--- a/.hgtags Fri Nov 08 16:48:20 2019 -0500
+++ b/.hgtags Fri Nov 08 20:41:14 2019 -0500
@@ -594,3 +594,4 @@
9b67dd88a9313e982ec5f710a7747161bc8f0c23 jdk-14+19
54ffb15c48399dd59922ee22bb592d815307e77c jdk-14+20
c16ac7a2eba4e73cb4f7ee9294dd647860eebff0 jdk-14+21
+83810b7d12e7ff761ad3dd91f323a22dad96f108 jdk-14+22
--- a/doc/testing.html Fri Nov 08 16:48:20 2019 -0500
+++ b/doc/testing.html Fri Nov 08 20:41:14 2019 -0500
@@ -43,6 +43,7 @@
<li><a href="#docker-tests">Docker Tests</a></li>
<li><a href="#non-us-locale">Non-US locale</a></li>
<li><a href="#pkcs11-tests">PKCS11 Tests</a></li>
+<li><a href="#client-ui-tests">Client UI Tests</a></li>
</ul></li>
</ul>
</nav>
@@ -207,5 +208,15 @@
<p>It is highly recommended to use the latest NSS version when running PKCS11 tests. Improper NSS version may lead to unexpected failures which are hard to diagnose. For example, sun/security/pkcs11/Secmod/AddTrustedCert.java may fail on Ubuntu 18.04 with the default NSS version in the system. To run these tests correctly, the system property <code>test.nss.lib.paths</code> is required on Ubuntu 18.04 to specify the alternative NSS lib directories. For example:</p>
<pre><code>$ make test TEST="jtreg:sun/security/pkcs11/Secmod/AddTrustedCert.java" JTREG="JAVA_OPTIONS=-Dtest.nss.lib.paths=/path/to/your/latest/NSS-libs"</code></pre>
<p>For more notes about the PKCS11 tests, please refer to test/jdk/sun/security/pkcs11/README.</p>
+<h3 id="client-ui-tests">Client UI Tests</h3>
+<p>Some Client UI tests use key sequences which may be reserved by the operating system. Usually that causes the test failure. So it is highly recommended to disable system key shortcuts prior testing. The steps to access and disable system key shortcuts for various platforms are provided below.</p>
+<h4 id="macos">MacOS</h4>
+<p>Choose Apple menu; System Preferences, click Keyboard, then click Shortcuts; select or deselect desired shortcut.</p>
+<p>For example, test/jdk/javax/swing/TooltipManager/JMenuItemToolTipKeyBindingsTest/JMenuItemToolTipKeyBindingsTest.java fails on MacOS because it uses <code>CTRL + F1</code> key sequence to show or hide tooltip message but the key combination is reserved by the operating system. To run the test correctly the default global key shortcut should be disabled using the steps described above, and then deselect "Turn keyboard access on or off" option which is responsible for <code>CTRL + F1</code> combination.</p>
+<h4 id="linux">Linux</h4>
+<p>Open the Activities overview and start typing Settings; Choose Settings, click Devices, then click Keyboard; set or override desired shortcut.</p>
+<h4 id="windows">Windows</h4>
+<p>Type <code>gpedit</code> in the Search and then click Edit group policy; navigate to User Configuration -> Administrative Templates -> Windows Components -> File Explorer; in the right-side pane look for "Turn off Windows key hotkeys" and double click on it; enable or disable hotkeys.</p>
+<p>Note: restart is required to make the settings take effect.</p>
</body>
</html>
--- a/doc/testing.md Fri Nov 08 16:48:20 2019 -0500
+++ b/doc/testing.md Fri Nov 08 20:41:14 2019 -0500
@@ -421,6 +421,35 @@
For more notes about the PKCS11 tests, please refer to test/jdk/sun/security/pkcs11/README.
+### Client UI Tests
+
+Some Client UI tests use key sequences which may be reserved by the operating
+system. Usually that causes the test failure. So it is highly recommended to disable
+system key shortcuts prior testing. The steps to access and disable system key shortcuts
+for various platforms are provided below.
+
+#### MacOS
+Choose Apple menu; System Preferences, click Keyboard, then click Shortcuts;
+select or deselect desired shortcut.
+
+For example, test/jdk/javax/swing/TooltipManager/JMenuItemToolTipKeyBindingsTest/JMenuItemToolTipKeyBindingsTest.java fails
+on MacOS because it uses `CTRL + F1` key sequence to show or hide tooltip message
+but the key combination is reserved by the operating system. To run the test correctly
+the default global key shortcut should be disabled using the steps described above, and then deselect
+"Turn keyboard access on or off" option which is responsible for `CTRL + F1` combination.
+
+#### Linux
+Open the Activities overview and start typing Settings; Choose Settings, click Devices,
+then click Keyboard; set or override desired shortcut.
+
+#### Windows
+Type `gpedit` in the Search and then click Edit group policy; navigate to
+User Configuration -> Administrative Templates -> Windows Components -> File Explorer;
+in the right-side pane look for "Turn off Windows key hotkeys" and double click on it;
+enable or disable hotkeys.
+
+Note: restart is required to make the settings take effect.
+
---
# Override some definitions in the global css file that are not optimal for
# this document.
--- a/make/Docs.gmk Fri Nov 08 16:48:20 2019 -0500
+++ b/make/Docs.gmk Fri Nov 08 20:41:14 2019 -0500
@@ -138,9 +138,9 @@
ifeq ($(IS_DRAFT), true)
DRAFT_MARKER_STR := <br><strong>DRAFT $(VERSION_STRING)</strong>
ifeq ($(VERSION_BUILD), 0)
- DRAFT_MARKER_TITLE := [ad-hoc build]
+ DRAFT_MARKER_TITLE := $(SPACE)[ad-hoc build]
else
- DRAFT_MARKER_TITLE := [build $(VERSION_BUILD)]
+ DRAFT_MARKER_TITLE := $(SPACE)[build $(VERSION_BUILD)]
endif
DRAFT_TEXT := This specification is not final and is subject to change. \
Use is subject to <a href="$(LICENSE_URL)">license terms</a>.
@@ -304,7 +304,7 @@
$1_DOC_TITLE := $$($1_LONG_NAME)<br>Version $$(VERSION_SPECIFICATION) API \
Specification
- $1_WINDOW_TITLE := $$(subst &,&,$$($1_SHORT_NAME)) $$(DRAFT_MARKER_TITLE)
+ $1_WINDOW_TITLE := $$(subst &,&,$$($1_SHORT_NAME))$$(DRAFT_MARKER_TITLE)
$1_HEADER_TITLE := <div $$(HEADER_STYLE)><strong>$$($1_SHORT_NAME)</strong> \
$$(DRAFT_MARKER_STR)</div>
--- a/make/hotspot/symbols/symbols-unix Fri Nov 08 16:48:20 2019 -0500
+++ b/make/hotspot/symbols/symbols-unix Fri Nov 08 20:41:14 2019 -0500
@@ -148,7 +148,6 @@
JVM_IsThreadAlive
JVM_IsVMGeneratedMethodIx
JVM_LatestUserDefinedLoader
-JVM_LinkClass
JVM_LoadLibrary
JVM_MaxMemory
JVM_MaxObjectInspectionAge
--- a/make/jdk/src/classes/build/tools/cldrconverter/Bundle.java Fri Nov 08 16:48:20 2019 -0500
+++ b/make/jdk/src/classes/build/tools/cldrconverter/Bundle.java Fri Nov 08 20:41:14 2019 -0500
@@ -391,26 +391,23 @@
}
private void handleMultipleInheritance(Map<String, Object> map, Map<String, Object> parents, String key) {
- String formatKey = key + "/format";
- Object format = map.get(formatKey);
+ String formatMapKey = key + "/format";
+ Object format = map.get(formatMapKey);
if (format != null) {
- map.remove(formatKey);
+ map.remove(formatMapKey);
map.put(key, format);
- if (fillInElements(parents, formatKey, format)) {
+ if (fillInElements(parents, formatMapKey, format)) {
map.remove(key);
}
}
- String standaloneKey = key + "/stand-alone";
- Object standalone = map.get(standaloneKey);
+ String standaloneMapKey = key + "/stand-alone";
+ Object standalone = map.get(standaloneMapKey);
if (standalone != null) {
- map.remove(standaloneKey);
- String realKey = key;
- if (format != null) {
- realKey = "standalone." + key;
- }
- map.put(realKey, standalone);
- if (fillInElements(parents, standaloneKey, standalone)) {
- map.remove(realKey);
+ map.remove(standaloneMapKey);
+ String standaloneResourceKey = "standalone." + key;
+ map.put(standaloneResourceKey, standalone);
+ if (fillInElements(parents, standaloneMapKey, standalone)) {
+ map.remove(standaloneResourceKey);
}
}
}
--- a/make/lib/Lib-jdk.hotspot.agent.gmk Fri Nov 08 16:48:20 2019 -0500
+++ b/make/lib/Lib-jdk.hotspot.agent.gmk Fri Nov 08 20:41:14 2019 -0500
@@ -55,7 +55,7 @@
SA_TOOLCHAIN := $(TOOLCHAIN_DEFAULT)
ifeq ($(call isTargetOs, linux), true)
- SA_TOOLCHAIN := TOOLCHAIN_BUILD_LINK_CXX
+ SA_TOOLCHAIN := TOOLCHAIN_LINK_CXX
endif
################################################################################
--- a/src/hotspot/cpu/aarch64/c1_LIRAssembler_aarch64.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/aarch64/c1_LIRAssembler_aarch64.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -1978,6 +1978,9 @@
case T_ADDRESS:
imm = opr2->as_constant_ptr()->as_jint();
break;
+ case T_METADATA:
+ imm = (intptr_t)(opr2->as_constant_ptr()->as_metadata());
+ break;
case T_OBJECT:
case T_ARRAY:
jobject2reg(opr2->as_constant_ptr()->as_jobject(), rscratch1);
--- a/src/hotspot/cpu/aarch64/c1_Runtime1_aarch64.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/aarch64/c1_Runtime1_aarch64.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -840,6 +840,7 @@
__ sub(arr_size, arr_size, t1); // body length
__ add(t1, t1, obj); // body start
__ initialize_body(t1, arr_size, 0, t2);
+ __ membar(Assembler::StoreStore);
__ verify_oop(obj);
__ ret(lr);
--- a/src/hotspot/cpu/aarch64/gc/shenandoah/shenandoahBarrierSetAssembler_aarch64.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/aarch64/gc/shenandoah/shenandoahBarrierSetAssembler_aarch64.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -22,6 +22,7 @@
*/
#include "precompiled.hpp"
+#include "gc/shenandoah/shenandoahBarrierSet.hpp"
#include "gc/shenandoah/shenandoahBarrierSetAssembler.hpp"
#include "gc/shenandoah/shenandoahForwarding.hpp"
#include "gc/shenandoah/shenandoahHeap.inline.hpp"
@@ -253,32 +254,16 @@
dst = rscratch1;
}
- RegSet to_save_r1 = RegSet::of(r1);
- // If outgoing register is r1, we can clobber it
- if (result_dst != r1) {
- __ push(to_save_r1, sp);
- }
+ // Save r0 and r1, unless it is an output register
+ RegSet to_save = RegSet::of(r0, r1) - result_dst;
+ __ push(to_save, sp);
__ lea(r1, load_addr);
-
- RegSet to_save_r0 = RegSet::of(r0);
- if (dst != r0) {
- __ push(to_save_r0, sp);
- __ mov(r0, dst);
- }
+ __ mov(r0, dst);
__ far_call(RuntimeAddress(CAST_FROM_FN_PTR(address, ShenandoahBarrierSetAssembler::shenandoah_lrb())));
- if (result_dst != r0) {
- __ mov(result_dst, r0);
- }
-
- if (dst != r0) {
- __ pop(to_save_r0, sp);
- }
-
- if (result_dst != r1) {
- __ pop(to_save_r1, sp);
- }
+ __ mov(result_dst, r0);
+ __ pop(to_save, sp);
__ bind(done);
__ leave();
@@ -346,29 +331,42 @@
}
}
+//
+// Arguments:
+//
+// Inputs:
+// src: oop location to load from, might be clobbered
+//
+// Output:
+// dst: oop loaded from src location
+//
+// Kill:
+// rscratch1 (scratch reg)
+//
+// Alias:
+// dst: rscratch1 (might use rscratch1 as temporary output register to avoid clobbering src)
+//
void ShenandoahBarrierSetAssembler::load_at(MacroAssembler* masm, DecoratorSet decorators, BasicType type,
Register dst, Address src, Register tmp1, Register tmp_thread) {
- bool on_oop = is_reference_type(type);
- bool not_in_heap = (decorators & IN_NATIVE) != 0;
- bool on_weak = (decorators & ON_WEAK_OOP_REF) != 0;
- bool on_phantom = (decorators & ON_PHANTOM_OOP_REF) != 0;
- bool on_reference = on_weak || on_phantom;
- bool is_traversal_mode = ShenandoahHeap::heap()->is_traversal_mode();
- bool keep_alive = (decorators & AS_NO_KEEPALIVE) == 0 || is_traversal_mode;
+ // 1: non-reference load, no additional barrier is needed
+ if (!is_reference_type(type)) {
+ BarrierSetAssembler::load_at(masm, decorators, type, dst, src, tmp1, tmp_thread);
+ return;
+ }
- Register result_dst = dst;
+ // 2: load a reference from src location and apply LRB if needed
+ if (ShenandoahBarrierSet::need_load_reference_barrier(decorators, type)) {
+ Register result_dst = dst;
- if (on_oop) {
- // We want to preserve src
+ // Preserve src location for LRB
if (dst == src.base() || dst == src.index()) {
dst = rscratch1;
}
assert_different_registers(dst, src.base(), src.index());
- }
- BarrierSetAssembler::load_at(masm, decorators, type, dst, src, tmp1, tmp_thread);
- if (on_oop) {
- if (not_in_heap && !is_traversal_mode) {
+ BarrierSetAssembler::load_at(masm, decorators, type, dst, src, tmp1, tmp_thread);
+
+ if (ShenandoahBarrierSet::use_load_reference_barrier_native(decorators, type)) {
load_reference_barrier_native(masm, dst, src);
} else {
load_reference_barrier(masm, dst, src);
@@ -378,18 +376,21 @@
__ mov(result_dst, dst);
dst = result_dst;
}
+ } else {
+ BarrierSetAssembler::load_at(masm, decorators, type, dst, src, tmp1, tmp_thread);
+ }
- if (ShenandoahKeepAliveBarrier && on_reference && keep_alive) {
- __ enter();
- satb_write_barrier_pre(masm /* masm */,
- noreg /* obj */,
- dst /* pre_val */,
- rthread /* thread */,
- tmp1 /* tmp */,
- true /* tosca_live */,
- true /* expand_call */);
- __ leave();
- }
+ // 3: apply keep-alive barrier if needed
+ if (ShenandoahBarrierSet::need_keep_alive_barrier(decorators, type)) {
+ __ enter();
+ satb_write_barrier_pre(masm /* masm */,
+ noreg /* obj */,
+ dst /* pre_val */,
+ rthread /* thread */,
+ tmp1 /* tmp */,
+ true /* tosca_live */,
+ true /* expand_call */);
+ __ leave();
}
}
--- a/src/hotspot/cpu/aarch64/nativeInst_aarch64.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/aarch64/nativeInst_aarch64.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -287,8 +287,6 @@
//-------------------------------------------------------------------
-address NativeMovRegMem::instruction_address() const { return addr_at(instruction_offset); }
-
int NativeMovRegMem::offset() const {
address pc = instruction_address();
unsigned insn = *(unsigned*)pc;
--- a/src/hotspot/cpu/aarch64/nativeInst_aarch64.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/aarch64/nativeInst_aarch64.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -381,11 +381,11 @@
public:
// helper
- int instruction_start() const;
+ int instruction_start() const { return instruction_offset; }
- address instruction_address() const;
+ address instruction_address() const { return addr_at(instruction_offset); }
- address next_instruction_address() const;
+ int num_bytes_to_end_of_patch() const { return instruction_offset + instruction_size; }
int offset() const;
--- a/src/hotspot/cpu/aarch64/templateInterpreterGenerator_aarch64.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/aarch64/templateInterpreterGenerator_aarch64.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -285,7 +285,6 @@
}
break;
case Interpreter::java_lang_math_pow :
- fpargs = 2;
if (StubRoutines::dpow() == NULL) {
fn = CAST_FROM_FN_PTR(address, SharedRuntime::dpow);
} else {
--- a/src/hotspot/cpu/arm/c1_LIRAssembler_arm.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/arm/c1_LIRAssembler_arm.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -1817,6 +1817,11 @@
assert(opr2->as_constant_ptr()->as_jobject() == NULL, "cannot handle otherwise");
__ cmp(opr1->as_register(), 0);
break;
+ case T_METADATA:
+ assert(condition == lir_cond_equal || condition == lir_cond_notEqual, "Only equality tests");
+ assert(opr2->as_constant_ptr()->as_metadata() == NULL, "cannot handle otherwise");
+ __ cmp(opr1->as_register(), 0);
+ break;
default:
ShouldNotReachHere();
}
--- a/src/hotspot/cpu/arm/c1_LIRGenerator_arm.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/arm/c1_LIRGenerator_arm.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -1310,9 +1310,16 @@
CodeEmitInfo* info) {
if (value->is_double_cpu()) {
assert(address->index()->is_illegal(), "should have a constant displacement");
- LIR_Opr tmp = new_pointer_register();
- add_large_constant(address->base(), address->disp(), tmp);
- __ volatile_store_mem_reg(value, new LIR_Address(tmp, (intx)0, address->type()), info);
+ LIR_Address* store_addr = NULL;
+ if (address->disp() != 0) {
+ LIR_Opr tmp = new_pointer_register();
+ add_large_constant(address->base(), address->disp(), tmp);
+ store_addr = new LIR_Address(tmp, (intx)0, address->type());
+ } else {
+ // address->disp() can be 0, if the address is referenced using the unsafe intrinsic
+ store_addr = address;
+ }
+ __ volatile_store_mem_reg(value, store_addr, info);
return;
}
__ store(value, address, info, lir_patch_none);
@@ -1322,9 +1329,16 @@
CodeEmitInfo* info) {
if (result->is_double_cpu()) {
assert(address->index()->is_illegal(), "should have a constant displacement");
- LIR_Opr tmp = new_pointer_register();
- add_large_constant(address->base(), address->disp(), tmp);
- __ volatile_load_mem_reg(new LIR_Address(tmp, (intx)0, address->type()), result, info);
+ LIR_Address* load_addr = NULL;
+ if (address->disp() != 0) {
+ LIR_Opr tmp = new_pointer_register();
+ add_large_constant(address->base(), address->disp(), tmp);
+ load_addr = new LIR_Address(tmp, (intx)0, address->type());
+ } else {
+ // address->disp() can be 0, if the address is referenced using the unsafe intrinsic
+ load_addr = address;
+ }
+ __ volatile_load_mem_reg(load_addr, result, info);
return;
}
__ load(address, result, info, lir_patch_none);
--- a/src/hotspot/cpu/arm/nativeInst_arm_32.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/arm/nativeInst_arm_32.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -349,6 +349,11 @@
// (field access patching is handled differently in that case)
class NativeMovRegMem: public NativeInstruction {
public:
+ enum arm_specific_constants {
+ instruction_size = 8
+ };
+
+ int num_bytes_to_end_of_patch() const { return instruction_size; }
int offset() const;
void set_offset(int x);
--- a/src/hotspot/cpu/arm/vtableStubs_arm.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/arm/vtableStubs_arm.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -1,5 +1,5 @@
/*
- * Copyright (c) 2008, 2018, Oracle and/or its affiliates. All rights reserved.
+ * Copyright (c) 2008, 2019, Oracle and/or its affiliates. All rights reserved.
* DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
*
* This code is free software; you can redistribute it and/or modify it
@@ -32,6 +32,7 @@
#include "oops/compiledICHolder.hpp"
#include "oops/instanceKlass.hpp"
#include "oops/klassVtable.hpp"
+#include "oops/klass.inline.hpp"
#include "runtime/sharedRuntime.hpp"
#include "vmreg_arm.inline.hpp"
#ifdef COMPILER2
--- a/src/hotspot/cpu/ppc/c1_LIRAssembler_ppc.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/ppc/c1_LIRAssembler_ppc.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -1467,6 +1467,19 @@
}
break;
+ case T_METADATA:
+ // We only need, for now, comparison with NULL for metadata.
+ {
+ assert(condition == lir_cond_equal || condition == lir_cond_notEqual, "oops");
+ Metadata* p = opr2->as_constant_ptr()->as_metadata();
+ if (p == NULL) {
+ __ cmpdi(BOOL_RESULT, opr1->as_register(), 0);
+ } else {
+ ShouldNotReachHere();
+ }
+ }
+ break;
+
default:
ShouldNotReachHere();
break;
--- a/src/hotspot/cpu/ppc/nativeInst_ppc.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/ppc/nativeInst_ppc.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -462,6 +462,8 @@
address instruction_address() const { return addr_at(0); }
+ int num_bytes_to_end_of_patch() const { return instruction_size; }
+
intptr_t offset() const {
#ifdef VM_LITTLE_ENDIAN
short *hi_ptr = (short*)(addr_at(0));
--- a/src/hotspot/cpu/s390/c1_LIRAssembler_s390.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/s390/c1_LIRAssembler_s390.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -1322,6 +1322,15 @@
} else {
__ z_cfi(reg1, c->as_jint());
}
+ } else if (c->type() == T_METADATA) {
+ // We only need, for now, comparison with NULL for metadata.
+ assert(condition == lir_cond_equal || condition == lir_cond_notEqual, "oops");
+ Metadata* m = c->as_metadata();
+ if (m == NULL) {
+ __ z_cghi(reg1, 0);
+ } else {
+ ShouldNotReachHere();
+ }
} else if (is_reference_type(c->type())) {
// In 64bit oops are single register.
jobject o = c->as_jobject();
--- a/src/hotspot/cpu/s390/compiledIC_s390.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/s390/compiledIC_s390.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -1,6 +1,6 @@
/*
* Copyright (c) 2016, 2019, Oracle and/or its affiliates. All rights reserved.
- * Copyright (c) 2016 SAP SE. All rights reserved.
+ * Copyright (c) 2016, 2019, SAP SE. All rights reserved.
* DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
*
* This code is free software; you can redistribute it and/or modify it
@@ -75,6 +75,7 @@
return stub;
#else
ShouldNotReachHere();
+ return NULL;
#endif
}
--- a/src/hotspot/cpu/s390/disassembler_s390.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/s390/disassembler_s390.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -28,8 +28,6 @@
#include "code/codeCache.hpp"
#include "compiler/disassembler.hpp"
#include "depChecker_s390.hpp"
-#include "gc/cms/concurrentMarkSweepGeneration.inline.hpp"
-#include "gc/cms/parOopClosures.inline.hpp"
#include "gc/shared/collectedHeap.hpp"
#include "gc/shared/cardTableBarrierSet.hpp"
#include "gc/shared/genOopClosures.inline.hpp"
--- a/src/hotspot/cpu/s390/macroAssembler_s390.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/s390/macroAssembler_s390.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -37,9 +37,11 @@
#include "oops/accessDecorators.hpp"
#include "oops/compressedOops.inline.hpp"
#include "oops/klass.inline.hpp"
+#ifdef COMPILER2
#include "opto/compile.hpp"
#include "opto/intrinsicnode.hpp"
#include "opto/matcher.hpp"
+#endif
#include "prims/methodHandles.hpp"
#include "registerSaver_s390.hpp"
#include "runtime/biasedLocking.hpp"
@@ -2925,7 +2927,7 @@
}
void MacroAssembler::nmethod_UEP(Label& ic_miss) {
- Register ic_reg = as_Register(Matcher::inline_cache_reg_encode());
+ Register ic_reg = Z_inline_cache;
int klass_offset = oopDesc::klass_offset_in_bytes();
if (!ImplicitNullChecks || MacroAssembler::needs_explicit_null_check(klass_offset)) {
if (VM_Version::has_CompareBranch()) {
@@ -4590,6 +4592,7 @@
return block_end - block_start;
}
+#ifdef COMPILER2
//------------------------------------------------------
// Special String Intrinsics. Implementation
//------------------------------------------------------
@@ -5837,7 +5840,7 @@
return offset() - block_start;
}
-
+#endif
//-------------------------------------------------
// Constants (scalar and oop) in constant pool
@@ -6150,96 +6153,6 @@
Assembler::z_brc(Assembler::bcondOverflow /* CC==3 (iterate) */, retry);
}
-
-void MacroAssembler::generate_type_profiling(const Register Rdata,
- const Register Rreceiver_klass,
- const Register Rwanted_receiver_klass,
- const Register Rmatching_row,
- bool is_virtual_call) {
- const int row_size = in_bytes(ReceiverTypeData::receiver_offset(1)) -
- in_bytes(ReceiverTypeData::receiver_offset(0));
- const int num_rows = ReceiverTypeData::row_limit();
- NearLabel found_free_row;
- NearLabel do_increment;
- NearLabel found_no_slot;
-
- BLOCK_COMMENT("type profiling {");
-
- // search for:
- // a) The type given in Rwanted_receiver_klass.
- // b) The *first* empty row.
-
- // First search for a) only, just running over b) with no regard.
- // This is possible because
- // wanted_receiver_class == receiver_class && wanted_receiver_class == 0
- // is never true (receiver_class can't be zero).
- for (int row_num = 0; row_num < num_rows; row_num++) {
- // Row_offset should be a well-behaved positive number. The generated code relies
- // on that wrt constant code size. Add2reg can handle all row_offset values, but
- // will have to vary generated code size.
- int row_offset = in_bytes(ReceiverTypeData::receiver_offset(row_num));
- assert(Displacement::is_shortDisp(row_offset), "Limitation of generated code");
-
- // Is Rwanted_receiver_klass in this row?
- if (VM_Version::has_CompareBranch()) {
- z_lg(Rwanted_receiver_klass, row_offset, Z_R0, Rdata);
- // Rmatching_row = Rdata + row_offset;
- add2reg(Rmatching_row, row_offset, Rdata);
- // if (*row_recv == (intptr_t) receiver_klass) goto fill_existing_slot;
- compare64_and_branch(Rwanted_receiver_klass, Rreceiver_klass, Assembler::bcondEqual, do_increment);
- } else {
- add2reg(Rmatching_row, row_offset, Rdata);
- z_cg(Rreceiver_klass, row_offset, Z_R0, Rdata);
- z_bre(do_increment);
- }
- }
-
- // Now that we did not find a match, let's search for b).
-
- // We could save the first calculation of Rmatching_row if we woud search for a) in reverse order.
- // We would then end up here with Rmatching_row containing the value for row_num == 0.
- // We would not see much benefit, if any at all, because the CPU can schedule
- // two instructions together with a branch anyway.
- for (int row_num = 0; row_num < num_rows; row_num++) {
- int row_offset = in_bytes(ReceiverTypeData::receiver_offset(row_num));
-
- // Has this row a zero receiver_klass, i.e. is it empty?
- if (VM_Version::has_CompareBranch()) {
- z_lg(Rwanted_receiver_klass, row_offset, Z_R0, Rdata);
- // Rmatching_row = Rdata + row_offset
- add2reg(Rmatching_row, row_offset, Rdata);
- // if (*row_recv == (intptr_t) 0) goto found_free_row
- compare64_and_branch(Rwanted_receiver_klass, (intptr_t)0, Assembler::bcondEqual, found_free_row);
- } else {
- add2reg(Rmatching_row, row_offset, Rdata);
- load_and_test_long(Rwanted_receiver_klass, Address(Rdata, row_offset));
- z_bre(found_free_row); // zero -> Found a free row.
- }
- }
-
- // No match, no empty row found.
- // Increment total counter to indicate polymorphic case.
- if (is_virtual_call) {
- add2mem_64(Address(Rdata, CounterData::count_offset()), 1, Rmatching_row);
- }
- z_bru(found_no_slot);
-
- // Here we found an empty row, but we have not found Rwanted_receiver_klass.
- // Rmatching_row holds the address to the first empty row.
- bind(found_free_row);
- // Store receiver_klass into empty slot.
- z_stg(Rreceiver_klass, 0, Z_R0, Rmatching_row);
-
- // Increment the counter of Rmatching_row.
- bind(do_increment);
- ByteSize counter_offset = ReceiverTypeData::receiver_count_offset(0) - ReceiverTypeData::receiver_offset(0);
- add2mem_64(Address(Rmatching_row, counter_offset), 1, Rdata);
-
- bind(found_no_slot);
-
- BLOCK_COMMENT("} type profiling");
-}
-
//---------------------------------------
// Helpers for Intrinsic Emitters
//---------------------------------------
--- a/src/hotspot/cpu/s390/macroAssembler_s390.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/s390/macroAssembler_s390.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -850,6 +850,7 @@
// Kills: tmp, Z_R0, Z_R1.
// Early clobber: result.
// Boolean precise controls accuracy of result value.
+#ifdef COMPILER2
unsigned int string_compress(Register result, Register src, Register dst, Register cnt,
Register tmp, bool precise);
@@ -885,6 +886,7 @@
unsigned int string_indexof_char(Register result, Register haystack, Register haycnt,
Register needle, jchar needleChar, Register odd_reg, Register even_reg, bool is_byte);
+#endif
// Emit an oop const to the constant pool and set a relocation info
// with address current_pc. Return the TOC offset of the constant.
@@ -918,13 +920,6 @@
// Offset is +/- 2**32 -> use long.
static long get_load_const_from_toc_offset(address a);
-
- void generate_type_profiling(const Register Rdata,
- const Register Rreceiver_klass,
- const Register Rwanted_receiver_klass,
- const Register Rmatching_row,
- bool is_virtual_call);
-
// Bit operations for single register operands.
inline void lshift(Register r, int places, bool doubl = true); // <<
inline void rshift(Register r, int places, bool doubl = true); // >>
--- a/src/hotspot/cpu/s390/nativeInst_s390.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/s390/nativeInst_s390.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -535,6 +535,12 @@
inline NativeMovRegMem* nativeMovRegMem_at (address address);
class NativeMovRegMem: public NativeInstruction {
public:
+ enum z_specific_constants {
+ instruction_size = 12 // load_const used with access_field_id
+ };
+
+ int num_bytes_to_end_of_patch() const { return instruction_size; }
+
intptr_t offset() const {
return nativeMovConstReg_at(addr_at(0))->data();
}
--- a/src/hotspot/cpu/s390/sharedRuntime_s390.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/s390/sharedRuntime_s390.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -32,6 +32,7 @@
#include "interpreter/interpreter.hpp"
#include "interpreter/interp_masm.hpp"
#include "memory/resourceArea.hpp"
+#include "nativeInst_s390.hpp"
#include "oops/compiledICHolder.hpp"
#include "oops/klass.inline.hpp"
#include "registerSaver_s390.hpp"
@@ -1521,7 +1522,6 @@
VMRegPair *in_regs,
BasicType ret_type,
address critical_entry) {
-#ifdef COMPILER2
int total_in_args = method->size_of_parameters();
if (method->is_method_handle_intrinsic()) {
vmIntrinsics::ID iid = method->intrinsic_id();
@@ -2401,10 +2401,6 @@
}
return nm;
-#else
- ShouldNotReachHere();
- return NULL;
-#endif // COMPILER2
}
static address gen_c2i_adapter(MacroAssembler *masm,
@@ -2880,7 +2876,7 @@
// to Deoptimization::fetch_unroll_info below.
// The (int) cast is necessary, because -((unsigned int)14)
// is an unsigned int.
- __ add2reg(Z_R14, -(int)HandlerImpl::size_deopt_handler());
+ __ add2reg(Z_R14, -(int)NativeCall::max_instruction_size());
const Register exec_mode_reg = Z_tmp_1;
--- a/src/hotspot/cpu/s390/vm_version_s390.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/s390/vm_version_s390.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -61,7 +61,9 @@
intx cache_line_size = Dcache_lineSize(0);
+#ifdef COMPILER2
MaxVectorSize = 8;
+#endif
if (has_PrefetchRaw()) {
if (FLAG_IS_DEFAULT(AllocatePrefetchStyle)) { // not preset
@@ -217,6 +219,7 @@
FLAG_SET_DEFAULT(UseSHA, false);
}
+#ifdef COMPILER2
if (FLAG_IS_DEFAULT(UseMultiplyToLenIntrinsic)) {
FLAG_SET_DEFAULT(UseMultiplyToLenIntrinsic, true);
}
@@ -226,6 +229,7 @@
if (FLAG_IS_DEFAULT(UseMontgomerySquareIntrinsic)) {
FLAG_SET_DEFAULT(UseMontgomerySquareIntrinsic, true);
}
+#endif
if (FLAG_IS_DEFAULT(UsePopCountInstruction)) {
FLAG_SET_DEFAULT(UsePopCountInstruction, true);
}
--- a/src/hotspot/cpu/sparc/c1_LIRAssembler_sparc.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/sparc/c1_LIRAssembler_sparc.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -1511,6 +1511,18 @@
}
break;
+ case T_METADATA:
+ // We only need, for now, comparison with NULL for metadata.
+ { assert(condition == lir_cond_equal || condition == lir_cond_notEqual, "oops");
+ Metadata* m = opr2->as_constant_ptr()->as_metadata();
+ if (m == NULL) {
+ __ cmp(opr1->as_register(), 0);
+ } else {
+ ShouldNotReachHere();
+ }
+ }
+ break;
+
default:
ShouldNotReachHere();
break;
--- a/src/hotspot/cpu/sparc/nativeInst_sparc.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/sparc/nativeInst_sparc.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -574,15 +574,6 @@
//-------------------------------------------------------------------
-void NativeMovRegMem::copy_instruction_to(address new_instruction_address) {
- Untested("copy_instruction_to");
- int instruction_size = next_instruction_address() - instruction_address();
- for (int i = 0; i < instruction_size; i += BytesPerInstWord) {
- *(int*)(new_instruction_address + i) = *(int*)(address(this) + i);
- }
-}
-
-
void NativeMovRegMem::verify() {
NativeInstruction::verify();
// make sure code pattern is actually a "ld" or "st" of some sort.
--- a/src/hotspot/cpu/sparc/nativeInst_sparc.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/sparc/nativeInst_sparc.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -576,7 +576,8 @@
// sethi and the add. The nop is required to be in the delay slot of the call instruction
// which overwrites the sethi during patching.
class NativeMovConstRegPatching;
-inline NativeMovConstRegPatching* nativeMovConstRegPatching_at(address address);class NativeMovConstRegPatching: public NativeInstruction {
+inline NativeMovConstRegPatching* nativeMovConstRegPatching_at(address address);
+class NativeMovConstRegPatching: public NativeInstruction {
public:
enum Sparc_specific_constants {
sethi_offset = 0,
@@ -664,10 +665,13 @@
return (is_op(i0, Assembler::ldst_op));
}
- address instruction_address() const { return addr_at(0); }
- address next_instruction_address() const {
- return addr_at(is_immediate() ? 4 : (7 * BytesPerInstWord));
+ address instruction_address() const { return addr_at(0); }
+
+ int num_bytes_to_end_of_patch() const {
+ return is_immediate()? BytesPerInstWord :
+ NativeMovConstReg::instruction_size;
}
+
intptr_t offset() const {
return is_immediate()? inv_simm(long_at(0), offset_width) :
nativeMovConstReg_at(addr_at(0))->data();
@@ -684,8 +688,6 @@
set_offset (offset() + radd_offset);
}
- void copy_instruction_to(address new_instruction_address);
-
void verify();
void print ();
--- a/src/hotspot/cpu/x86/assembler_x86.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/x86/assembler_x86.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -4227,7 +4227,7 @@
void Assembler::vpshufb(XMMRegister dst, XMMRegister nds, XMMRegister src, int vector_len) {
assert(vector_len == AVX_128bit? VM_Version::supports_avx() :
vector_len == AVX_256bit? VM_Version::supports_avx2() :
- 0, "");
+ vector_len == AVX_512bit? VM_Version::supports_avx512bw() : 0, "");
InstructionAttr attributes(vector_len, /* rex_w */ false, /* legacy_mode */ _legacy_mode_bw, /* no_mask_reg */ true, /* uses_vl */ true);
int encode = simd_prefix_and_encode(dst, nds, src, VEX_SIMD_66, VEX_OPCODE_0F_38, &attributes);
emit_int8(0x00);
@@ -7197,7 +7197,6 @@
emit_int8(0x7C);
emit_int8((unsigned char)(0xC0 | encode));
}
-
void Assembler::evpgatherdd(XMMRegister dst, KRegister mask, Address src, int vector_len) {
assert(VM_Version::supports_evex(), "");
assert(dst != xnoreg, "sanity");
@@ -7212,7 +7211,6 @@
emit_int8((unsigned char)0x90);
emit_operand(dst, src);
}
-
// Carry-Less Multiplication Quadword
void Assembler::pclmulqdq(XMMRegister dst, XMMRegister src, int mask) {
assert(VM_Version::supports_clmul(), "");
--- a/src/hotspot/cpu/x86/c1_LIRAssembler_x86.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/x86/c1_LIRAssembler_x86.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -2641,6 +2641,15 @@
LIR_Const* c = opr2->as_constant_ptr();
if (c->type() == T_INT) {
__ cmpl(reg1, c->as_jint());
+ } else if (c->type() == T_METADATA) {
+ // All we need for now is a comparison with NULL for equality.
+ assert(condition == lir_cond_equal || condition == lir_cond_notEqual, "oops");
+ Metadata* m = c->as_metadata();
+ if (m == NULL) {
+ __ cmpptr(reg1, (int32_t)0);
+ } else {
+ ShouldNotReachHere();
+ }
} else if (is_reference_type(c->type())) {
// In 64bit oops are single register
jobject o = c->as_jobject();
--- a/src/hotspot/cpu/x86/gc/shenandoah/shenandoahBarrierSetAssembler_x86.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/x86/gc/shenandoah/shenandoahBarrierSetAssembler_x86.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -22,6 +22,7 @@
*/
#include "precompiled.hpp"
+#include "gc/shenandoah/shenandoahBarrierSet.hpp"
#include "gc/shenandoah/shenandoahBarrierSetAssembler.hpp"
#include "gc/shenandoah/shenandoahForwarding.hpp"
#include "gc/shenandoah/shenandoahHeap.inline.hpp"
@@ -445,21 +446,35 @@
}
}
+//
+// Arguments:
+//
+// Inputs:
+// src: oop location, might be clobbered
+// tmp1: scratch register, might not be valid.
+//
+// Output:
+// dst: oop loaded from src location
+//
+// Kill:
+// tmp1 (if it is valid)
+//
void ShenandoahBarrierSetAssembler::load_at(MacroAssembler* masm, DecoratorSet decorators, BasicType type,
Register dst, Address src, Register tmp1, Register tmp_thread) {
- bool on_oop = is_reference_type(type);
- bool on_weak = (decorators & ON_WEAK_OOP_REF) != 0;
- bool on_phantom = (decorators & ON_PHANTOM_OOP_REF) != 0;
- bool not_in_heap = (decorators & IN_NATIVE) != 0;
- bool on_reference = on_weak || on_phantom;
- bool is_traversal_mode = ShenandoahHeap::heap()->is_traversal_mode();
- bool keep_alive = ((decorators & AS_NO_KEEPALIVE) == 0) || is_traversal_mode;
+ // 1: non-reference load, no additional barrier is needed
+ if (!is_reference_type(type)) {
+ BarrierSetAssembler::load_at(masm, decorators, type, dst, src, tmp1, tmp_thread);
+ return;
+ }
- Register result_dst = dst;
- bool use_tmp1_for_dst = false;
+ assert((decorators & ON_UNKNOWN_OOP_REF) == 0, "Not expected");
- if (on_oop) {
- // We want to preserve src
+ // 2: load a reference from src location and apply LRB if needed
+ if (ShenandoahBarrierSet::need_load_reference_barrier(decorators, type)) {
+ Register result_dst = dst;
+ bool use_tmp1_for_dst = false;
+
+ // Preserve src location for LRB
if (dst == src.base() || dst == src.index()) {
// Use tmp1 for dst if possible, as it is not used in BarrierAssembler::load_at()
if (tmp1->is_valid() && tmp1 != src.base() && tmp1 != src.index()) {
@@ -469,19 +484,18 @@
dst = rdi;
__ push(dst);
}
+ assert_different_registers(dst, src.base(), src.index());
}
- assert_different_registers(dst, src.base(), src.index());
- }
- BarrierSetAssembler::load_at(masm, decorators, type, dst, src, tmp1, tmp_thread);
+ BarrierSetAssembler::load_at(masm, decorators, type, dst, src, tmp1, tmp_thread);
- if (on_oop) {
- if (not_in_heap && !is_traversal_mode) {
+ if (ShenandoahBarrierSet::use_load_reference_barrier_native(decorators, type)) {
load_reference_barrier_native(masm, dst, src);
} else {
load_reference_barrier(masm, dst, src);
}
+ // Move loaded oop to final destination
if (dst != result_dst) {
__ movptr(result_dst, dst);
@@ -491,21 +505,24 @@
dst = result_dst;
}
+ } else {
+ BarrierSetAssembler::load_at(masm, decorators, type, dst, src, tmp1, tmp_thread);
+ }
- if (ShenandoahKeepAliveBarrier && on_reference && keep_alive) {
- const Register thread = NOT_LP64(tmp_thread) LP64_ONLY(r15_thread);
- assert_different_registers(dst, tmp1, tmp_thread);
- NOT_LP64(__ get_thread(thread));
- // Generate the SATB pre-barrier code to log the value of
- // the referent field in an SATB buffer.
- shenandoah_write_barrier_pre(masm /* masm */,
- noreg /* obj */,
- dst /* pre_val */,
- thread /* thread */,
- tmp1 /* tmp */,
- true /* tosca_live */,
- true /* expand_call */);
- }
+ // 3: apply keep-alive barrier if needed
+ if (ShenandoahBarrierSet::need_keep_alive_barrier(decorators, type)) {
+ const Register thread = NOT_LP64(tmp_thread) LP64_ONLY(r15_thread);
+ assert_different_registers(dst, tmp1, tmp_thread);
+ NOT_LP64(__ get_thread(thread));
+ // Generate the SATB pre-barrier code to log the value of
+ // the referent field in an SATB buffer.
+ shenandoah_write_barrier_pre(masm /* masm */,
+ noreg /* obj */,
+ dst /* pre_val */,
+ thread /* thread */,
+ tmp1 /* tmp */,
+ true /* tosca_live */,
+ true /* expand_call */);
}
}
--- a/src/hotspot/cpu/x86/macroAssembler_x86.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/x86/macroAssembler_x86.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -3770,6 +3770,16 @@
}
}
+void MacroAssembler::vpaddd(XMMRegister dst, XMMRegister nds, AddressLiteral src, int vector_len, Register rscratch) {
+ assert(UseAVX > 0, "requires some form of AVX");
+ if (reachable(src)) {
+ Assembler::vpaddd(dst, nds, as_Address(src), vector_len);
+ } else {
+ lea(rscratch, src);
+ Assembler::vpaddd(dst, nds, Address(rscratch, 0), vector_len);
+ }
+}
+
void MacroAssembler::vabsss(XMMRegister dst, XMMRegister nds, XMMRegister src, AddressLiteral negate_field, int vector_len) {
assert(((dst->encoding() < 16 && src->encoding() < 16 && nds->encoding() < 16) || VM_Version::supports_avx512vldq()),"XMM register should be 0-15");
vandps(dst, nds, negate_field, vector_len);
--- a/src/hotspot/cpu/x86/macroAssembler_x86.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/x86/macroAssembler_x86.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -993,6 +993,8 @@
public:
void aesecb_encrypt(Register source_addr, Register dest_addr, Register key, Register len);
void aesecb_decrypt(Register source_addr, Register dest_addr, Register key, Register len);
+ void aesctr_encrypt(Register src_addr, Register dest_addr, Register key, Register counter,
+ Register len_reg, Register used, Register used_addr, Register saved_encCounter_start);
#endif
@@ -1238,6 +1240,10 @@
void vpaddw(XMMRegister dst, XMMRegister nds, XMMRegister src, int vector_len);
void vpaddw(XMMRegister dst, XMMRegister nds, Address src, int vector_len);
+ void vpaddd(XMMRegister dst, XMMRegister nds, XMMRegister src, int vector_len) { Assembler::vpaddd(dst, nds, src, vector_len); }
+ void vpaddd(XMMRegister dst, XMMRegister nds, Address src, int vector_len) { Assembler::vpaddd(dst, nds, src, vector_len); }
+ void vpaddd(XMMRegister dst, XMMRegister nds, AddressLiteral src, int vector_len, Register rscratch);
+
void vpand(XMMRegister dst, XMMRegister nds, XMMRegister src, int vector_len) { Assembler::vpand(dst, nds, src, vector_len); }
void vpand(XMMRegister dst, XMMRegister nds, Address src, int vector_len) { Assembler::vpand(dst, nds, src, vector_len); }
void vpand(XMMRegister dst, XMMRegister nds, AddressLiteral src, int vector_len, Register scratch_reg = rscratch1);
--- a/src/hotspot/cpu/x86/macroAssembler_x86_aes.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/x86/macroAssembler_x86_aes.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -1,5 +1,5 @@
/*
-* Copyright (c) 2018, Intel Corporation.
+* Copyright (c) 2019, Intel Corporation.
*
* DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
*
@@ -778,4 +778,493 @@
vpxor(xmm3, xmm3, xmm3, Assembler::AVX_128bit);
vpxor(xmm15, xmm15, xmm15, Assembler::AVX_128bit);
}
+
+// AES Counter Mode using VAES instructions
+void MacroAssembler::aesctr_encrypt(Register src_addr, Register dest_addr, Register key, Register counter,
+ Register len_reg, Register used, Register used_addr, Register saved_encCounter_start) {
+
+ const Register rounds = 0;
+ const Register pos = r12;
+
+ Label PRELOOP_START, EXIT_PRELOOP, REMAINDER, REMAINDER_16, LOOP, END, EXIT, END_LOOP,
+ AES192, AES256, AES192_REMAINDER16, REMAINDER16_END_LOOP, AES256_REMAINDER16,
+ REMAINDER_8, REMAINDER_4, AES192_REMAINDER8, REMAINDER_LOOP, AES256_REMINDER,
+ AES192_REMAINDER, END_REMAINDER_LOOP, AES256_REMAINDER8, REMAINDER8_END_LOOP,
+ AES192_REMAINDER4, AES256_REMAINDER4, AES256_REMAINDER, END_REMAINDER4, EXTRACT_TAILBYTES,
+ EXTRACT_TAIL_4BYTES, EXTRACT_TAIL_2BYTES, EXTRACT_TAIL_1BYTE, STORE_CTR;
+
+ cmpl(len_reg, 0);
+ jcc(Assembler::belowEqual, EXIT);
+
+ movl(pos, 0);
+ // if the number of used encrypted counter bytes < 16,
+ // XOR PT with saved encrypted counter to obtain CT
+ bind(PRELOOP_START);
+ cmpl(used, 16);
+ jcc(Assembler::aboveEqual, EXIT_PRELOOP);
+ movb(rbx, Address(saved_encCounter_start, used));
+ xorb(rbx, Address(src_addr, pos));
+ movb(Address(dest_addr, pos), rbx);
+ addptr(pos, 1);
+ addptr(used, 1);
+ decrement(len_reg);
+ jmp(PRELOOP_START);
+
+ bind(EXIT_PRELOOP);
+ movl(Address(used_addr, 0), used);
+
+ // Calculate number of rounds i.e. 10, 12, 14, based on key length(128, 192, 256).
+ movl(rounds, Address(key, arrayOopDesc::length_offset_in_bytes() - arrayOopDesc::base_offset_in_bytes(T_INT)));
+
+ vpxor(xmm0, xmm0, xmm0, Assembler::AVX_128bit);
+ // Move initial counter value in xmm0
+ movdqu(xmm0, Address(counter, 0));
+ // broadcast counter value to zmm8
+ evshufi64x2(xmm8, xmm0, xmm0, 0, Assembler::AVX_512bit);
+
+ // load lbswap mask
+ evmovdquq(xmm16, ExternalAddress(StubRoutines::x86::counter_mask_addr()), Assembler::AVX_512bit, r15);
+
+ //shuffle counter using lbswap_mask
+ vpshufb(xmm8, xmm8, xmm16, Assembler::AVX_512bit);
+
+ // pre-increment and propagate counter values to zmm9-zmm15 registers.
+ // Linc0 increments the zmm8 by 1 (initial value being 0), Linc4 increments the counters zmm9-zmm15 by 4
+ // The counter is incremented after each block i.e. 16 bytes is processed;
+ // each zmm register has 4 counter values as its MSB
+ // the counters are incremented in parallel
+ vpaddd(xmm8, xmm8, ExternalAddress(StubRoutines::x86::counter_mask_addr() + 64), Assembler::AVX_512bit, r15);//linc0
+ vpaddd(xmm9, xmm8, ExternalAddress(StubRoutines::x86::counter_mask_addr() + 128), Assembler::AVX_512bit, r15);//linc4(rip)
+ vpaddd(xmm10, xmm9, ExternalAddress(StubRoutines::x86::counter_mask_addr() + 128), Assembler::AVX_512bit, r15);//Linc4(rip)
+ vpaddd(xmm11, xmm10, ExternalAddress(StubRoutines::x86::counter_mask_addr() + 128), Assembler::AVX_512bit, r15);//Linc4(rip)
+ vpaddd(xmm12, xmm11, ExternalAddress(StubRoutines::x86::counter_mask_addr() + 128), Assembler::AVX_512bit, r15);//Linc4(rip)
+ vpaddd(xmm13, xmm12, ExternalAddress(StubRoutines::x86::counter_mask_addr() + 128), Assembler::AVX_512bit, r15);//Linc4(rip)
+ vpaddd(xmm14, xmm13, ExternalAddress(StubRoutines::x86::counter_mask_addr() + 128), Assembler::AVX_512bit, r15);//Linc4(rip)
+ vpaddd(xmm15, xmm14, ExternalAddress(StubRoutines::x86::counter_mask_addr() + 128), Assembler::AVX_512bit, r15);//Linc4(rip)
+
+ // load linc32 mask in zmm register.linc32 increments counter by 32
+ evmovdquq(xmm19, ExternalAddress(StubRoutines::x86::counter_mask_addr() + 256), Assembler::AVX_512bit, r15);//Linc32
+
+ // xmm31 contains the key shuffle mask.
+ movdqu(xmm31, ExternalAddress(StubRoutines::x86::key_shuffle_mask_addr()));
+ // Load key function loads 128 bit key and shuffles it. Then we broadcast the shuffled key to convert it into a 512 bit value.
+ // For broadcasting the values to ZMM, vshufi64 is used instead of evbroadcasti64x2 as the source in this case is ZMM register
+ // that holds shuffled key value.
+ ev_load_key(xmm20, key, 0, xmm31);
+ ev_load_key(xmm21, key, 1 * 16, xmm31);
+ ev_load_key(xmm22, key, 2 * 16, xmm31);
+ ev_load_key(xmm23, key, 3 * 16, xmm31);
+ ev_load_key(xmm24, key, 4 * 16, xmm31);
+ ev_load_key(xmm25, key, 5 * 16, xmm31);
+ ev_load_key(xmm26, key, 6 * 16, xmm31);
+ ev_load_key(xmm27, key, 7 * 16, xmm31);
+ ev_load_key(xmm28, key, 8 * 16, xmm31);
+ ev_load_key(xmm29, key, 9 * 16, xmm31);
+ ev_load_key(xmm30, key, 10 * 16, xmm31);
+
+ // Process 32 blocks or 512 bytes of data
+ bind(LOOP);
+ cmpl(len_reg, 512);
+ jcc(Assembler::less, REMAINDER);
+ subq(len_reg, 512);
+ //Shuffle counter and Exor it with roundkey1. Result is stored in zmm0-7
+ vpshufb(xmm0, xmm8, xmm16, Assembler::AVX_512bit);
+ evpxorq(xmm0, xmm0, xmm20, Assembler::AVX_512bit);
+ vpshufb(xmm1, xmm9, xmm16, Assembler::AVX_512bit);
+ evpxorq(xmm1, xmm1, xmm20, Assembler::AVX_512bit);
+ vpshufb(xmm2, xmm10, xmm16, Assembler::AVX_512bit);
+ evpxorq(xmm2, xmm2, xmm20, Assembler::AVX_512bit);
+ vpshufb(xmm3, xmm11, xmm16, Assembler::AVX_512bit);
+ evpxorq(xmm3, xmm3, xmm20, Assembler::AVX_512bit);
+ vpshufb(xmm4, xmm12, xmm16, Assembler::AVX_512bit);
+ evpxorq(xmm4, xmm4, xmm20, Assembler::AVX_512bit);
+ vpshufb(xmm5, xmm13, xmm16, Assembler::AVX_512bit);
+ evpxorq(xmm5, xmm5, xmm20, Assembler::AVX_512bit);
+ vpshufb(xmm6, xmm14, xmm16, Assembler::AVX_512bit);
+ evpxorq(xmm6, xmm6, xmm20, Assembler::AVX_512bit);
+ vpshufb(xmm7, xmm15, xmm16, Assembler::AVX_512bit);
+ evpxorq(xmm7, xmm7, xmm20, Assembler::AVX_512bit);
+ // Perform AES encode operations and put results in zmm0-zmm7.
+ // This is followed by incrementing counter values in zmm8-zmm15.
+ // Since we will be processing 32 blocks at a time, the counter is incremented by 32.
+ roundEnc(xmm21, 7);
+ vpaddq(xmm8, xmm8, xmm19, Assembler::AVX_512bit);
+ roundEnc(xmm22, 7);
+ vpaddq(xmm9, xmm9, xmm19, Assembler::AVX_512bit);
+ roundEnc(xmm23, 7);
+ vpaddq(xmm10, xmm10, xmm19, Assembler::AVX_512bit);
+ roundEnc(xmm24, 7);
+ vpaddq(xmm11, xmm11, xmm19, Assembler::AVX_512bit);
+ roundEnc(xmm25, 7);
+ vpaddq(xmm12, xmm12, xmm19, Assembler::AVX_512bit);
+ roundEnc(xmm26, 7);
+ vpaddq(xmm13, xmm13, xmm19, Assembler::AVX_512bit);
+ roundEnc(xmm27, 7);
+ vpaddq(xmm14, xmm14, xmm19, Assembler::AVX_512bit);
+ roundEnc(xmm28, 7);
+ vpaddq(xmm15, xmm15, xmm19, Assembler::AVX_512bit);
+ roundEnc(xmm29, 7);
+
+ cmpl(rounds, 52);
+ jcc(Assembler::aboveEqual, AES192);
+ lastroundEnc(xmm30, 7);
+ jmp(END_LOOP);
+
+ bind(AES192);
+ roundEnc(xmm30, 7);
+ ev_load_key(xmm18, key, 11 * 16, xmm31);
+ roundEnc(xmm18, 7);
+ cmpl(rounds, 60);
+ jcc(Assembler::aboveEqual, AES256);
+ ev_load_key(xmm18, key, 12 * 16, xmm31);
+ lastroundEnc(xmm18, 7);
+ jmp(END_LOOP);
+
+ bind(AES256);
+ ev_load_key(xmm18, key, 12 * 16, xmm31);
+ roundEnc(xmm18, 7);
+ ev_load_key(xmm18, key, 13 * 16, xmm31);
+ roundEnc(xmm18, 7);
+ ev_load_key(xmm18, key, 14 * 16, xmm31);
+ lastroundEnc(xmm18, 7);
+
+ // After AES encode rounds, the encrypted block cipher lies in zmm0-zmm7
+ // xor encrypted block cipher and input plaintext and store resultant ciphertext
+ bind(END_LOOP);
+ evpxorq(xmm0, xmm0, Address(src_addr, pos, Address::times_1, 0 * 64), Assembler::AVX_512bit);
+ evmovdquq(Address(dest_addr, pos, Address::times_1, 0), xmm0, Assembler::AVX_512bit);
+ evpxorq(xmm1, xmm1, Address(src_addr, pos, Address::times_1, 1 * 64), Assembler::AVX_512bit);
+ evmovdquq(Address(dest_addr, pos, Address::times_1, 64), xmm1, Assembler::AVX_512bit);
+ evpxorq(xmm2, xmm2, Address(src_addr, pos, Address::times_1, 2 * 64), Assembler::AVX_512bit);
+ evmovdquq(Address(dest_addr, pos, Address::times_1, 2 * 64), xmm2, Assembler::AVX_512bit);
+ evpxorq(xmm3, xmm3, Address(src_addr, pos, Address::times_1, 3 * 64), Assembler::AVX_512bit);
+ evmovdquq(Address(dest_addr, pos, Address::times_1, 3 * 64), xmm3, Assembler::AVX_512bit);
+ evpxorq(xmm4, xmm4, Address(src_addr, pos, Address::times_1, 4 * 64), Assembler::AVX_512bit);
+ evmovdquq(Address(dest_addr, pos, Address::times_1, 4 * 64), xmm4, Assembler::AVX_512bit);
+ evpxorq(xmm5, xmm5, Address(src_addr, pos, Address::times_1, 5 * 64), Assembler::AVX_512bit);
+ evmovdquq(Address(dest_addr, pos, Address::times_1, 5 * 64), xmm5, Assembler::AVX_512bit);
+ evpxorq(xmm6, xmm6, Address(src_addr, pos, Address::times_1, 6 * 64), Assembler::AVX_512bit);
+ evmovdquq(Address(dest_addr, pos, Address::times_1, 6 * 64), xmm6, Assembler::AVX_512bit);
+ evpxorq(xmm7, xmm7, Address(src_addr, pos, Address::times_1, 7 * 64), Assembler::AVX_512bit);
+ evmovdquq(Address(dest_addr, pos, Address::times_1, 7 * 64), xmm7, Assembler::AVX_512bit);
+ addq(pos, 512);
+ jmp(LOOP);
+
+ // Encode 256, 128, 64 or 16 bytes at a time if length is less than 512 bytes
+ bind(REMAINDER);
+ cmpl(len_reg, 0);
+ jcc(Assembler::equal, END);
+ cmpl(len_reg, 256);
+ jcc(Assembler::aboveEqual, REMAINDER_16);
+ cmpl(len_reg, 128);
+ jcc(Assembler::aboveEqual, REMAINDER_8);
+ cmpl(len_reg, 64);
+ jcc(Assembler::aboveEqual, REMAINDER_4);
+ // At this point, we will process 16 bytes of data at a time.
+ // So load xmm19 with counter increment value as 1
+ evmovdquq(xmm19, ExternalAddress(StubRoutines::x86::counter_mask_addr() + 80), Assembler::AVX_128bit, r15);
+ jmp(REMAINDER_LOOP);
+
+ // Each ZMM register can be used to encode 64 bytes of data, so we have 4 ZMM registers to encode 256 bytes of data
+ bind(REMAINDER_16);
+ subq(len_reg, 256);
+ // As we process 16 blocks at a time, load mask for incrementing the counter value by 16
+ evmovdquq(xmm19, ExternalAddress(StubRoutines::x86::counter_mask_addr() + 320), Assembler::AVX_512bit, r15);//Linc16(rip)
+ // shuffle counter and XOR counter with roundkey1
+ vpshufb(xmm0, xmm8, xmm16, Assembler::AVX_512bit);
+ evpxorq(xmm0, xmm0, xmm20, Assembler::AVX_512bit);
+ vpshufb(xmm1, xmm9, xmm16, Assembler::AVX_512bit);
+ evpxorq(xmm1, xmm1, xmm20, Assembler::AVX_512bit);
+ vpshufb(xmm2, xmm10, xmm16, Assembler::AVX_512bit);
+ evpxorq(xmm2, xmm2, xmm20, Assembler::AVX_512bit);
+ vpshufb(xmm3, xmm11, xmm16, Assembler::AVX_512bit);
+ evpxorq(xmm3, xmm3, xmm20, Assembler::AVX_512bit);
+ // Increment counter values by 16
+ vpaddq(xmm8, xmm8, xmm19, Assembler::AVX_512bit);
+ vpaddq(xmm9, xmm9, xmm19, Assembler::AVX_512bit);
+ // AES encode rounds
+ roundEnc(xmm21, 3);
+ roundEnc(xmm22, 3);
+ roundEnc(xmm23, 3);
+ roundEnc(xmm24, 3);
+ roundEnc(xmm25, 3);
+ roundEnc(xmm26, 3);
+ roundEnc(xmm27, 3);
+ roundEnc(xmm28, 3);
+ roundEnc(xmm29, 3);
+
+ cmpl(rounds, 52);
+ jcc(Assembler::aboveEqual, AES192_REMAINDER16);
+ lastroundEnc(xmm30, 3);
+ jmp(REMAINDER16_END_LOOP);
+
+ bind(AES192_REMAINDER16);
+ roundEnc(xmm30, 3);
+ ev_load_key(xmm18, key, 11 * 16, xmm31);
+ roundEnc(xmm18, 3);
+ ev_load_key(xmm5, key, 12 * 16, xmm31);
+
+ cmpl(rounds, 60);
+ jcc(Assembler::aboveEqual, AES256_REMAINDER16);
+ lastroundEnc(xmm5, 3);
+ jmp(REMAINDER16_END_LOOP);
+ bind(AES256_REMAINDER16);
+ roundEnc(xmm5, 3);
+ ev_load_key(xmm6, key, 13 * 16, xmm31);
+ roundEnc(xmm6, 3);
+ ev_load_key(xmm7, key, 14 * 16, xmm31);
+ lastroundEnc(xmm7, 3);
+
+ // After AES encode rounds, the encrypted block cipher lies in zmm0-zmm3
+ // xor 256 bytes of PT with the encrypted counters to produce CT.
+ bind(REMAINDER16_END_LOOP);
+ evpxorq(xmm0, xmm0, Address(src_addr, pos, Address::times_1, 0), Assembler::AVX_512bit);
+ evmovdquq(Address(dest_addr, pos, Address::times_1, 0), xmm0, Assembler::AVX_512bit);
+ evpxorq(xmm1, xmm1, Address(src_addr, pos, Address::times_1, 1 * 64), Assembler::AVX_512bit);
+ evmovdquq(Address(dest_addr, pos, Address::times_1, 1 * 64), xmm1, Assembler::AVX_512bit);
+ evpxorq(xmm2, xmm2, Address(src_addr, pos, Address::times_1, 2 * 64), Assembler::AVX_512bit);
+ evmovdquq(Address(dest_addr, pos, Address::times_1, 2 * 64), xmm2, Assembler::AVX_512bit);
+ evpxorq(xmm3, xmm3, Address(src_addr, pos, Address::times_1, 3 * 64), Assembler::AVX_512bit);
+ evmovdquq(Address(dest_addr, pos, Address::times_1, 3 * 64), xmm3, Assembler::AVX_512bit);
+ addq(pos, 256);
+
+ cmpl(len_reg, 128);
+ jcc(Assembler::aboveEqual, REMAINDER_8);
+
+ cmpl(len_reg, 64);
+ jcc(Assembler::aboveEqual, REMAINDER_4);
+ //load mask for incrementing the counter value by 1
+ evmovdquq(xmm19, ExternalAddress(StubRoutines::x86::counter_mask_addr() + 80), Assembler::AVX_128bit, r15);//Linc0 + 16(rip)
+ jmp(REMAINDER_LOOP);
+
+ // Each ZMM register can be used to encode 64 bytes of data, so we have 2 ZMM registers to encode 128 bytes of data
+ bind(REMAINDER_8);
+ subq(len_reg, 128);
+ // As we process 8 blocks at a time, load mask for incrementing the counter value by 8
+ evmovdquq(xmm19, ExternalAddress(StubRoutines::x86::counter_mask_addr() + 192), Assembler::AVX_512bit, r15);//Linc8(rip)
+ // shuffle counters and xor with roundkey1
+ vpshufb(xmm0, xmm8, xmm16, Assembler::AVX_512bit);
+ evpxorq(xmm0, xmm0, xmm20, Assembler::AVX_512bit);
+ vpshufb(xmm1, xmm9, xmm16, Assembler::AVX_512bit);
+ evpxorq(xmm1, xmm1, xmm20, Assembler::AVX_512bit);
+ // increment counter by 8
+ vpaddq(xmm8, xmm8, xmm19, Assembler::AVX_512bit);
+ // AES encode
+ roundEnc(xmm21, 1);
+ roundEnc(xmm22, 1);
+ roundEnc(xmm23, 1);
+ roundEnc(xmm24, 1);
+ roundEnc(xmm25, 1);
+ roundEnc(xmm26, 1);
+ roundEnc(xmm27, 1);
+ roundEnc(xmm28, 1);
+ roundEnc(xmm29, 1);
+
+ cmpl(rounds, 52);
+ jcc(Assembler::aboveEqual, AES192_REMAINDER8);
+ lastroundEnc(xmm30, 1);
+ jmp(REMAINDER8_END_LOOP);
+
+ bind(AES192_REMAINDER8);
+ roundEnc(xmm30, 1);
+ ev_load_key(xmm18, key, 11 * 16, xmm31);
+ roundEnc(xmm18, 1);
+ ev_load_key(xmm5, key, 12 * 16, xmm31);
+ cmpl(rounds, 60);
+ jcc(Assembler::aboveEqual, AES256_REMAINDER8);
+ lastroundEnc(xmm5, 1);
+ jmp(REMAINDER8_END_LOOP);
+
+ bind(AES256_REMAINDER8);
+ roundEnc(xmm5, 1);
+ ev_load_key(xmm6, key, 13 * 16, xmm31);
+ roundEnc(xmm6, 1);
+ ev_load_key(xmm7, key, 14 * 16, xmm31);
+ lastroundEnc(xmm7, 1);
+
+ bind(REMAINDER8_END_LOOP);
+ // After AES encode rounds, the encrypted block cipher lies in zmm0-zmm1
+ // XOR PT with the encrypted counter and store as CT
+ evpxorq(xmm0, xmm0, Address(src_addr, pos, Address::times_1, 0 * 64), Assembler::AVX_512bit);
+ evmovdquq(Address(dest_addr, pos, Address::times_1, 0 * 64), xmm0, Assembler::AVX_512bit);
+ evpxorq(xmm1, xmm1, Address(src_addr, pos, Address::times_1, 1 * 64), Assembler::AVX_512bit);
+ evmovdquq(Address(dest_addr, pos, Address::times_1, 1 * 64), xmm1, Assembler::AVX_512bit);
+ addq(pos, 128);
+
+ cmpl(len_reg, 64);
+ jcc(Assembler::aboveEqual, REMAINDER_4);
+ // load mask for incrementing the counter value by 1
+ evmovdquq(xmm19, ExternalAddress(StubRoutines::x86::counter_mask_addr() + 80), Assembler::AVX_128bit, r15);//Linc0 + 16(rip)
+ jmp(REMAINDER_LOOP);
+
+ // Each ZMM register can be used to encode 64 bytes of data, so we have 1 ZMM register used in this block of code
+ bind(REMAINDER_4);
+ subq(len_reg, 64);
+ // As we process 4 blocks at a time, load mask for incrementing the counter value by 4
+ evmovdquq(xmm19, ExternalAddress(StubRoutines::x86::counter_mask_addr() + 128), Assembler::AVX_512bit, r15);//Linc4(rip)
+ // XOR counter with first roundkey
+ vpshufb(xmm0, xmm8, xmm16, Assembler::AVX_512bit);
+ evpxorq(xmm0, xmm0, xmm20, Assembler::AVX_512bit);
+ // Increment counter
+ vpaddq(xmm8, xmm8, xmm19, Assembler::AVX_512bit);
+ vaesenc(xmm0, xmm0, xmm21, Assembler::AVX_512bit);
+ vaesenc(xmm0, xmm0, xmm22, Assembler::AVX_512bit);
+ vaesenc(xmm0, xmm0, xmm23, Assembler::AVX_512bit);
+ vaesenc(xmm0, xmm0, xmm24, Assembler::AVX_512bit);
+ vaesenc(xmm0, xmm0, xmm25, Assembler::AVX_512bit);
+ vaesenc(xmm0, xmm0, xmm26, Assembler::AVX_512bit);
+ vaesenc(xmm0, xmm0, xmm27, Assembler::AVX_512bit);
+ vaesenc(xmm0, xmm0, xmm28, Assembler::AVX_512bit);
+ vaesenc(xmm0, xmm0, xmm29, Assembler::AVX_512bit);
+ cmpl(rounds, 52);
+ jcc(Assembler::aboveEqual, AES192_REMAINDER4);
+ vaesenclast(xmm0, xmm0, xmm30, Assembler::AVX_512bit);
+ jmp(END_REMAINDER4);
+
+ bind(AES192_REMAINDER4);
+ vaesenc(xmm0, xmm0, xmm30, Assembler::AVX_512bit);
+ ev_load_key(xmm18, key, 11 * 16, xmm31);
+ vaesenc(xmm0, xmm0, xmm18, Assembler::AVX_512bit);
+ ev_load_key(xmm5, key, 12 * 16, xmm31);
+
+ cmpl(rounds, 60);
+ jcc(Assembler::aboveEqual, AES256_REMAINDER4);
+ vaesenclast(xmm0, xmm0, xmm5, Assembler::AVX_512bit);
+ jmp(END_REMAINDER4);
+
+ bind(AES256_REMAINDER4);
+ vaesenc(xmm0, xmm0, xmm5, Assembler::AVX_512bit);
+ ev_load_key(xmm6, key, 13 * 16, xmm31);
+ vaesenc(xmm0, xmm0, xmm6, Assembler::AVX_512bit);
+ ev_load_key(xmm7, key, 14 * 16, xmm31);
+ vaesenclast(xmm0, xmm0, xmm7, Assembler::AVX_512bit);
+ // After AES encode rounds, the encrypted block cipher lies in zmm0.
+ // XOR encrypted block cipher with PT and store 64 bytes of ciphertext
+ bind(END_REMAINDER4);
+ evpxorq(xmm0, xmm0, Address(src_addr, pos, Address::times_1, 0 * 64), Assembler::AVX_512bit);
+ evmovdquq(Address(dest_addr, pos, Address::times_1, 0), xmm0, Assembler::AVX_512bit);
+ addq(pos, 64);
+ // load mask for incrementing the counter value by 1
+ evmovdquq(xmm19, ExternalAddress(StubRoutines::x86::counter_mask_addr() + 80), Assembler::AVX_128bit, r15);//Linc0 + 16(rip)
+
+ // For a single block, the AES rounds start here.
+ bind(REMAINDER_LOOP);
+ cmpl(len_reg, 0);
+ jcc(Assembler::belowEqual, END);
+ // XOR counter with first roundkey
+ vpshufb(xmm0, xmm8, xmm16, Assembler::AVX_128bit);
+ evpxorq(xmm0, xmm0, xmm20, Assembler::AVX_128bit);
+ vaesenc(xmm0, xmm0, xmm21, Assembler::AVX_128bit);
+ // Increment counter by 1
+ vpaddq(xmm8, xmm8, xmm19, Assembler::AVX_128bit);
+ vaesenc(xmm0, xmm0, xmm22, Assembler::AVX_128bit);
+ vaesenc(xmm0, xmm0, xmm23, Assembler::AVX_128bit);
+ vaesenc(xmm0, xmm0, xmm24, Assembler::AVX_128bit);
+ vaesenc(xmm0, xmm0, xmm25, Assembler::AVX_128bit);
+ vaesenc(xmm0, xmm0, xmm26, Assembler::AVX_128bit);
+ vaesenc(xmm0, xmm0, xmm27, Assembler::AVX_128bit);
+ vaesenc(xmm0, xmm0, xmm28, Assembler::AVX_128bit);
+ vaesenc(xmm0, xmm0, xmm29, Assembler::AVX_128bit);
+
+ cmpl(rounds, 52);
+ jcc(Assembler::aboveEqual, AES192_REMAINDER);
+ vaesenclast(xmm0, xmm0, xmm30, Assembler::AVX_128bit);
+ jmp(END_REMAINDER_LOOP);
+
+ bind(AES192_REMAINDER);
+ vaesenc(xmm0, xmm0, xmm30, Assembler::AVX_128bit);
+ ev_load_key(xmm18, key, 11 * 16, xmm31);
+ vaesenc(xmm0, xmm0, xmm18, Assembler::AVX_128bit);
+ ev_load_key(xmm5, key, 12 * 16, xmm31);
+ cmpl(rounds, 60);
+ jcc(Assembler::aboveEqual, AES256_REMAINDER);
+ vaesenclast(xmm0, xmm0, xmm5, Assembler::AVX_128bit);
+ jmp(END_REMAINDER_LOOP);
+
+ bind(AES256_REMAINDER);
+ vaesenc(xmm0, xmm0, xmm5, Assembler::AVX_128bit);
+ ev_load_key(xmm6, key, 13 * 16, xmm31);
+ vaesenc(xmm0, xmm0, xmm6, Assembler::AVX_128bit);
+ ev_load_key(xmm7, key, 14 * 16, xmm31);
+ vaesenclast(xmm0, xmm0, xmm7, Assembler::AVX_128bit);
+
+ bind(END_REMAINDER_LOOP);
+ // If the length register is less than the blockSize i.e. 16
+ // then we store only those bytes of the CT to the destination
+ // corresponding to the length register value
+ // extracting the exact number of bytes is handled by EXTRACT_TAILBYTES
+ cmpl(len_reg, 16);
+ jcc(Assembler::less, EXTRACT_TAILBYTES);
+ subl(len_reg, 16);
+ // After AES encode rounds, the encrypted block cipher lies in xmm0.
+ // If the length register is equal to 16 bytes, store CT in dest after XOR operation.
+ evpxorq(xmm0, xmm0, Address(src_addr, pos, Address::times_1, 0), Assembler::AVX_128bit);
+ evmovdquq(Address(dest_addr, pos, Address::times_1, 0), xmm0, Assembler::AVX_128bit);
+ addl(pos, 16);
+
+ jmp(REMAINDER_LOOP);
+
+ bind(EXTRACT_TAILBYTES);
+ // Save encrypted counter value in xmm0 for next invocation, before XOR operation
+ movdqu(Address(saved_encCounter_start, 0), xmm0);
+ // XOR encryted block cipher in xmm0 with PT to produce CT
+ evpxorq(xmm0, xmm0, Address(src_addr, pos, Address::times_1, 0), Assembler::AVX_128bit);
+ // extract upto 15 bytes of CT from xmm0 as specified by length register
+ testptr(len_reg, 8);
+ jcc(Assembler::zero, EXTRACT_TAIL_4BYTES);
+ pextrq(Address(dest_addr, pos), xmm0, 0);
+ psrldq(xmm0, 8);
+ addl(pos, 8);
+ bind(EXTRACT_TAIL_4BYTES);
+ testptr(len_reg, 4);
+ jcc(Assembler::zero, EXTRACT_TAIL_2BYTES);
+ pextrd(Address(dest_addr, pos), xmm0, 0);
+ psrldq(xmm0, 4);
+ addq(pos, 4);
+ bind(EXTRACT_TAIL_2BYTES);
+ testptr(len_reg, 2);
+ jcc(Assembler::zero, EXTRACT_TAIL_1BYTE);
+ pextrw(Address(dest_addr, pos), xmm0, 0);
+ psrldq(xmm0, 2);
+ addl(pos, 2);
+ bind(EXTRACT_TAIL_1BYTE);
+ testptr(len_reg, 1);
+ jcc(Assembler::zero, END);
+ pextrb(Address(dest_addr, pos), xmm0, 0);
+ addl(pos, 1);
+
+ bind(END);
+ // If there are no tail bytes, store counter value and exit
+ cmpl(len_reg, 0);
+ jcc(Assembler::equal, STORE_CTR);
+ movl(Address(used_addr, 0), len_reg);
+
+ bind(STORE_CTR);
+ //shuffle updated counter and store it
+ vpshufb(xmm8, xmm8, xmm16, Assembler::AVX_128bit);
+ movdqu(Address(counter, 0), xmm8);
+ // Zero out counter and key registers
+ evpxorq(xmm8, xmm8, xmm8, Assembler::AVX_512bit);
+ evpxorq(xmm20, xmm20, xmm20, Assembler::AVX_512bit);
+ evpxorq(xmm21, xmm21, xmm21, Assembler::AVX_512bit);
+ evpxorq(xmm22, xmm22, xmm22, Assembler::AVX_512bit);
+ evpxorq(xmm23, xmm23, xmm23, Assembler::AVX_512bit);
+ evpxorq(xmm24, xmm24, xmm24, Assembler::AVX_512bit);
+ evpxorq(xmm25, xmm25, xmm25, Assembler::AVX_512bit);
+ evpxorq(xmm26, xmm26, xmm26, Assembler::AVX_512bit);
+ evpxorq(xmm27, xmm27, xmm27, Assembler::AVX_512bit);
+ evpxorq(xmm28, xmm28, xmm28, Assembler::AVX_512bit);
+ evpxorq(xmm29, xmm29, xmm29, Assembler::AVX_512bit);
+ evpxorq(xmm30, xmm30, xmm30, Assembler::AVX_512bit);
+ cmpl(rounds, 44);
+ jcc(Assembler::belowEqual, EXIT);
+ evpxorq(xmm18, xmm18, xmm18, Assembler::AVX_512bit);
+ evpxorq(xmm5, xmm5, xmm5, Assembler::AVX_512bit);
+ cmpl(rounds, 52);
+ jcc(Assembler::belowEqual, EXIT);
+ evpxorq(xmm6, xmm6, xmm6, Assembler::AVX_512bit);
+ evpxorq(xmm7, xmm7, xmm7, Assembler::AVX_512bit);
+ bind(EXIT);
+}
+
#endif // _LP64
--- a/src/hotspot/cpu/x86/nativeInst_x86.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/x86/nativeInst_x86.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -355,60 +355,7 @@
return off;
}
-address NativeMovRegMem::instruction_address() const {
- return addr_at(instruction_start());
-}
-
-address NativeMovRegMem::next_instruction_address() const {
- address ret = instruction_address() + instruction_size;
- u_char instr_0 = *(u_char*) instruction_address();
- switch (instr_0) {
- case instruction_operandsize_prefix:
-
- fatal("should have skipped instruction_operandsize_prefix");
- break;
-
- case instruction_extended_prefix:
- fatal("should have skipped instruction_extended_prefix");
- break;
-
- case instruction_code_mem2reg_movslq: // 0x63
- case instruction_code_mem2reg_movzxb: // 0xB6
- case instruction_code_mem2reg_movsxb: // 0xBE
- case instruction_code_mem2reg_movzxw: // 0xB7
- case instruction_code_mem2reg_movsxw: // 0xBF
- case instruction_code_reg2mem: // 0x89 (q/l)
- case instruction_code_mem2reg: // 0x8B (q/l)
- case instruction_code_reg2memb: // 0x88
- case instruction_code_mem2regb: // 0x8a
-
- case instruction_code_lea: // 0x8d
-
- case instruction_code_float_s: // 0xd9 fld_s a
- case instruction_code_float_d: // 0xdd fld_d a
-
- case instruction_code_xmm_load: // 0x10
- case instruction_code_xmm_store: // 0x11
- case instruction_code_xmm_lpd: // 0x12
- {
- // If there is an SIB then instruction is longer than expected
- u_char mod_rm = *(u_char*)(instruction_address() + 1);
- if ((mod_rm & 7) == 0x4) {
- ret++;
- }
- }
- case instruction_code_xor:
- fatal("should have skipped xor lead in");
- break;
-
- default:
- fatal("not a NativeMovRegMem");
- }
- return ret;
-
-}
-
-int NativeMovRegMem::offset() const{
+int NativeMovRegMem::patch_offset() const {
int off = data_offset + instruction_start();
u_char mod_rm = *(u_char*)(instruction_address() + 1);
// nnnn(r12|rsp) isn't coded as simple mod/rm since that is
@@ -417,19 +364,7 @@
if ((mod_rm & 7) == 0x4) {
off++;
}
- return int_at(off);
-}
-
-void NativeMovRegMem::set_offset(int x) {
- int off = data_offset + instruction_start();
- u_char mod_rm = *(u_char*)(instruction_address() + 1);
- // nnnn(r12|rsp) isn't coded as simple mod/rm since that is
- // the encoding to use an SIB byte. Which will have the nnnn
- // field off by one byte
- if ((mod_rm & 7) == 0x4) {
- off++;
- }
- set_int_at(off, x);
+ return off;
}
void NativeMovRegMem::verify() {
--- a/src/hotspot/cpu/x86/nativeInst_x86.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/x86/nativeInst_x86.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -361,7 +361,6 @@
instruction_VEX_prefix_3bytes = Assembler::VEX_3bytes,
instruction_EVEX_prefix_4bytes = Assembler::EVEX_4bytes,
- instruction_size = 4,
instruction_offset = 0,
data_offset = 2,
next_instruction_offset = 4
@@ -370,15 +369,26 @@
// helper
int instruction_start() const;
- address instruction_address() const;
+ address instruction_address() const {
+ return addr_at(instruction_start());
+ }
- address next_instruction_address() const;
+ int num_bytes_to_end_of_patch() const {
+ return patch_offset() + sizeof(jint);
+ }
- int offset() const;
+ int offset() const {
+ return int_at(patch_offset());
+ }
- void set_offset(int x);
+ void set_offset(int x) {
+ set_int_at(patch_offset(), x);
+ }
- void add_offset_in_bytes(int add_offset) { set_offset ( ( offset() + add_offset ) ); }
+ void add_offset_in_bytes(int add_offset) {
+ int patch_off = patch_offset();
+ set_int_at(patch_off, int_at(patch_off) + add_offset);
+ }
void verify();
void print ();
@@ -387,6 +397,7 @@
static void test() {}
private:
+ int patch_offset() const;
inline friend NativeMovRegMem* nativeMovRegMem_at (address address);
};
--- a/src/hotspot/cpu/x86/stubGenerator_x86_64.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/x86/stubGenerator_x86_64.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -3982,6 +3982,123 @@
return start;
}
+ // This mask is used for incrementing counter value(linc0, linc4, etc.)
+ address counter_mask_addr() {
+ __ align(64);
+ StubCodeMark mark(this, "StubRoutines", "counter_mask_addr");
+ address start = __ pc();
+ __ emit_data64(0x08090a0b0c0d0e0f, relocInfo::none);//lbswapmask
+ __ emit_data64(0x0001020304050607, relocInfo::none);
+ __ emit_data64(0x08090a0b0c0d0e0f, relocInfo::none);
+ __ emit_data64(0x0001020304050607, relocInfo::none);
+ __ emit_data64(0x08090a0b0c0d0e0f, relocInfo::none);
+ __ emit_data64(0x0001020304050607, relocInfo::none);
+ __ emit_data64(0x08090a0b0c0d0e0f, relocInfo::none);
+ __ emit_data64(0x0001020304050607, relocInfo::none);
+ __ emit_data64(0x0000000000000000, relocInfo::none);//linc0 = counter_mask_addr+64
+ __ emit_data64(0x0000000000000000, relocInfo::none);
+ __ emit_data64(0x0000000000000001, relocInfo::none);//counter_mask_addr() + 80
+ __ emit_data64(0x0000000000000000, relocInfo::none);
+ __ emit_data64(0x0000000000000002, relocInfo::none);
+ __ emit_data64(0x0000000000000000, relocInfo::none);
+ __ emit_data64(0x0000000000000003, relocInfo::none);
+ __ emit_data64(0x0000000000000000, relocInfo::none);
+ __ emit_data64(0x0000000000000004, relocInfo::none);//linc4 = counter_mask_addr() + 128
+ __ emit_data64(0x0000000000000000, relocInfo::none);
+ __ emit_data64(0x0000000000000004, relocInfo::none);
+ __ emit_data64(0x0000000000000000, relocInfo::none);
+ __ emit_data64(0x0000000000000004, relocInfo::none);
+ __ emit_data64(0x0000000000000000, relocInfo::none);
+ __ emit_data64(0x0000000000000004, relocInfo::none);
+ __ emit_data64(0x0000000000000000, relocInfo::none);
+ __ emit_data64(0x0000000000000008, relocInfo::none);//linc8 = counter_mask_addr() + 192
+ __ emit_data64(0x0000000000000000, relocInfo::none);
+ __ emit_data64(0x0000000000000008, relocInfo::none);
+ __ emit_data64(0x0000000000000000, relocInfo::none);
+ __ emit_data64(0x0000000000000008, relocInfo::none);
+ __ emit_data64(0x0000000000000000, relocInfo::none);
+ __ emit_data64(0x0000000000000008, relocInfo::none);
+ __ emit_data64(0x0000000000000000, relocInfo::none);
+ __ emit_data64(0x0000000000000020, relocInfo::none);//linc32 = counter_mask_addr() + 256
+ __ emit_data64(0x0000000000000000, relocInfo::none);
+ __ emit_data64(0x0000000000000020, relocInfo::none);
+ __ emit_data64(0x0000000000000000, relocInfo::none);
+ __ emit_data64(0x0000000000000020, relocInfo::none);
+ __ emit_data64(0x0000000000000000, relocInfo::none);
+ __ emit_data64(0x0000000000000020, relocInfo::none);
+ __ emit_data64(0x0000000000000000, relocInfo::none);
+ __ emit_data64(0x0000000000000010, relocInfo::none);//linc16 = counter_mask_addr() + 320
+ __ emit_data64(0x0000000000000000, relocInfo::none);
+ __ emit_data64(0x0000000000000010, relocInfo::none);
+ __ emit_data64(0x0000000000000000, relocInfo::none);
+ __ emit_data64(0x0000000000000010, relocInfo::none);
+ __ emit_data64(0x0000000000000000, relocInfo::none);
+ __ emit_data64(0x0000000000000010, relocInfo::none);
+ __ emit_data64(0x0000000000000000, relocInfo::none);
+ return start;
+ }
+
+ // Vector AES Counter implementation
+ address generate_counterMode_VectorAESCrypt() {
+ __ align(CodeEntryAlignment);
+ StubCodeMark mark(this, "StubRoutines", "counterMode_AESCrypt");
+ address start = __ pc();
+ const Register from = c_rarg0; // source array address
+ const Register to = c_rarg1; // destination array address
+ const Register key = c_rarg2; // key array address r8
+ const Register counter = c_rarg3; // counter byte array initialized from counter array address
+ // and updated with the incremented counter in the end
+#ifndef _WIN64
+ const Register len_reg = c_rarg4;
+ const Register saved_encCounter_start = c_rarg5;
+ const Register used_addr = r10;
+ const Address used_mem(rbp, 2 * wordSize);
+ const Register used = r11;
+#else
+ const Address len_mem(rbp, 6 * wordSize); // length is on stack on Win64
+ const Address saved_encCounter_mem(rbp, 7 * wordSize); // saved encrypted counter is on stack on Win64
+ const Address used_mem(rbp, 8 * wordSize); // used length is on stack on Win64
+ const Register len_reg = r10; // pick the first volatile windows register
+ const Register saved_encCounter_start = r11;
+ const Register used_addr = r13;
+ const Register used = r14;
+#endif
+ __ enter();
+ // Save state before entering routine
+ __ push(r12);
+ __ push(r13);
+ __ push(r14);
+ __ push(r15);
+#ifdef _WIN64
+ // on win64, fill len_reg from stack position
+ __ movl(len_reg, len_mem);
+ __ movptr(saved_encCounter_start, saved_encCounter_mem);
+ __ movptr(used_addr, used_mem);
+ __ movl(used, Address(used_addr, 0));
+#else
+ __ push(len_reg); // Save
+ __ movptr(used_addr, used_mem);
+ __ movl(used, Address(used_addr, 0));
+#endif
+ __ push(rbx);
+ __ aesctr_encrypt(from, to, key, counter, len_reg, used, used_addr, saved_encCounter_start);
+ // Restore state before leaving routine
+ __ pop(rbx);
+#ifdef _WIN64
+ __ movl(rax, len_mem); // return length
+#else
+ __ pop(rax); // return length
+#endif
+ __ pop(r15);
+ __ pop(r14);
+ __ pop(r13);
+ __ pop(r12);
+
+ __ leave(); // required for proper stackwalking of RuntimeStub frame
+ __ ret(0);
+ return start;
+ }
+
// This is a version of CTR/AES crypt which does 6 blocks in a loop at a time
// to hide instruction latency
//
@@ -6111,9 +6228,14 @@
StubRoutines::_cipherBlockChaining_decryptAESCrypt = generate_cipherBlockChaining_decryptAESCrypt_Parallel();
}
}
- if (UseAESCTRIntrinsics){
- StubRoutines::x86::_counter_shuffle_mask_addr = generate_counter_shuffle_mask();
- StubRoutines::_counterMode_AESCrypt = generate_counterMode_AESCrypt_Parallel();
+ if (UseAESCTRIntrinsics) {
+ if (VM_Version::supports_vaes() && VM_Version::supports_avx512bw() && VM_Version::supports_avx512vl()) {
+ StubRoutines::x86::_counter_mask_addr = counter_mask_addr();
+ StubRoutines::_counterMode_AESCrypt = generate_counterMode_VectorAESCrypt();
+ } else {
+ StubRoutines::x86::_counter_shuffle_mask_addr = generate_counter_shuffle_mask();
+ StubRoutines::_counterMode_AESCrypt = generate_counterMode_AESCrypt_Parallel();
+ }
}
if (UseSHA1Intrinsics) {
--- a/src/hotspot/cpu/x86/stubRoutines_x86.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/x86/stubRoutines_x86.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -62,7 +62,7 @@
address StubRoutines::x86::_left_shift_mask = NULL;
address StubRoutines::x86::_and_mask = NULL;
address StubRoutines::x86::_url_charset = NULL;
-
+address StubRoutines::x86::_counter_mask_addr = NULL;
#endif
address StubRoutines::x86::_pshuffle_byte_flip_mask_addr = NULL;
--- a/src/hotspot/cpu/x86/stubRoutines_x86.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/cpu/x86/stubRoutines_x86.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -154,6 +154,7 @@
static address _k512_W_addr;
// byte flip mask for sha512
static address _pshuffle_byte_flip_mask_addr_sha512;
+ static address _counter_mask_addr;
// Masks for base64
static address _base64_charset;
static address _bswap_mask;
@@ -258,6 +259,7 @@
static address base64_right_shift_mask_addr() { return _right_shift_mask; }
static address base64_left_shift_mask_addr() { return _left_shift_mask; }
static address base64_and_mask_addr() { return _and_mask; }
+ static address counter_mask_addr() { return _counter_mask_addr; }
#endif
static address pshuffle_byte_flip_mask_addr() { return _pshuffle_byte_flip_mask_addr; }
static void generate_CRC32C_table(bool is_pclmulqdq_supported);
--- a/src/hotspot/os_cpu/linux_aarch64/orderAccess_linux_aarch64.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/os_cpu/linux_aarch64/orderAccess_linux_aarch64.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -55,14 +55,14 @@
struct OrderAccess::PlatformOrderedLoad<byte_size, X_ACQUIRE>
{
template <typename T>
- T operator()(const volatile T* p) const { T data; __atomic_load(p, &data, __ATOMIC_ACQUIRE); return data; }
+ T operator()(const volatile T* p) const { T data; __atomic_load(const_cast<T*>(p), &data, __ATOMIC_ACQUIRE); return data; }
};
template<size_t byte_size>
struct OrderAccess::PlatformOrderedStore<byte_size, RELEASE_X>
{
template <typename T>
- void operator()(T v, volatile T* p) const { __atomic_store(p, &v, __ATOMIC_RELEASE); }
+ void operator()(T v, volatile T* p) const { __atomic_store(const_cast<T*>(p), &v, __ATOMIC_RELEASE); }
};
template<size_t byte_size>
--- a/src/hotspot/os_cpu/linux_s390/os_linux_s390.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/os_cpu/linux_s390/os_linux_s390.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -1,6 +1,6 @@
/*
* Copyright (c) 2016, 2019, Oracle and/or its affiliates. All rights reserved.
- * Copyright (c) 2016, 2018 SAP SE. All rights reserved.
+ * Copyright (c) 2016, 2019 SAP SE. All rights reserved.
* DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
*
* This code is free software; you can redistribute it and/or modify it
@@ -426,6 +426,7 @@
stub = SharedRuntime::continuation_for_implicit_exception(thread, pc, SharedRuntime::IMPLICIT_NULL);
}
+#ifdef COMPILER2
// SIGTRAP-based implicit range check in compiled code.
else if (sig == SIGFPE && TrapBasedRangeChecks &&
(trap_pc != NULL) &&
@@ -435,6 +436,7 @@
}
stub = SharedRuntime::continuation_for_implicit_exception(thread, trap_pc, SharedRuntime::IMPLICIT_NULL);
}
+#endif
else if (sig == SIGFPE && info->si_code == FPE_INTDIV) {
stub = SharedRuntime::continuation_for_implicit_exception(thread, trap_pc, SharedRuntime::IMPLICIT_DIVIDE_BY_ZERO);
--- a/src/hotspot/share/aot/aotCodeHeap.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/aot/aotCodeHeap.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -34,6 +34,7 @@
#include "interpreter/abstractInterpreter.hpp"
#include "jvmci/compilerRuntime.hpp"
#include "jvmci/jvmciRuntime.hpp"
+#include "logging/log.hpp"
#include "memory/allocation.inline.hpp"
#include "memory/universe.hpp"
#include "oops/compressedOops.hpp"
--- a/src/hotspot/share/c1/c1_Canonicalizer.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/c1/c1_Canonicalizer.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -1,5 +1,5 @@
/*
- * Copyright (c) 1999, 2018, Oracle and/or its affiliates. All rights reserved.
+ * Copyright (c) 1999, 2019, Oracle and/or its affiliates. All rights reserved.
* DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
*
* This code is free software; you can redistribute it and/or modify it
@@ -354,25 +354,21 @@
}
if (t2->is_constant()) {
if (t->tag() == intTag) {
- int value = t->as_IntConstant()->value();
- int shift = t2->as_IntConstant()->value() & 31;
- jint mask = ~(~0 << (32 - shift));
- if (shift == 0) mask = ~0;
+ jint value = t->as_IntConstant()->value();
+ jint shift = t2->as_IntConstant()->value();
switch (x->op()) {
- case Bytecodes::_ishl: set_constant(value << shift); return;
- case Bytecodes::_ishr: set_constant(value >> shift); return;
- case Bytecodes::_iushr: set_constant((value >> shift) & mask); return;
+ case Bytecodes::_ishl: set_constant(java_shift_left(value, shift)); return;
+ case Bytecodes::_ishr: set_constant(java_shift_right(value, shift)); return;
+ case Bytecodes::_iushr: set_constant(java_shift_right_unsigned(value, shift)); return;
default: break;
}
} else if (t->tag() == longTag) {
jlong value = t->as_LongConstant()->value();
- int shift = t2->as_IntConstant()->value() & 63;
- jlong mask = ~(~jlong_cast(0) << (64 - shift));
- if (shift == 0) mask = ~jlong_cast(0);
+ jint shift = t2->as_IntConstant()->value();
switch (x->op()) {
- case Bytecodes::_lshl: set_constant(value << shift); return;
- case Bytecodes::_lshr: set_constant(value >> shift); return;
- case Bytecodes::_lushr: set_constant((value >> shift) & mask); return;
+ case Bytecodes::_lshl: set_constant(java_shift_left(value, shift)); return;
+ case Bytecodes::_lshr: set_constant(java_shift_right(value, shift)); return;
+ case Bytecodes::_lushr: set_constant(java_shift_right_unsigned(value, shift)); return;
default: break;
}
}
--- a/src/hotspot/share/c1/c1_CodeStubs.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/c1/c1_CodeStubs.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -409,7 +409,7 @@
if (_id == PatchingStub::access_field_id) {
// embed a fixed offset to handle long patches which need to be offset by a word.
// the patching code will just add the field offset field to this offset so
- // that we can refernce either the high or low word of a double word field.
+ // that we can reference either the high or low word of a double word field.
int field_offset = 0;
switch (patch_code) {
case lir_patch_low: field_offset = lo_word_offset_in_bytes; break;
@@ -419,6 +419,8 @@
}
NativeMovRegMem* n_move = nativeMovRegMem_at(pc_start());
n_move->set_offset(field_offset);
+ // Copy will never get executed, so only copy the part which is required for patching.
+ _bytes_to_copy = MAX2(n_move->num_bytes_to_end_of_patch(), (int)NativeGeneralJump::instruction_size);
} else if (_id == load_klass_id || _id == load_mirror_id || _id == load_appendix_id) {
assert(_obj != noreg, "must have register object for load_klass/load_mirror");
#ifdef ASSERT
--- a/src/hotspot/share/c1/c1_Instruction.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/c1/c1_Instruction.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -29,6 +29,7 @@
#include "c1/c1_ValueStack.hpp"
#include "ci/ciObjArrayKlass.hpp"
#include "ci/ciTypeArrayKlass.hpp"
+#include "utilities/bitMap.inline.hpp"
// Implementation of Instruction
--- a/src/hotspot/share/c1/c1_LIRGenerator.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/c1/c1_LIRGenerator.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -1301,7 +1301,7 @@
}
__ move(new LIR_Address(rcvr.result(), java_lang_Class::klass_offset_in_bytes(), T_ADDRESS), temp, info);
- __ cmp(lir_cond_notEqual, temp, LIR_OprFact::intConst(0));
+ __ cmp(lir_cond_notEqual, temp, LIR_OprFact::metadataConst(0));
__ cmove(lir_cond_notEqual, LIR_OprFact::intConst(0), LIR_OprFact::intConst(1), result, T_BOOLEAN);
}
--- a/src/hotspot/share/ci/bcEscapeAnalyzer.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/ci/bcEscapeAnalyzer.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -151,7 +151,7 @@
void BCEscapeAnalyzer::clear_bits(ArgumentMap vars, VectorSet &bm) {
for (int i = 0; i < _arg_size; i++) {
if (vars.contains(i)) {
- bm >>= i;
+ bm.remove(i);
}
}
}
@@ -1280,9 +1280,9 @@
set_modified(var, OFFSET_ANY, 4);
set_global_escape(var);
}
- _arg_local.Clear();
- _arg_stack.Clear();
- _arg_returned.Clear();
+ _arg_local.clear();
+ _arg_stack.clear();
+ _arg_returned.clear();
_return_local = false;
_return_allocated = false;
_allocated_escapes = true;
@@ -1334,7 +1334,7 @@
// Do not scan method if it has no object parameters and
// does not returns an object (_return_allocated is set in initialize()).
- if (_arg_local.Size() == 0 && !_return_allocated) {
+ if (_arg_local.is_empty() && !_return_allocated) {
// Clear all info since method's bytecode was not analysed and
// set pessimistic escape information.
clear_escape_info();
@@ -1457,10 +1457,10 @@
, _parent(parent)
, _level(parent == NULL ? 0 : parent->level() + 1) {
if (!_conservative) {
- _arg_local.Clear();
- _arg_stack.Clear();
- _arg_returned.Clear();
- _dirty.Clear();
+ _arg_local.clear();
+ _arg_stack.clear();
+ _arg_returned.clear();
+ _dirty.clear();
Arena* arena = CURRENT_ENV->arena();
_arg_modified = (uint *) arena->Amalloc(_arg_size * sizeof(uint));
Copy::zero_to_bytes(_arg_modified, _arg_size * sizeof(uint));
--- a/src/hotspot/share/classfile/javaClasses.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/classfile/javaClasses.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -1681,13 +1681,6 @@
}
bool java_lang_Thread::interrupted(oop java_thread) {
-#if INCLUDE_JFR
- if (java_thread == NULL) {
- // can happen from Jfr::on_vm_init leading to call of JavaThread::sleep
- assert(!is_init_completed(), "should only happen during init");
- return false;
- }
-#endif
return java_thread->bool_field_volatile(_interrupted_offset);
}
--- a/src/hotspot/share/classfile/vmSymbols.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/classfile/vmSymbols.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -786,9 +786,6 @@
#endif // COMPILER1
#ifdef COMPILER2
case vmIntrinsics::_clone:
-#if INCLUDE_ZGC
- if (UseZGC) return true;
-#endif
case vmIntrinsics::_copyOf:
case vmIntrinsics::_copyOfRange:
// These intrinsics use both the objectcopy and the arraycopy
--- a/src/hotspot/share/compiler/compilerDefinitions.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/compiler/compilerDefinitions.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -211,7 +211,6 @@
}
}
-#endif // TIERED
void CompilerConfig::set_tiered_flags() {
// Increase the code cache size - tiered compiles a lot more.
@@ -292,6 +291,8 @@
}
}
+#endif // TIERED
+
#if INCLUDE_JVMCI
void set_jvmci_specific_flags() {
if (UseJVMCICompiler) {
@@ -474,9 +475,12 @@
set_jvmci_specific_flags();
#endif
+#ifdef TIERED
if (TieredCompilation) {
set_tiered_flags();
- } else {
+ } else
+#endif
+ {
// Scale CompileThreshold
// CompileThresholdScaling == 0.0 is equivalent to -Xint and leaves CompileThreshold unchanged.
if (!FLAG_IS_DEFAULT(CompileThresholdScaling) && CompileThresholdScaling > 0.0) {
--- a/src/hotspot/share/compiler/compilerDefinitions.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/compiler/compilerDefinitions.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -62,6 +62,7 @@
CompLevel_full_optimization = 4 // C2 or JVMCI
};
+#ifdef TIERED
class CompilationModeFlag : AllStatic {
static bool _quick_only;
static bool _high_only;
@@ -79,6 +80,7 @@
static void set_high_only_quick_internal(bool x) { _high_only_quick_internal = x; }
};
+#endif
extern CompLevel CompLevel_highest_tier;
extern CompLevel CompLevel_initial_compile;
@@ -147,7 +149,7 @@
static void ergo_initialize();
private:
- static void set_tiered_flags();
+ TIERED_ONLY(static void set_tiered_flags();)
};
#endif // SHARE_COMPILER_COMPILERDEFINITIONS_HPP
--- a/src/hotspot/share/compiler/compilerDirectives.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/compiler/compilerDirectives.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -61,11 +61,12 @@
cflags(PrintIntrinsics, bool, PrintIntrinsics, PrintIntrinsics) \
NOT_PRODUCT(cflags(TraceOptoPipelining, bool, TraceOptoPipelining, TraceOptoPipelining)) \
NOT_PRODUCT(cflags(TraceOptoOutput, bool, TraceOptoOutput, TraceOptoOutput)) \
+NOT_PRODUCT(cflags(PrintIdeal, bool, PrintIdeal, PrintIdeal)) \
+NOT_PRODUCT(cflags(IGVPrintLevel, intx, PrintIdealGraphLevel, IGVPrintLevel)) \
cflags(TraceSpilling, bool, TraceSpilling, TraceSpilling) \
cflags(Vectorize, bool, false, Vectorize) \
cflags(VectorizeDebug, uintx, 0, VectorizeDebug) \
cflags(CloneMapDebug, bool, false, CloneMapDebug) \
- cflags(IGVPrintLevel, intx, PrintIdealGraphLevel, IGVPrintLevel) \
cflags(MaxNodeLimit, intx, MaxNodeLimit, MaxNodeLimit)
#else
#define compilerdirectives_c2_flags(cflags)
--- a/src/hotspot/share/gc/cms/compactibleFreeListSpace.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/cms/compactibleFreeListSpace.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -32,7 +32,7 @@
#include "gc/shared/collectedHeap.inline.hpp"
#include "gc/shared/genOopClosures.inline.hpp"
#include "gc/shared/space.inline.hpp"
-#include "gc/shared/spaceDecorator.hpp"
+#include "gc/shared/spaceDecorator.inline.hpp"
#include "logging/log.hpp"
#include "logging/logStream.hpp"
#include "memory/allocation.inline.hpp"
--- a/src/hotspot/share/gc/cms/parNewGeneration.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/cms/parNewGeneration.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -44,7 +44,7 @@
#include "gc/shared/referencePolicy.hpp"
#include "gc/shared/referenceProcessorPhaseTimes.hpp"
#include "gc/shared/space.hpp"
-#include "gc/shared/spaceDecorator.hpp"
+#include "gc/shared/spaceDecorator.inline.hpp"
#include "gc/shared/strongRootsScope.hpp"
#include "gc/shared/taskqueue.inline.hpp"
#include "gc/shared/weakProcessor.hpp"
--- a/src/hotspot/share/gc/g1/g1BlockOffsetTable.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/g1/g1BlockOffsetTable.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -25,8 +25,7 @@
#include "precompiled.hpp"
#include "gc/g1/g1BlockOffsetTable.inline.hpp"
#include "gc/g1/g1CollectedHeap.inline.hpp"
-#include "gc/g1/heapRegion.hpp"
-#include "gc/shared/space.hpp"
+#include "gc/g1/heapRegion.inline.hpp"
#include "logging/log.hpp"
#include "oops/oop.inline.hpp"
#include "runtime/java.hpp"
@@ -74,12 +73,12 @@
// G1BlockOffsetTablePart
//////////////////////////////////////////////////////////////////////
-G1BlockOffsetTablePart::G1BlockOffsetTablePart(G1BlockOffsetTable* array, G1ContiguousSpace* gsp) :
+G1BlockOffsetTablePart::G1BlockOffsetTablePart(G1BlockOffsetTable* array, HeapRegion* hr) :
_next_offset_threshold(NULL),
_next_offset_index(0),
DEBUG_ONLY(_object_can_span(false) COMMA)
_bot(array),
- _space(gsp)
+ _hr(hr)
{
}
@@ -141,7 +140,7 @@
if (start_card > end_card) {
return;
}
- assert(start_card > _bot->index_for(_space->bottom()), "Cannot be first card");
+ assert(start_card > _bot->index_for(_hr->bottom()), "Cannot be first card");
assert(_bot->offset_array(start_card-1) <= BOTConstants::N_words,
"Offset card has an unexpected value");
size_t start_card_for_region = start_card;
@@ -224,7 +223,7 @@
"next_boundary is beyond the end of the covered region "
" next_boundary " PTR_FORMAT " _array->_end " PTR_FORMAT,
p2i(next_boundary), p2i(_bot->_reserved.end()));
- if (addr >= _space->top()) return _space->top();
+ if (addr >= _hr->top()) return _hr->top();
while (next_boundary < addr) {
while (n <= next_boundary) {
q = n;
@@ -326,9 +325,9 @@
}
void G1BlockOffsetTablePart::verify() const {
- assert(_space->bottom() < _space->top(), "Only non-empty regions should be verified.");
- size_t start_card = _bot->index_for(_space->bottom());
- size_t end_card = _bot->index_for(_space->top() - 1);
+ assert(_hr->bottom() < _hr->top(), "Only non-empty regions should be verified.");
+ size_t start_card = _bot->index_for(_hr->bottom());
+ size_t end_card = _bot->index_for(_hr->top() - 1);
for (size_t current_card = start_card; current_card < end_card; current_card++) {
u_char entry = _bot->offset_array(current_card);
@@ -342,9 +341,9 @@
HeapWord* obj = obj_end;
size_t obj_size = block_size(obj);
obj_end = obj + obj_size;
- guarantee(obj_end > obj && obj_end <= _space->top(),
+ guarantee(obj_end > obj && obj_end <= _hr->top(),
"Invalid object end. obj: " PTR_FORMAT " obj_size: " SIZE_FORMAT " obj_end: " PTR_FORMAT " top: " PTR_FORMAT,
- p2i(obj), obj_size, p2i(obj_end), p2i(_space->top()));
+ p2i(obj), obj_size, p2i(obj_end), p2i(_hr->top()));
}
} else {
// Because we refine the BOT based on which cards are dirty there is not much we can verify here.
@@ -359,9 +358,9 @@
start_card, current_card, backskip);
HeapWord* backskip_address = _bot->address_for_index(current_card - backskip);
- guarantee(backskip_address >= _space->bottom(),
+ guarantee(backskip_address >= _hr->bottom(),
"Going backwards beyond bottom of the region: bottom: " PTR_FORMAT ", backskip_address: " PTR_FORMAT,
- p2i(_space->bottom()), p2i(backskip_address));
+ p2i(_hr->bottom()), p2i(backskip_address));
}
}
}
@@ -373,13 +372,12 @@
#endif
#ifndef PRODUCT
-void
-G1BlockOffsetTablePart::print_on(outputStream* out) {
- size_t from_index = _bot->index_for(_space->bottom());
- size_t to_index = _bot->index_for(_space->end());
+void G1BlockOffsetTablePart::print_on(outputStream* out) {
+ size_t from_index = _bot->index_for(_hr->bottom());
+ size_t to_index = _bot->index_for(_hr->end());
out->print_cr(">> BOT for area [" PTR_FORMAT "," PTR_FORMAT ") "
"cards [" SIZE_FORMAT "," SIZE_FORMAT ")",
- p2i(_space->bottom()), p2i(_space->end()), from_index, to_index);
+ p2i(_hr->bottom()), p2i(_hr->end()), from_index, to_index);
for (size_t i = from_index; i < to_index; ++i) {
out->print_cr(" entry " SIZE_FORMAT_W(8) " | " PTR_FORMAT " : %3u",
i, p2i(_bot->address_for_index(i)),
@@ -391,7 +389,7 @@
#endif // !PRODUCT
HeapWord* G1BlockOffsetTablePart::initialize_threshold_raw() {
- _next_offset_index = _bot->index_for_raw(_space->bottom());
+ _next_offset_index = _bot->index_for_raw(_hr->bottom());
_next_offset_index++;
_next_offset_threshold =
_bot->address_for_index_raw(_next_offset_index);
@@ -399,14 +397,14 @@
}
void G1BlockOffsetTablePart::zero_bottom_entry_raw() {
- size_t bottom_index = _bot->index_for_raw(_space->bottom());
- assert(_bot->address_for_index_raw(bottom_index) == _space->bottom(),
+ size_t bottom_index = _bot->index_for_raw(_hr->bottom());
+ assert(_bot->address_for_index_raw(bottom_index) == _hr->bottom(),
"Precondition of call");
_bot->set_offset_array_raw(bottom_index, 0);
}
HeapWord* G1BlockOffsetTablePart::initialize_threshold() {
- _next_offset_index = _bot->index_for(_space->bottom());
+ _next_offset_index = _bot->index_for(_hr->bottom());
_next_offset_index++;
_next_offset_threshold =
_bot->address_for_index(_next_offset_index);
@@ -416,7 +414,7 @@
void G1BlockOffsetTablePart::set_for_starts_humongous(HeapWord* obj_top, size_t fill_size) {
// The first BOT entry should have offset 0.
reset_bot();
- alloc_block(_space->bottom(), obj_top);
+ alloc_block(_hr->bottom(), obj_top);
if (fill_size > 0) {
alloc_block(obj_top, fill_size);
}
--- a/src/hotspot/share/gc/g1/g1BlockOffsetTable.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/g1/g1BlockOffsetTable.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -33,14 +33,14 @@
// Forward declarations
class G1BlockOffsetTable;
-class G1ContiguousSpace;
+class HeapRegion;
// This implementation of "G1BlockOffsetTable" divides the covered region
// into "N"-word subregions (where "N" = 2^"LogN". An array with an entry
// for each such subregion indicates how far back one must go to find the
// start of the chunk that includes the first word of the subregion.
//
-// Each G1BlockOffsetTablePart is owned by a G1ContiguousSpace.
+// Each G1BlockOffsetTablePart is owned by a HeapRegion.
class G1BlockOffsetTable: public CHeapObj<mtGC> {
friend class G1BlockOffsetTablePart;
@@ -120,8 +120,8 @@
// This is the global BlockOffsetTable.
G1BlockOffsetTable* _bot;
- // The space that owns this subregion.
- G1ContiguousSpace* _space;
+ // The region that owns this subregion.
+ HeapRegion* _hr;
// Sets the entries
// corresponding to the cards starting at "start" and ending at "end"
@@ -183,7 +183,7 @@
public:
// The elements of the array are initialized to zero.
- G1BlockOffsetTablePart(G1BlockOffsetTable* array, G1ContiguousSpace* gsp);
+ G1BlockOffsetTablePart(G1BlockOffsetTable* array, HeapRegion* hr);
void verify() const;
--- a/src/hotspot/share/gc/g1/g1BlockOffsetTable.inline.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/g1/g1BlockOffsetTable.inline.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -28,11 +28,10 @@
#include "gc/g1/g1BlockOffsetTable.hpp"
#include "gc/g1/heapRegion.hpp"
#include "gc/shared/memset_with_concurrent_readers.hpp"
-#include "gc/shared/space.hpp"
#include "runtime/atomic.hpp"
inline HeapWord* G1BlockOffsetTablePart::block_start(const void* addr) {
- if (addr >= _space->bottom() && addr < _space->end()) {
+ if (addr >= _hr->bottom() && addr < _hr->end()) {
HeapWord* q = block_at_or_preceding(addr, true, _next_offset_index-1);
return forward_to_block_containing_addr(q, addr);
} else {
@@ -41,7 +40,7 @@
}
inline HeapWord* G1BlockOffsetTablePart::block_start_const(const void* addr) const {
- if (addr >= _space->bottom() && addr < _space->end()) {
+ if (addr >= _hr->bottom() && addr < _hr->end()) {
HeapWord* q = block_at_or_preceding(addr, true, _next_offset_index-1);
HeapWord* n = q + block_size(q);
return forward_to_block_containing_addr_const(q, n, addr);
@@ -107,15 +106,15 @@
}
inline size_t G1BlockOffsetTablePart::block_size(const HeapWord* p) const {
- return _space->block_size(p);
+ return _hr->block_size(p);
}
inline HeapWord* G1BlockOffsetTablePart::block_at_or_preceding(const void* addr,
bool has_max_index,
size_t max_index) const {
- assert(_object_can_span || _bot->offset_array(_bot->index_for(_space->bottom())) == 0,
+ assert(_object_can_span || _bot->offset_array(_bot->index_for(_hr->bottom())) == 0,
"Object crossed region boundary, found offset %u instead of 0",
- (uint) _bot->offset_array(_bot->index_for(_space->bottom())));
+ (uint) _bot->offset_array(_bot->index_for(_hr->bottom())));
size_t index = _bot->index_for(addr);
// We must make sure that the offset table entry we use is valid. If
// "addr" is past the end, start at the last known one and go forward.
@@ -140,7 +139,7 @@
inline HeapWord* G1BlockOffsetTablePart::forward_to_block_containing_addr_const(HeapWord* q, HeapWord* n,
const void* addr) const {
- if (addr >= _space->top()) return _space->top();
+ if (addr >= _hr->top()) return _hr->top();
while (n <= addr) {
q = n;
oop obj = oop(q);
--- a/src/hotspot/share/gc/g1/g1CollectedHeap.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/g1/g1CollectedHeap.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -664,8 +664,6 @@
next_region = NULL;
}
curr_region->set_top(top);
- curr_region->set_first_dead(top);
- curr_region->set_end_of_live(top);
curr_region = next_region;
}
@@ -3978,7 +3976,7 @@
}
if (!r->evacuation_failed()) {
- assert(r->not_empty(), "Region %u is an empty region in the collection set.", r->hrm_index());
+ assert(!r->is_empty(), "Region %u is an empty region in the collection set.", r->hrm_index());
_before_used_bytes += r->used();
g1h->free_region(r,
&_local_free_list,
--- a/src/hotspot/share/gc/g1/g1ConcurrentMark.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/g1/g1ConcurrentMark.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -32,6 +32,7 @@
#include "gc/g1/heapRegionSet.hpp"
#include "gc/shared/taskqueue.hpp"
#include "gc/shared/verifyOption.hpp"
+#include "gc/shared/workgroup.hpp"
#include "memory/allocation.hpp"
#include "utilities/compilerWarnings.hpp"
--- a/src/hotspot/share/gc/g1/g1YoungGenSizer.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/g1/g1YoungGenSizer.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -28,6 +28,7 @@
#include "gc/g1/g1YoungGenSizer.hpp"
#include "gc/g1/heapRegion.hpp"
#include "logging/log.hpp"
+#include "runtime/globals_extension.hpp"
G1YoungGenSizer::G1YoungGenSizer() : _sizer_kind(SizerDefaults),
_use_adaptive_sizing(true), _min_desired_young_length(0), _max_desired_young_length(0) {
--- a/src/hotspot/share/gc/g1/heapRegion.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/g1/heapRegion.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -35,7 +35,6 @@
#include "gc/g1/heapRegionRemSet.hpp"
#include "gc/g1/heapRegionTracer.hpp"
#include "gc/shared/genOopClosures.inline.hpp"
-#include "gc/shared/space.inline.hpp"
#include "logging/log.hpp"
#include "logging/logStream.hpp"
#include "memory/iterator.inline.hpp"
@@ -45,7 +44,6 @@
#include "oops/oop.inline.hpp"
#include "runtime/atomic.hpp"
#include "runtime/orderAccess.hpp"
-#include "utilities/growableArray.hpp"
int HeapRegion::LogOfHRGrainBytes = 0;
int HeapRegion::LogOfHRGrainWords = 0;
@@ -234,21 +232,27 @@
HeapRegion::HeapRegion(uint hrm_index,
G1BlockOffsetTable* bot,
MemRegion mr) :
- G1ContiguousSpace(bot),
- _rem_set(NULL),
- _hrm_index(hrm_index),
- _type(),
- _humongous_start_region(NULL),
- _evacuation_failed(false),
- _next(NULL), _prev(NULL),
+ _bottom(NULL),
+ _end(NULL),
+ _top(NULL),
+ _compaction_top(NULL),
+ _bot_part(bot, this),
+ _par_alloc_lock(Mutex::leaf, "HeapRegion par alloc lock", true),
+ _pre_dummy_top(NULL),
+ _rem_set(NULL),
+ _hrm_index(hrm_index),
+ _type(),
+ _humongous_start_region(NULL),
+ _evacuation_failed(false),
+ _next(NULL), _prev(NULL),
#ifdef ASSERT
- _containing_set(NULL),
+ _containing_set(NULL),
#endif
- _prev_marked_bytes(0), _next_marked_bytes(0), _gc_efficiency(0.0),
- _index_in_opt_cset(InvalidCSetIndex), _young_index_in_cset(-1),
- _surv_rate_group(NULL), _age_index(-1),
- _prev_top_at_mark_start(NULL), _next_top_at_mark_start(NULL),
- _recorded_rs_length(0), _predicted_elapsed_time_ms(0)
+ _prev_marked_bytes(0), _next_marked_bytes(0), _gc_efficiency(0.0),
+ _index_in_opt_cset(InvalidCSetIndex), _young_index_in_cset(-1),
+ _surv_rate_group(NULL), _age_index(-1),
+ _prev_top_at_mark_start(NULL), _next_top_at_mark_start(NULL),
+ _recorded_rs_length(0), _predicted_elapsed_time_ms(0)
{
_rem_set = new HeapRegionRemSet(bot, this);
@@ -258,10 +262,20 @@
void HeapRegion::initialize(MemRegion mr, bool clear_space, bool mangle_space) {
assert(_rem_set->is_empty(), "Remembered set must be empty");
- G1ContiguousSpace::initialize(mr, clear_space, mangle_space);
+ assert(Universe::on_page_boundary(mr.start()) && Universe::on_page_boundary(mr.end()),
+ "invalid space boundaries");
+
+ set_bottom(mr.start());
+ set_end(mr.end());
+ if (clear_space) {
+ clear(mangle_space);
+ }
+
+ set_top(bottom());
+ set_compaction_top(bottom());
+ reset_bot();
hr_clear(false /*par*/, false /*clear_space*/);
- set_top(bottom());
}
void HeapRegion::report_region_type_change(G1HeapRegionTraceType::Type to) {
@@ -444,6 +458,7 @@
}
void HeapRegion::print() const { print_on(tty); }
+
void HeapRegion::print_on(outputStream* st) const {
st->print("|%4u", this->_hrm_index);
st->print("|" PTR_FORMAT ", " PTR_FORMAT ", " PTR_FORMAT,
@@ -636,9 +651,6 @@
debug_only(virtual bool should_verify_oops() { return false; })
};
-// This really ought to be commoned up into OffsetTableContigSpace somehow.
-// We would need a mechanism to make that code skip dead objects.
-
void HeapRegion::verify(VerifyOption vo,
bool* failures) const {
G1CollectedHeap* g1h = G1CollectedHeap::heap();
@@ -828,51 +840,32 @@
guarantee(!failures, "HeapRegion RemSet verification failed");
}
-void HeapRegion::prepare_for_compaction(CompactPoint* cp) {
- // Not used for G1 anymore, but pure virtual in Space.
- ShouldNotReachHere();
+void HeapRegion::clear(bool mangle_space) {
+ set_top(bottom());
+ set_compaction_top(bottom());
+
+ if (ZapUnusedHeapArea && mangle_space) {
+ mangle_unused_area();
+ }
+ reset_bot();
}
-// G1OffsetTableContigSpace code; copied from space.cpp. Hope this can go
-// away eventually.
-
-void G1ContiguousSpace::clear(bool mangle_space) {
- set_top(bottom());
- CompactibleSpace::clear(mangle_space);
- reset_bot();
-}
#ifndef PRODUCT
-void G1ContiguousSpace::mangle_unused_area() {
- mangle_unused_area_complete();
-}
-
-void G1ContiguousSpace::mangle_unused_area_complete() {
+void HeapRegion::mangle_unused_area() {
SpaceMangler::mangle_region(MemRegion(top(), end()));
}
#endif
-void G1ContiguousSpace::print() const {
- print_short();
- tty->print_cr(" [" INTPTR_FORMAT ", " INTPTR_FORMAT ", "
- INTPTR_FORMAT ", " INTPTR_FORMAT ")",
- p2i(bottom()), p2i(top()), p2i(_bot_part.threshold()), p2i(end()));
-}
-
-HeapWord* G1ContiguousSpace::initialize_threshold() {
+HeapWord* HeapRegion::initialize_threshold() {
return _bot_part.initialize_threshold();
}
-HeapWord* G1ContiguousSpace::cross_threshold(HeapWord* start,
- HeapWord* end) {
+HeapWord* HeapRegion::cross_threshold(HeapWord* start, HeapWord* end) {
_bot_part.alloc_block(start, end);
return _bot_part.threshold();
}
-void G1ContiguousSpace::safe_object_iterate(ObjectClosure* blk) {
- object_iterate(blk);
-}
-
-void G1ContiguousSpace::object_iterate(ObjectClosure* blk) {
+void HeapRegion::object_iterate(ObjectClosure* blk) {
HeapWord* p = bottom();
while (p < top()) {
if (block_is_obj(p)) {
@@ -881,18 +874,3 @@
p += block_size(p);
}
}
-
-G1ContiguousSpace::G1ContiguousSpace(G1BlockOffsetTable* bot) :
- _top(NULL),
- _bot_part(bot, this),
- _par_alloc_lock(Mutex::leaf, "OffsetTableContigSpace par alloc lock", true),
- _pre_dummy_top(NULL)
-{
-}
-
-void G1ContiguousSpace::initialize(MemRegion mr, bool clear_space, bool mangle_space) {
- CompactibleSpace::initialize(mr, clear_space, mangle_space);
- _top = bottom();
- set_saved_mark_word(NULL);
- reset_bot();
-}
--- a/src/hotspot/share/gc/g1/heapRegion.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/g1/heapRegion.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -31,34 +31,13 @@
#include "gc/g1/heapRegionType.hpp"
#include "gc/g1/survRateGroup.hpp"
#include "gc/shared/ageTable.hpp"
-#include "gc/shared/cardTable.hpp"
+#include "gc/shared/spaceDecorator.hpp"
#include "gc/shared/verifyOption.hpp"
-#include "gc/shared/spaceDecorator.hpp"
+#include "runtime/mutex.hpp"
#include "utilities/macros.hpp"
-// A HeapRegion is the smallest piece of a G1CollectedHeap that
-// can be collected independently.
-
-// NOTE: Although a HeapRegion is a Space, its
-// Space::initDirtyCardClosure method must not be called.
-// The problem is that the existence of this method breaks
-// the independence of barrier sets from remembered sets.
-// The solution is to remove this method from the definition
-// of a Space.
-
-// Each heap region is self contained. top() and end() can never
-// be set beyond the end of the region. For humongous objects,
-// the first region is a StartsHumongous region. If the humongous
-// object is larger than a heap region, the following regions will
-// be of type ContinuesHumongous. In this case the top() of the
-// StartHumongous region and all ContinuesHumongous regions except
-// the last will point to their own end. The last ContinuesHumongous
-// region may have top() equal the end of object if there isn't
-// room for filler objects to pad out to the end of the region.
-
class G1CollectedHeap;
class G1CMBitMap;
-class G1IsAliveAndApplyClosure;
class HeapRegionRemSet;
class HeapRegion;
class HeapRegionSetBase;
@@ -73,31 +52,27 @@
// sentinel value for hrm_index
#define G1_NO_HRM_INDEX ((uint) -1)
-// The complicating factor is that BlockOffsetTable diverged
-// significantly, and we need functionality that is only in the G1 version.
-// So I copied that code, which led to an alternate G1 version of
-// OffsetTableContigSpace. If the two versions of BlockOffsetTable could
-// be reconciled, then G1OffsetTableContigSpace could go away.
+// A HeapRegion is the smallest piece of a G1CollectedHeap that
+// can be collected independently.
-// The idea behind time stamps is the following. We want to keep track of
-// the highest address where it's safe to scan objects for each region.
-// This is only relevant for current GC alloc regions so we keep a time stamp
-// per region to determine if the region has been allocated during the current
-// GC or not. If the time stamp is current we report a scan_top value which
-// was saved at the end of the previous GC for retained alloc regions and which is
-// equal to the bottom for all other regions.
-// There is a race between card scanners and allocating gc workers where we must ensure
-// that card scanners do not read the memory allocated by the gc workers.
-// In order to enforce that, we must not return a value of _top which is more recent than the
-// time stamp. This is due to the fact that a region may become a gc alloc region at
-// some point after we've read the timestamp value as being < the current time stamp.
-// The time stamps are re-initialized to zero at cleanup and at Full GCs.
-// The current scheme that uses sequential unsigned ints will fail only if we have 4b
-// evacuation pauses between two cleanups, which is _highly_ unlikely.
-class G1ContiguousSpace: public CompactibleSpace {
+// Each heap region is self contained. top() and end() can never
+// be set beyond the end of the region. For humongous objects,
+// the first region is a StartsHumongous region. If the humongous
+// object is larger than a heap region, the following regions will
+// be of type ContinuesHumongous. In this case the top() of the
+// StartHumongous region and all ContinuesHumongous regions except
+// the last will point to their own end. The last ContinuesHumongous
+// region may have top() equal the end of object if there isn't
+// room for filler objects to pad out to the end of the region.
+class HeapRegion : public CHeapObj<mtGC> {
friend class VMStructs;
+
+ HeapWord* _bottom;
+ HeapWord* _end;
+
HeapWord* volatile _top;
- protected:
+ HeapWord* _compaction_top;
+
G1BlockOffsetTablePart _bot_part;
Mutex _par_alloc_lock;
// When we need to retire an allocation region, while other threads
@@ -108,43 +83,57 @@
// into the region was and this is what this keeps track.
HeapWord* _pre_dummy_top;
- public:
- G1ContiguousSpace(G1BlockOffsetTable* bot);
+public:
+ void set_bottom(HeapWord* value) { _bottom = value; }
+ HeapWord* bottom() const { return _bottom; }
+
+ void set_end(HeapWord* value) { _end = value; }
+ HeapWord* end() const { return _end; }
+
+ void set_compaction_top(HeapWord* compaction_top) { _compaction_top = compaction_top; }
+ HeapWord* compaction_top() const { return _compaction_top; }
void set_top(HeapWord* value) { _top = value; }
HeapWord* top() const { return _top; }
- protected:
- // Reset the G1ContiguousSpace.
- virtual void initialize(MemRegion mr, bool clear_space, bool mangle_space);
+ // Returns true iff the given the heap region contains the
+ // given address as part of an allocated object. This may
+ // be a potentially, so we restrict its use to assertion checks only.
+ bool is_in(const void* p) const {
+ return is_in_reserved(p);
+ }
+ bool is_in(oop obj) const {
+ return is_in((void*)obj);
+ }
+ // Returns true iff the given reserved memory of the space contains the
+ // given address.
+ bool is_in_reserved(const void* p) const { return _bottom <= p && p < _end; }
- HeapWord* volatile* top_addr() { return &_top; }
- // Try to allocate at least min_word_size and up to desired_size from this Space.
+ size_t capacity() const { return byte_size(bottom(), end()); }
+ size_t used() const { return byte_size(bottom(), top()); }
+ size_t free() const { return byte_size(top(), end()); }
+
+ bool is_empty() const { return used() == 0; }
+
+private:
+ void reset_after_compaction() { set_top(compaction_top()); }
+
+ // Try to allocate at least min_word_size and up to desired_size from this region.
// Returns NULL if not possible, otherwise sets actual_word_size to the amount of
// space allocated.
- // This version assumes that all allocation requests to this Space are properly
+ // This version assumes that all allocation requests to this HeapRegion are properly
// synchronized.
inline HeapWord* allocate_impl(size_t min_word_size, size_t desired_word_size, size_t* actual_word_size);
- // Try to allocate at least min_word_size and up to desired_size from this Space.
+ // Try to allocate at least min_word_size and up to desired_size from this HeapRegion.
// Returns NULL if not possible, otherwise sets actual_word_size to the amount of
// space allocated.
// This version synchronizes with other calls to par_allocate_impl().
inline HeapWord* par_allocate_impl(size_t min_word_size, size_t desired_word_size, size_t* actual_word_size);
- public:
- void reset_after_compaction() { set_top(compaction_top()); }
-
- size_t used() const { return byte_size(bottom(), top()); }
- size_t free() const { return byte_size(top(), end()); }
- bool is_free_block(const HeapWord* p) const { return p >= top(); }
+ void mangle_unused_area() PRODUCT_RETURN;
- MemRegion used_region() const { return MemRegion(bottom(), top()); }
-
+public:
void object_iterate(ObjectClosure* blk);
- void safe_object_iterate(ObjectClosure* blk);
-
- void mangle_unused_area() PRODUCT_RETURN;
- void mangle_unused_area_complete() PRODUCT_RETURN;
// See the comment above in the declaration of _pre_dummy_top for an
// explanation of what it is.
@@ -152,32 +141,31 @@
assert(is_in(pre_dummy_top) && pre_dummy_top <= top(), "pre-condition");
_pre_dummy_top = pre_dummy_top;
}
+
HeapWord* pre_dummy_top() {
return (_pre_dummy_top == NULL) ? top() : _pre_dummy_top;
}
void reset_pre_dummy_top() { _pre_dummy_top = NULL; }
- virtual void clear(bool mangle_space);
+ void clear(bool mangle_space);
HeapWord* block_start(const void* p);
HeapWord* block_start_const(const void* p) const;
// Allocation (return NULL if full). Assumes the caller has established
- // mutually exclusive access to the space.
+ // mutually exclusive access to the HeapRegion.
HeapWord* allocate(size_t min_word_size, size_t desired_word_size, size_t* actual_word_size);
// Allocation (return NULL if full). Enforces mutual exclusion internally.
HeapWord* par_allocate(size_t min_word_size, size_t desired_word_size, size_t* actual_word_size);
- virtual HeapWord* allocate(size_t word_size);
- virtual HeapWord* par_allocate(size_t word_size);
+ HeapWord* allocate(size_t word_size);
+ HeapWord* par_allocate(size_t word_size);
HeapWord* saved_mark_word() const { ShouldNotReachHere(); return NULL; }
// MarkSweep support phase3
- virtual HeapWord* initialize_threshold();
- virtual HeapWord* cross_threshold(HeapWord* start, HeapWord* end);
-
- virtual void print() const;
+ HeapWord* initialize_threshold();
+ HeapWord* cross_threshold(HeapWord* start, HeapWord* end);
void reset_bot() {
_bot_part.reset_bot();
@@ -186,34 +174,11 @@
void print_bot_on(outputStream* out) {
_bot_part.print_on(out);
}
-};
-class HeapRegion: public G1ContiguousSpace {
- friend class VMStructs;
- // Allow scan_and_forward to call (private) overrides for auxiliary functions on this class
- template <typename SpaceType>
- friend void CompactibleSpace::scan_and_forward(SpaceType* space, CompactPoint* cp);
- private:
-
+private:
// The remembered set for this region.
- // (Might want to make this "inline" later, to avoid some alloc failure
- // issues.)
HeapRegionRemSet* _rem_set;
- // Auxiliary functions for scan_and_forward support.
- // See comments for CompactibleSpace for more information.
- inline HeapWord* scan_limit() const {
- return top();
- }
-
- inline bool scanned_block_is_obj(const HeapWord* addr) const {
- return true; // Always true, since scan_limit is top
- }
-
- inline size_t scanned_block_size(const HeapWord* addr) const {
- return HeapRegion::block_size(addr); // Avoid virtual call
- }
-
void report_region_type_change(G1HeapRegionTraceType::Type to);
// Returns whether the given object address refers to a dead object, and either the
@@ -223,7 +188,6 @@
// - not called on humongous objects or archive regions
inline bool is_obj_dead_with_size(const oop obj, const G1CMBitMap* const prev_bitmap, size_t* size) const;
- protected:
// The index of this region in the heap region sequence.
uint _hrm_index;
@@ -269,8 +233,6 @@
// "next" is the top at the start of the in-progress marking (if any.)
HeapWord* _prev_top_at_mark_start;
HeapWord* _next_top_at_mark_start;
- // If a collection pause is in progress, this is the top at the start
- // of that pause.
void init_top_at_mark_start() {
assert(_prev_marked_bytes == 0 &&
@@ -306,16 +268,14 @@
// Returns the block size of the given (dead, potentially having its class unloaded) object
// starting at p extending to at most the prev TAMS using the given mark bitmap.
inline size_t block_size_using_bitmap(const HeapWord* p, const G1CMBitMap* const prev_bitmap) const;
- public:
- HeapRegion(uint hrm_index,
- G1BlockOffsetTable* bot,
- MemRegion mr);
+public:
+ HeapRegion(uint hrm_index, G1BlockOffsetTable* bot, MemRegion mr);
// Initializing the HeapRegion not only resets the data structure, but also
// resets the BOT for that heap region.
// The default values for clear_space means that we will do the clearing if
// there's clearing to be done ourselves. We also always mangle the space.
- virtual void initialize(MemRegion mr, bool clear_space = false, bool mangle_space = SpaceDecorator::Mangle);
+ void initialize(MemRegion mr, bool clear_space = false, bool mangle_space = SpaceDecorator::Mangle);
static int LogOfHRGrainBytes;
static int LogOfHRGrainWords;
@@ -364,8 +324,6 @@
// objects to call size_t ApplyToMarkedClosure::apply(oop) for.
template<typename ApplyToMarkedClosure>
inline void apply_to_marked_objects(G1CMBitMap* bitmap, ApplyToMarkedClosure* closure);
- // Override for scan_and_forward support.
- void prepare_for_compaction(CompactPoint* cp);
// Update heap region to be consistent after compaction.
void complete_compaction();
@@ -707,8 +665,8 @@
// full GC.
void verify(VerifyOption vo, bool *failures) const;
- // Override; it uses the "prev" marking information
- virtual void verify() const;
+ // Verify using the "prev" marking information
+ void verify() const;
void verify_rem_set(VerifyOption vo, bool *failures) const;
void verify_rem_set() const;
@@ -724,7 +682,7 @@
bool _is_complete;
void set_incomplete() { _is_complete = false; }
- public:
+public:
HeapRegionClosure(): _is_complete(true) {}
// Typically called on each region until it returns true.
--- a/src/hotspot/share/gc/g1/heapRegion.inline.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/g1/heapRegion.inline.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -29,22 +29,22 @@
#include "gc/g1/g1CollectedHeap.inline.hpp"
#include "gc/g1/g1ConcurrentMarkBitMap.inline.hpp"
#include "gc/g1/heapRegion.hpp"
-#include "gc/shared/space.hpp"
#include "oops/oop.inline.hpp"
#include "runtime/atomic.hpp"
#include "runtime/prefetch.inline.hpp"
#include "utilities/align.hpp"
+#include "utilities/globalDefinitions.hpp"
-inline HeapWord* G1ContiguousSpace::allocate_impl(size_t min_word_size,
- size_t desired_word_size,
- size_t* actual_size) {
+inline HeapWord* HeapRegion::allocate_impl(size_t min_word_size,
+ size_t desired_word_size,
+ size_t* actual_size) {
HeapWord* obj = top();
size_t available = pointer_delta(end(), obj);
size_t want_to_allocate = MIN2(available, desired_word_size);
if (want_to_allocate >= min_word_size) {
HeapWord* new_top = obj + want_to_allocate;
set_top(new_top);
- assert(is_aligned(obj) && is_aligned(new_top), "checking alignment");
+ assert(is_object_aligned(obj) && is_object_aligned(new_top), "checking alignment");
*actual_size = want_to_allocate;
return obj;
} else {
@@ -52,21 +52,21 @@
}
}
-inline HeapWord* G1ContiguousSpace::par_allocate_impl(size_t min_word_size,
- size_t desired_word_size,
- size_t* actual_size) {
+inline HeapWord* HeapRegion::par_allocate_impl(size_t min_word_size,
+ size_t desired_word_size,
+ size_t* actual_size) {
do {
HeapWord* obj = top();
size_t available = pointer_delta(end(), obj);
size_t want_to_allocate = MIN2(available, desired_word_size);
if (want_to_allocate >= min_word_size) {
HeapWord* new_top = obj + want_to_allocate;
- HeapWord* result = Atomic::cmpxchg(new_top, top_addr(), obj);
+ HeapWord* result = Atomic::cmpxchg(new_top, &_top, obj);
// result can be one of two:
// the old top value: the exchange succeeded
// otherwise: the new value of the top is returned.
if (result == obj) {
- assert(is_aligned(obj) && is_aligned(new_top), "checking alignment");
+ assert(is_object_aligned(obj) && is_object_aligned(new_top), "checking alignment");
*actual_size = want_to_allocate;
return obj;
}
@@ -76,9 +76,9 @@
} while (true);
}
-inline HeapWord* G1ContiguousSpace::allocate(size_t min_word_size,
- size_t desired_word_size,
- size_t* actual_size) {
+inline HeapWord* HeapRegion::allocate(size_t min_word_size,
+ size_t desired_word_size,
+ size_t* actual_size) {
HeapWord* res = allocate_impl(min_word_size, desired_word_size, actual_size);
if (res != NULL) {
_bot_part.alloc_block(res, *actual_size);
@@ -86,12 +86,12 @@
return res;
}
-inline HeapWord* G1ContiguousSpace::allocate(size_t word_size) {
+inline HeapWord* HeapRegion::allocate(size_t word_size) {
size_t temp;
return allocate(word_size, word_size, &temp);
}
-inline HeapWord* G1ContiguousSpace::par_allocate(size_t word_size) {
+inline HeapWord* HeapRegion::par_allocate(size_t word_size) {
size_t temp;
return par_allocate(word_size, word_size, &temp);
}
@@ -99,19 +99,18 @@
// Because of the requirement of keeping "_offsets" up to date with the
// allocations, we sequentialize these with a lock. Therefore, best if
// this is used for larger LAB allocations only.
-inline HeapWord* G1ContiguousSpace::par_allocate(size_t min_word_size,
- size_t desired_word_size,
- size_t* actual_size) {
+inline HeapWord* HeapRegion::par_allocate(size_t min_word_size,
+ size_t desired_word_size,
+ size_t* actual_size) {
MutexLocker x(&_par_alloc_lock);
return allocate(min_word_size, desired_word_size, actual_size);
}
-inline HeapWord* G1ContiguousSpace::block_start(const void* p) {
+inline HeapWord* HeapRegion::block_start(const void* p) {
return _bot_part.block_start(p);
}
-inline HeapWord*
-G1ContiguousSpace::block_start_const(const void* p) const {
+inline HeapWord* HeapRegion::block_start_const(const void* p) const {
return _bot_part.block_start_const(p);
}
@@ -134,8 +133,7 @@
return obj_is_dead;
}
-inline bool
-HeapRegion::block_is_obj(const HeapWord* p) const {
+inline bool HeapRegion::block_is_obj(const HeapWord* p) const {
G1CollectedHeap* g1h = G1CollectedHeap::heap();
if (!this->is_in(p)) {
@@ -185,7 +183,7 @@
inline void HeapRegion::complete_compaction() {
// Reset space and bot after compaction is complete if needed.
reset_after_compaction();
- if (used_region().is_empty()) {
+ if (is_empty()) {
reset_bot();
}
@@ -202,7 +200,7 @@
template<typename ApplyToMarkedClosure>
inline void HeapRegion::apply_to_marked_objects(G1CMBitMap* bitmap, ApplyToMarkedClosure* closure) {
- HeapWord* limit = scan_limit();
+ HeapWord* limit = top();
HeapWord* next_addr = bottom();
while (next_addr < limit) {
--- a/src/hotspot/share/gc/g1/vmStructs_g1.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/g1/vmStructs_g1.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -37,11 +37,14 @@
static_field(HeapRegion, GrainBytes, size_t) \
static_field(HeapRegion, LogOfHRGrainBytes, int) \
\
- nonstatic_field(HeapRegion, _type, HeapRegionType) \
+ nonstatic_field(HeapRegion, _type, HeapRegionType) \
+ nonstatic_field(HeapRegion, _bottom, HeapWord*) \
+ nonstatic_field(HeapRegion, _top, HeapWord* volatile) \
+ nonstatic_field(HeapRegion, _end, HeapWord*) \
+ nonstatic_field(HeapRegion, _compaction_top, HeapWord*) \
\
nonstatic_field(HeapRegionType, _tag, HeapRegionType::Tag volatile) \
\
- nonstatic_field(G1ContiguousSpace, _top, HeapWord* volatile) \
\
nonstatic_field(G1HeapRegionTable, _base, address) \
nonstatic_field(G1HeapRegionTable, _length, size_t) \
@@ -94,8 +97,7 @@
\
declare_type(G1CollectedHeap, CollectedHeap) \
\
- declare_type(G1ContiguousSpace, CompactibleSpace) \
- declare_type(HeapRegion, G1ContiguousSpace) \
+ declare_toplevel_type(HeapRegion) \
declare_toplevel_type(HeapRegionManager) \
declare_toplevel_type(HeapRegionSetBase) \
declare_toplevel_type(G1MonitoringSupport) \
--- a/src/hotspot/share/gc/parallel/asPSYoungGen.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/parallel/asPSYoungGen.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -30,7 +30,7 @@
#include "gc/parallel/psYoungGen.hpp"
#include "gc/shared/gcUtil.hpp"
#include "gc/shared/genArguments.hpp"
-#include "gc/shared/spaceDecorator.hpp"
+#include "gc/shared/spaceDecorator.inline.hpp"
#include "oops/oop.inline.hpp"
#include "runtime/java.hpp"
#include "utilities/align.hpp"
--- a/src/hotspot/share/gc/parallel/mutableSpace.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/parallel/mutableSpace.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -24,7 +24,7 @@
#include "precompiled.hpp"
#include "gc/parallel/mutableSpace.hpp"
-#include "gc/shared/spaceDecorator.hpp"
+#include "gc/shared/spaceDecorator.inline.hpp"
#include "memory/iterator.inline.hpp"
#include "memory/universe.hpp"
#include "oops/oop.inline.hpp"
--- a/src/hotspot/share/gc/parallel/psMarkSweep.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/parallel/psMarkSweep.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -48,7 +48,7 @@
#include "gc/shared/referencePolicy.hpp"
#include "gc/shared/referenceProcessor.hpp"
#include "gc/shared/referenceProcessorPhaseTimes.hpp"
-#include "gc/shared/spaceDecorator.hpp"
+#include "gc/shared/spaceDecorator.inline.hpp"
#include "gc/shared/weakProcessor.hpp"
#include "memory/universe.hpp"
#include "logging/log.hpp"
--- a/src/hotspot/share/gc/parallel/psMarkSweepDecorator.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/parallel/psMarkSweepDecorator.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -31,7 +31,7 @@
#include "gc/parallel/psMarkSweepDecorator.hpp"
#include "gc/parallel/psParallelCompact.inline.hpp"
#include "gc/serial/markSweep.inline.hpp"
-#include "gc/shared/spaceDecorator.hpp"
+#include "gc/shared/spaceDecorator.inline.hpp"
#include "memory/iterator.inline.hpp"
#include "oops/oop.inline.hpp"
#include "runtime/prefetch.inline.hpp"
--- a/src/hotspot/share/gc/parallel/psOldGen.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/parallel/psOldGen.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -33,7 +33,7 @@
#include "gc/parallel/psOldGen.hpp"
#include "gc/shared/cardTableBarrierSet.hpp"
#include "gc/shared/gcLocker.hpp"
-#include "gc/shared/spaceDecorator.hpp"
+#include "gc/shared/spaceDecorator.inline.hpp"
#include "logging/log.hpp"
#include "oops/oop.inline.hpp"
#include "runtime/java.hpp"
--- a/src/hotspot/share/gc/parallel/psParallelCompact.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/parallel/psParallelCompact.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -52,7 +52,7 @@
#include "gc/shared/referencePolicy.hpp"
#include "gc/shared/referenceProcessor.hpp"
#include "gc/shared/referenceProcessorPhaseTimes.hpp"
-#include "gc/shared/spaceDecorator.hpp"
+#include "gc/shared/spaceDecorator.inline.hpp"
#include "gc/shared/weakProcessor.hpp"
#include "gc/shared/workerPolicy.hpp"
#include "gc/shared/workgroup.hpp"
--- a/src/hotspot/share/gc/parallel/psScavenge.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/parallel/psScavenge.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -48,7 +48,7 @@
#include "gc/shared/referenceProcessor.hpp"
#include "gc/shared/referenceProcessorPhaseTimes.hpp"
#include "gc/shared/scavengableNMethods.hpp"
-#include "gc/shared/spaceDecorator.hpp"
+#include "gc/shared/spaceDecorator.inline.hpp"
#include "gc/shared/weakProcessor.hpp"
#include "gc/shared/workerPolicy.hpp"
#include "gc/shared/workgroup.hpp"
--- a/src/hotspot/share/gc/parallel/psYoungGen.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/parallel/psYoungGen.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -30,7 +30,7 @@
#include "gc/parallel/psYoungGen.hpp"
#include "gc/shared/gcUtil.hpp"
#include "gc/shared/genArguments.hpp"
-#include "gc/shared/spaceDecorator.hpp"
+#include "gc/shared/spaceDecorator.inline.hpp"
#include "logging/log.hpp"
#include "oops/oop.inline.hpp"
#include "runtime/java.hpp"
--- a/src/hotspot/share/gc/serial/defNewGeneration.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/serial/defNewGeneration.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -43,7 +43,7 @@
#include "gc/shared/referencePolicy.hpp"
#include "gc/shared/referenceProcessorPhaseTimes.hpp"
#include "gc/shared/space.inline.hpp"
-#include "gc/shared/spaceDecorator.hpp"
+#include "gc/shared/spaceDecorator.inline.hpp"
#include "gc/shared/strongRootsScope.hpp"
#include "gc/shared/weakProcessor.hpp"
#include "logging/log.hpp"
--- a/src/hotspot/share/gc/shared/c2/barrierSetC2.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/shared/c2/barrierSetC2.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -96,7 +96,6 @@
store = kit->store_to_memory(kit->control(), access.addr().node(), val.node(), access.type(),
access.addr().type(), mo, requires_atomic_access, unaligned, mismatched, unsafe);
- access.set_raw_access(store);
} else {
assert(!requires_atomic_access, "not yet supported");
assert(access.is_opt_access(), "either parse or opt access");
@@ -120,6 +119,8 @@
mm->set_memory_at(alias, st);
}
}
+ access.set_raw_access(store);
+
return store;
}
@@ -153,7 +154,6 @@
load = kit->make_load(control, adr, val_type, access.type(), adr_type, mo,
dep, requires_atomic_access, unaligned, mismatched, unsafe);
}
- access.set_raw_access(load);
} else {
assert(!requires_atomic_access, "not yet supported");
assert(access.is_opt_access(), "either parse or opt access");
@@ -165,6 +165,7 @@
load = LoadNode::make(gvn, control, mem, adr, adr_type, val_type, access.type(), mo, dep, unaligned, mismatched);
load = gvn.transform(load);
}
+ access.set_raw_access(load);
return load;
}
@@ -806,7 +807,8 @@
Node* dest_offset = ac->in(ArrayCopyNode::DestPos);
Node* length = ac->in(ArrayCopyNode::Length);
- assert (src_offset == NULL && dest_offset == NULL, "for clone offsets should be null");
+ assert (src_offset == NULL, "for clone offsets should be null");
+ assert (dest_offset == NULL, "for clone offsets should be null");
const char* copyfunc_name = "arraycopy";
address copyfunc_addr =
--- a/src/hotspot/share/gc/shared/generation.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/shared/generation.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -35,7 +35,7 @@
#include "gc/shared/generation.hpp"
#include "gc/shared/generationSpec.hpp"
#include "gc/shared/space.inline.hpp"
-#include "gc/shared/spaceDecorator.hpp"
+#include "gc/shared/spaceDecorator.inline.hpp"
#include "logging/log.hpp"
#include "memory/allocation.inline.hpp"
#include "oops/oop.inline.hpp"
--- a/src/hotspot/share/gc/shared/space.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/shared/space.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -31,7 +31,7 @@
#include "gc/shared/genOopClosures.inline.hpp"
#include "gc/shared/space.hpp"
#include "gc/shared/space.inline.hpp"
-#include "gc/shared/spaceDecorator.hpp"
+#include "gc/shared/spaceDecorator.inline.hpp"
#include "memory/iterator.inline.hpp"
#include "memory/universe.hpp"
#include "oops/oop.inline.hpp"
--- a/src/hotspot/share/gc/shared/spaceDecorator.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/shared/spaceDecorator.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -23,8 +23,9 @@
*/
#include "precompiled.hpp"
+#include "gc/parallel/mutableSpace.hpp"
#include "gc/shared/space.inline.hpp"
-#include "gc/shared/spaceDecorator.hpp"
+#include "gc/shared/spaceDecorator.inline.hpp"
#include "logging/log.hpp"
#include "utilities/copy.hpp"
--- a/src/hotspot/share/gc/shared/spaceDecorator.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/shared/spaceDecorator.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -25,8 +25,8 @@
#ifndef SHARE_GC_SHARED_SPACEDECORATOR_HPP
#define SHARE_GC_SHARED_SPACEDECORATOR_HPP
-#include "gc/parallel/mutableSpace.hpp"
-#include "gc/shared/space.hpp"
+#include "memory/allocation.hpp"
+#include "memory/memRegion.hpp"
#include "utilities/globalDefinitions.hpp"
class SpaceDecorator: public AllStatic {
@@ -120,6 +120,7 @@
};
class ContiguousSpace;
+class MutableSpace;
// For use with GenCollectedHeap's
class GenSpaceMangler: public SpaceMangler {
@@ -127,8 +128,8 @@
ContiguousSpace* sp() { return _sp; }
- HeapWord* top() const { return _sp->top(); }
- HeapWord* end() const { return _sp->end(); }
+ HeapWord* top() const;
+ HeapWord* end() const;
public:
GenSpaceMangler(ContiguousSpace* sp) : SpaceMangler(), _sp(sp) {}
@@ -140,8 +141,8 @@
MutableSpace* sp() { return _sp; }
- HeapWord* top() const { return _sp->top(); }
- HeapWord* end() const { return _sp->end(); }
+ HeapWord* top() const;
+ HeapWord* end() const;
public:
MutableSpaceMangler(MutableSpace* sp) : SpaceMangler(), _sp(sp) {}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/src/hotspot/share/gc/shared/spaceDecorator.inline.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -0,0 +1,39 @@
+/*
+ * Copyright (c) 2019, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+#ifndef SHARE_GC_SHARED_SPACEDECORATOR_INLINE_HPP
+#define SHARE_GC_SHARED_SPACEDECORATOR_INLINE_HPP
+
+#include "gc/parallel/mutableSpace.hpp"
+#include "gc/shared/space.hpp"
+#include "gc/shared/spaceDecorator.hpp"
+#include "utilities/globalDefinitions.hpp"
+
+inline HeapWord* GenSpaceMangler::top() const { return _sp->top(); }
+inline HeapWord* GenSpaceMangler::end() const { return _sp->end(); }
+
+inline HeapWord* MutableSpaceMangler::top() const { return _sp->top(); }
+inline HeapWord* MutableSpaceMangler::end() const { return _sp->end(); }
+
+#endif // SHARE_GC_SHARED_SPACEDECORATOR_INLINE_HPP
--- a/src/hotspot/share/gc/shenandoah/c1/shenandoahBarrierSetC1.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/shenandoah/c1/shenandoahBarrierSetC1.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -24,6 +24,7 @@
#include "precompiled.hpp"
#include "c1/c1_IR.hpp"
#include "gc/shared/satbMarkQueue.hpp"
+#include "gc/shenandoah/shenandoahBarrierSet.hpp"
#include "gc/shenandoah/shenandoahBarrierSetAssembler.hpp"
#include "gc/shenandoah/shenandoahHeap.hpp"
#include "gc/shenandoah/shenandoahHeapRegion.hpp"
@@ -203,46 +204,48 @@
}
void ShenandoahBarrierSetC1::load_at_resolved(LIRAccess& access, LIR_Opr result) {
+ // 1: non-reference load, no additional barrier is needed
if (!access.is_oop()) {
BarrierSetC1::load_at_resolved(access, result);
return;
}
LIRGenerator* gen = access.gen();
-
DecoratorSet decorators = access.decorators();
- bool is_traversal_mode = ShenandoahHeap::heap()->is_traversal_mode();
+ BasicType type = access.type();
- if ((decorators & IN_NATIVE) != 0 && !is_traversal_mode) {
- assert(access.is_oop(), "IN_NATIVE access only for oop values");
- BarrierSetC1::load_at_resolved(access, result);
- LIR_OprList* args = new LIR_OprList();
- LIR_Opr addr = access.resolved_addr();
- addr = ensure_in_register(gen, addr);
- args->append(result);
- args->append(addr);
- BasicTypeList signature;
- signature.append(T_OBJECT);
- signature.append(T_ADDRESS);
- LIR_Opr call_result = gen->call_runtime(&signature, args,
- CAST_FROM_FN_PTR(address, ShenandoahRuntime::load_reference_barrier_native),
- objectType, NULL);
- __ move(call_result, result);
- } else {
- if (ShenandoahLoadRefBarrier) {
+ // 2: load a reference from src location and apply LRB if ShenandoahLoadRefBarrier is set
+ if (ShenandoahBarrierSet::need_load_reference_barrier(decorators, type)) {
+ if (ShenandoahBarrierSet::use_load_reference_barrier_native(decorators, type)) {
+ BarrierSetC1::load_at_resolved(access, result);
+ LIR_OprList* args = new LIR_OprList();
+ LIR_Opr addr = access.resolved_addr();
+ addr = ensure_in_register(gen, addr);
+ args->append(result);
+ args->append(addr);
+ BasicTypeList signature;
+ signature.append(T_OBJECT);
+ signature.append(T_ADDRESS);
+ LIR_Opr call_result = gen->call_runtime(&signature, args,
+ CAST_FROM_FN_PTR(address, ShenandoahRuntime::load_reference_barrier_native),
+ objectType, NULL);
+ __ move(call_result, result);
+ } else {
LIR_Opr tmp = gen->new_register(T_OBJECT);
BarrierSetC1::load_at_resolved(access, tmp);
- tmp = load_reference_barrier(access.gen(), tmp, access.resolved_addr());
+ tmp = load_reference_barrier(gen, tmp, access.resolved_addr());
__ move(tmp, result);
- } else {
- BarrierSetC1::load_at_resolved(access, result);
}
+ } else {
+ BarrierSetC1::load_at_resolved(access, result);
}
+ // 3: apply keep-alive barrier if ShenandoahKeepAliveBarrier is set
if (ShenandoahKeepAliveBarrier) {
bool is_weak = (decorators & ON_WEAK_OOP_REF) != 0;
bool is_phantom = (decorators & ON_PHANTOM_OOP_REF) != 0;
bool is_anonymous = (decorators & ON_UNKNOWN_OOP_REF) != 0;
+ bool is_traversal_mode = ShenandoahHeap::heap()->is_traversal_mode();
bool keep_alive = (decorators & AS_NO_KEEPALIVE) == 0 || is_traversal_mode;
if ((is_weak || is_phantom || is_anonymous) && keep_alive) {
@@ -252,13 +255,13 @@
Lcont_anonymous = new LabelObj();
generate_referent_check(access, Lcont_anonymous);
}
- pre_barrier(access.gen(), access.access_emit_info(), access.decorators(), LIR_OprFact::illegalOpr /* addr_opr */,
+ pre_barrier(gen, access.access_emit_info(), decorators, LIR_OprFact::illegalOpr /* addr_opr */,
result /* pre_val */);
if (is_anonymous) {
__ branch_destination(Lcont_anonymous->label());
}
}
- }
+ }
}
class C1ShenandoahPreBarrierCodeGenClosure : public StubAssemblerCodeGenClosure {
--- a/src/hotspot/share/gc/shenandoah/c2/shenandoahBarrierSetC2.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/shenandoah/c2/shenandoahBarrierSetC2.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -23,6 +23,7 @@
#include "precompiled.hpp"
#include "gc/shared/barrierSet.hpp"
+#include "gc/shenandoah/shenandoahBarrierSet.hpp"
#include "gc/shenandoah/shenandoahForwarding.hpp"
#include "gc/shenandoah/shenandoahHeap.hpp"
#include "gc/shenandoah/shenandoahHeuristics.hpp"
@@ -534,66 +535,70 @@
}
Node* ShenandoahBarrierSetC2::load_at_resolved(C2Access& access, const Type* val_type) const {
- DecoratorSet decorators = access.decorators();
+ // 1: non-reference load, no additional barrier is needed
+ if (!access.is_oop()) {
+ return BarrierSetC2::load_at_resolved(access, val_type);;
+ }
- Node* adr = access.addr().node();
- Node* obj = access.base();
+ Node* load = BarrierSetC2::load_at_resolved(access, val_type);
+ DecoratorSet decorators = access.decorators();
+ BasicType type = access.type();
- bool mismatched = (decorators & C2_MISMATCHED) != 0;
- bool unknown = (decorators & ON_UNKNOWN_OOP_REF) != 0;
- bool on_heap = (decorators & IN_HEAP) != 0;
- bool on_weak_ref = (decorators & (ON_WEAK_OOP_REF | ON_PHANTOM_OOP_REF)) != 0;
- bool is_unordered = (decorators & MO_UNORDERED) != 0;
- bool need_cpu_mem_bar = !is_unordered || mismatched || !on_heap;
- bool is_traversal_mode = ShenandoahHeap::heap()->is_traversal_mode();
- bool keep_alive = (decorators & AS_NO_KEEPALIVE) == 0 || is_traversal_mode;
- bool in_native = (decorators & IN_NATIVE) != 0;
-
- Node* top = Compile::current()->top();
-
- Node* offset = adr->is_AddP() ? adr->in(AddPNode::Offset) : top;
- Node* load = BarrierSetC2::load_at_resolved(access, val_type);
-
- if (access.is_oop()) {
- if (ShenandoahLoadRefBarrier) {
- load = new ShenandoahLoadReferenceBarrierNode(NULL, load, in_native && !is_traversal_mode);
- if (access.is_parse_access()) {
- load = static_cast<C2ParseAccess &>(access).kit()->gvn().transform(load);
- } else {
- load = static_cast<C2OptAccess &>(access).gvn().transform(load);
- }
+ // 2: apply LRB if needed
+ if (ShenandoahBarrierSet::need_load_reference_barrier(decorators, type)) {
+ load = new ShenandoahLoadReferenceBarrierNode(NULL,
+ load,
+ ShenandoahBarrierSet::use_load_reference_barrier_native(decorators, type));
+ if (access.is_parse_access()) {
+ load = static_cast<C2ParseAccess &>(access).kit()->gvn().transform(load);
+ } else {
+ load = static_cast<C2OptAccess &>(access).gvn().transform(load);
}
}
- // If we are reading the value of the referent field of a Reference
- // object (either by using Unsafe directly or through reflection)
- // then, if SATB is enabled, we need to record the referent in an
- // SATB log buffer using the pre-barrier mechanism.
- // Also we need to add memory barrier to prevent commoning reads
- // from this field across safepoint since GC can change its value.
- bool need_read_barrier = ShenandoahKeepAliveBarrier &&
- (on_weak_ref || (unknown && offset != top && obj != top));
+ // 3: apply keep-alive barrier if needed
+ if (ShenandoahBarrierSet::need_keep_alive_barrier(decorators, type)) {
+ Node* top = Compile::current()->top();
+ Node* adr = access.addr().node();
+ Node* offset = adr->is_AddP() ? adr->in(AddPNode::Offset) : top;
+ Node* obj = access.base();
- if (!access.is_oop() || !need_read_barrier) {
- return load;
- }
+ bool unknown = (decorators & ON_UNKNOWN_OOP_REF) != 0;
+ bool on_weak_ref = (decorators & (ON_WEAK_OOP_REF | ON_PHANTOM_OOP_REF)) != 0;
+ bool is_traversal_mode = ShenandoahHeap::heap()->is_traversal_mode();
+ bool keep_alive = (decorators & AS_NO_KEEPALIVE) == 0 || is_traversal_mode;
+
+ // If we are reading the value of the referent field of a Reference
+ // object (either by using Unsafe directly or through reflection)
+ // then, if SATB is enabled, we need to record the referent in an
+ // SATB log buffer using the pre-barrier mechanism.
+ // Also we need to add memory barrier to prevent commoning reads
+ // from this field across safepoint since GC can change its value.
+ if (!on_weak_ref || (unknown && (offset == top || obj == top)) || !keep_alive) {
+ return load;
+ }
- assert(access.is_parse_access(), "entry not supported at optimization time");
- C2ParseAccess& parse_access = static_cast<C2ParseAccess&>(access);
- GraphKit* kit = parse_access.kit();
+ assert(access.is_parse_access(), "entry not supported at optimization time");
+ C2ParseAccess& parse_access = static_cast<C2ParseAccess&>(access);
+ GraphKit* kit = parse_access.kit();
+ bool mismatched = (decorators & C2_MISMATCHED) != 0;
+ bool is_unordered = (decorators & MO_UNORDERED) != 0;
+ bool in_native = (decorators & IN_NATIVE) != 0;
+ bool need_cpu_mem_bar = !is_unordered || mismatched || in_native;
- if (on_weak_ref && keep_alive) {
- // Use the pre-barrier to record the value in the referent field
- satb_write_barrier_pre(kit, false /* do_load */,
- NULL /* obj */, NULL /* adr */, max_juint /* alias_idx */, NULL /* val */, NULL /* val_type */,
- load /* pre_val */, T_OBJECT);
- // Add memory barrier to prevent commoning reads from this field
- // across safepoint since GC can change its value.
- kit->insert_mem_bar(Op_MemBarCPUOrder);
- } else if (unknown) {
- // We do not require a mem bar inside pre_barrier if need_mem_bar
- // is set: the barriers would be emitted by us.
- insert_pre_barrier(kit, obj, offset, load, !need_cpu_mem_bar);
+ if (on_weak_ref) {
+ // Use the pre-barrier to record the value in the referent field
+ satb_write_barrier_pre(kit, false /* do_load */,
+ NULL /* obj */, NULL /* adr */, max_juint /* alias_idx */, NULL /* val */, NULL /* val_type */,
+ load /* pre_val */, T_OBJECT);
+ // Add memory barrier to prevent commoning reads from this field
+ // across safepoint since GC can change its value.
+ kit->insert_mem_bar(Op_MemBarCPUOrder);
+ } else if (unknown) {
+ // We do not require a mem bar inside pre_barrier if need_mem_bar
+ // is set: the barriers would be emitted by us.
+ insert_pre_barrier(kit, obj, offset, load, !need_cpu_mem_bar);
+ }
}
return load;
@@ -754,7 +759,7 @@
return true;
} else if (mode == LoopOptsShenandoahPostExpand) {
assert(UseShenandoahGC, "only for shenandoah");
- visited.Clear();
+ visited.clear();
ShenandoahBarrierC2Support::optimize_after_expansion(visited, nstack, worklist, phase);
return true;
}
--- a/src/hotspot/share/gc/shenandoah/c2/shenandoahSupport.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/shenandoah/c2/shenandoahSupport.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -383,7 +383,7 @@
(!verify_helper(in1, phis, visited, ShenandoahValue, trace, barriers_used) ||
!verify_helper(in2, phis, visited, ShenandoahValue, trace, barriers_used))) {
phis.clear();
- visited.Reset();
+ visited.reset();
}
}
} else if (n->is_LoadStore()) {
@@ -635,7 +635,7 @@
for (uint i = sfpt->jvms()->scloff(); i < sfpt->jvms()->endoff(); i++) {
if (!verify_helper(sfpt->in(i), phis, visited, ShenandoahLoad, trace, barriers_used)) {
phis.clear();
- visited.Reset();
+ visited.reset();
}
}
}
@@ -2368,7 +2368,7 @@
// Iterate over CFG nodes in rpo and propagate memory state to
// compute memory state at regions, creating new phis if needed.
Node_List rpo_list;
- visited.Clear();
+ visited.clear();
_phase->rpo(_phase->C->root(), stack, visited, rpo_list);
Node* root = rpo_list.pop();
assert(root == _phase->C->root(), "");
--- a/src/hotspot/share/gc/shenandoah/shenandoahArguments.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/shenandoah/shenandoahArguments.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -71,7 +71,7 @@
// compromise here.
bool ergo_conc = FLAG_IS_DEFAULT(ConcGCThreads);
if (ergo_conc) {
- FLAG_SET_DEFAULT(ConcGCThreads, MAX2(1, os::processor_count() / 4));
+ FLAG_SET_DEFAULT(ConcGCThreads, MAX2(1, os::initial_active_processor_count() / 4));
}
if (ConcGCThreads == 0) {
@@ -85,7 +85,7 @@
// the number of concurrent threads.
bool ergo_parallel = FLAG_IS_DEFAULT(ParallelGCThreads);
if (ergo_parallel) {
- FLAG_SET_DEFAULT(ParallelGCThreads, MAX2(1, os::processor_count() / 2));
+ FLAG_SET_DEFAULT(ParallelGCThreads, MAX2(1, os::initial_active_processor_count() / 2));
}
if (ParallelGCThreads == 0) {
--- a/src/hotspot/share/gc/shenandoah/shenandoahBarrierSet.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/shenandoah/shenandoahBarrierSet.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -27,6 +27,7 @@
#include "gc/shenandoah/shenandoahBarrierSetClone.inline.hpp"
#include "gc/shenandoah/shenandoahBarrierSetAssembler.hpp"
#include "gc/shenandoah/shenandoahCollectorPolicy.hpp"
+#include "gc/shenandoah/shenandoahConcurrentRoots.hpp"
#include "gc/shenandoah/shenandoahHeap.inline.hpp"
#include "gc/shenandoah/shenandoahHeuristics.hpp"
#include "gc/shenandoah/shenandoahTraversalGC.hpp"
@@ -71,6 +72,35 @@
return true;
}
+bool ShenandoahBarrierSet::need_load_reference_barrier(DecoratorSet decorators, BasicType type) {
+ if (!ShenandoahLoadRefBarrier) return false;
+ // Only needed for references
+ return is_reference_type(type);
+}
+
+bool ShenandoahBarrierSet::use_load_reference_barrier_native(DecoratorSet decorators, BasicType type) {
+ assert(need_load_reference_barrier(decorators, type), "Should be subset of LRB");
+ assert(is_reference_type(type), "Why we here?");
+ // Native load reference barrier is only needed for concurrent root processing
+ if (!ShenandoahConcurrentRoots::can_do_concurrent_roots()) {
+ return false;
+ }
+
+ return (decorators & IN_NATIVE) != 0;
+}
+
+bool ShenandoahBarrierSet::need_keep_alive_barrier(DecoratorSet decorators,BasicType type) {
+ if (!ShenandoahKeepAliveBarrier) return false;
+ // Only needed for references
+ if (!is_reference_type(type)) return false;
+
+ bool keep_alive = (decorators & AS_NO_KEEPALIVE) == 0;
+ bool unknown = (decorators & ON_UNKNOWN_OOP_REF) != 0;
+ bool is_traversal_mode = ShenandoahHeap::heap()->is_traversal_mode();
+ bool on_weak_ref = (decorators & (ON_WEAK_OOP_REF | ON_PHANTOM_OOP_REF)) != 0;
+ return (on_weak_ref || unknown) && (keep_alive || is_traversal_mode);
+}
+
template <class T>
inline void ShenandoahBarrierSet::inline_write_ref_field_pre(T* field, oop new_val) {
shenandoah_assert_not_in_cset_loc_except(field, _heap->cancelled_gc());
--- a/src/hotspot/share/gc/shenandoah/shenandoahBarrierSet.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/shenandoah/shenandoahBarrierSet.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -57,6 +57,10 @@
return barrier_set()->_satb_mark_queue_set;
}
+ static bool need_load_reference_barrier(DecoratorSet decorators, BasicType type);
+ static bool use_load_reference_barrier_native(DecoratorSet decorators, BasicType type);
+ static bool need_keep_alive_barrier(DecoratorSet decorators, BasicType type);
+
void print_on(outputStream* st) const;
bool is_a(BarrierSet::Name bsn);
--- a/src/hotspot/share/gc/shenandoah/shenandoahRootProcessor.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/shenandoah/shenandoahRootProcessor.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -28,7 +28,7 @@
#include "classfile/systemDictionary.hpp"
#include "code/codeCache.hpp"
#include "gc/shenandoah/shenandoahRootProcessor.inline.hpp"
-#include "gc/shenandoah/shenandoahHeap.hpp"
+#include "gc/shenandoah/shenandoahHeap.inline.hpp"
#include "gc/shenandoah/shenandoahPhaseTimings.hpp"
#include "gc/shenandoah/shenandoahStringDedup.hpp"
#include "gc/shenandoah/shenandoahTimingTracker.hpp"
--- a/src/hotspot/share/gc/z/c2/zBarrierSetC2.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/z/c2/zBarrierSetC2.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -27,14 +27,17 @@
#include "gc/z/zBarrierSet.hpp"
#include "gc/z/zBarrierSetAssembler.hpp"
#include "gc/z/zBarrierSetRuntime.hpp"
+#include "opto/arraycopynode.hpp"
#include "opto/block.hpp"
#include "opto/compile.hpp"
#include "opto/graphKit.hpp"
#include "opto/machnode.hpp"
+#include "opto/macro.hpp"
#include "opto/memnode.hpp"
#include "opto/node.hpp"
#include "opto/regalloc.hpp"
#include "opto/rootnode.hpp"
+#include "opto/type.hpp"
#include "utilities/growableArray.hpp"
#include "utilities/macros.hpp"
@@ -223,6 +226,56 @@
return type == T_OBJECT || type == T_ARRAY;
}
+static const TypeFunc* clone_type() {
+ // Create input type (domain)
+ const Type** domain_fields = TypeTuple::fields(3);
+ domain_fields[TypeFunc::Parms + 0] = TypeInstPtr::NOTNULL; // src
+ domain_fields[TypeFunc::Parms + 1] = TypeInstPtr::NOTNULL; // dst
+ domain_fields[TypeFunc::Parms + 2] = TypeInt::INT; // size
+ const TypeTuple* domain = TypeTuple::make(TypeFunc::Parms + 3, domain_fields);
+
+ // Create result type (range)
+ const Type** range_fields = TypeTuple::fields(0);
+ const TypeTuple* range = TypeTuple::make(TypeFunc::Parms + 0, range_fields);
+
+ return TypeFunc::make(domain, range);
+}
+
+void ZBarrierSetC2::clone_at_expansion(PhaseMacroExpand* phase, ArrayCopyNode* ac) const {
+ Node* const src = ac->in(ArrayCopyNode::Src);
+
+ if (src->bottom_type()->isa_aryptr()) {
+ // Clone primitive array
+ BarrierSetC2::clone_at_expansion(phase, ac);
+ return;
+ }
+
+ // Clone instance
+ Node* const ctrl = ac->in(TypeFunc::Control);
+ Node* const mem = ac->in(TypeFunc::Memory);
+ Node* const dst = ac->in(ArrayCopyNode::Dest);
+ Node* const src_offset = ac->in(ArrayCopyNode::SrcPos);
+ Node* const dst_offset = ac->in(ArrayCopyNode::DestPos);
+ Node* const size = ac->in(ArrayCopyNode::Length);
+
+ assert(src->bottom_type()->isa_instptr(), "Should be an instance");
+ assert(dst->bottom_type()->isa_instptr(), "Should be an instance");
+ assert(src_offset == NULL, "Should be null");
+ assert(dst_offset == NULL, "Should be null");
+
+ Node* const call = phase->make_leaf_call(ctrl,
+ mem,
+ clone_type(),
+ ZBarrierSetRuntime::clone_addr(),
+ "ZBarrierSetRuntime::clone",
+ TypeRawPtr::BOTTOM,
+ src,
+ dst,
+ size);
+ phase->transform_later(call);
+ phase->igvn().replace_node(ac, call);
+}
+
// == Dominating barrier elision ==
static bool block_has_safepoint(const Block* block, uint from, uint to) {
--- a/src/hotspot/share/gc/z/c2/zBarrierSetC2.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/z/c2/zBarrierSetC2.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -82,6 +82,8 @@
BasicType type,
bool is_clone,
ArrayCopyPhase phase) const;
+ virtual void clone_at_expansion(PhaseMacroExpand* phase,
+ ArrayCopyNode* ac) const;
virtual void late_barrier_analysis() const;
virtual int estimate_stub_size() const;
--- a/src/hotspot/share/gc/z/zBarrierSetRuntime.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/z/zBarrierSetRuntime.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -42,6 +42,10 @@
ZBarrier::load_barrier_on_oop_array(p, length);
JRT_END
+JRT_LEAF(void, ZBarrierSetRuntime::clone(oop src, oop dst, size_t size))
+ HeapAccess<>::clone(src, dst, size);
+JRT_END
+
address ZBarrierSetRuntime::load_barrier_on_oop_field_preloaded_addr(DecoratorSet decorators) {
if (decorators & ON_PHANTOM_OOP_REF) {
return load_barrier_on_phantom_oop_field_preloaded_addr();
@@ -67,3 +71,7 @@
address ZBarrierSetRuntime::load_barrier_on_oop_array_addr() {
return reinterpret_cast<address>(load_barrier_on_oop_array);
}
+
+address ZBarrierSetRuntime::clone_addr() {
+ return reinterpret_cast<address>(clone);
+}
--- a/src/hotspot/share/gc/z/zBarrierSetRuntime.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/gc/z/zBarrierSetRuntime.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -36,6 +36,7 @@
static oopDesc* load_barrier_on_weak_oop_field_preloaded(oopDesc* o, oop* p);
static oopDesc* load_barrier_on_phantom_oop_field_preloaded(oopDesc* o, oop* p);
static void load_barrier_on_oop_array(oop* p, size_t length);
+ static void clone(oop src, oop dst, size_t size);
public:
static address load_barrier_on_oop_field_preloaded_addr(DecoratorSet decorators);
@@ -43,6 +44,7 @@
static address load_barrier_on_weak_oop_field_preloaded_addr();
static address load_barrier_on_phantom_oop_field_preloaded_addr();
static address load_barrier_on_oop_array_addr();
+ static address clone_addr();
};
#endif // SHARE_GC_Z_ZBARRIERSETRUNTIME_HPP
--- a/src/hotspot/share/include/jvm.h Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/include/jvm.h Fri Nov 08 20:41:14 2019 -0500
@@ -346,11 +346,6 @@
JNIEXPORT jclass JNICALL
JVM_FindPrimitiveClass(JNIEnv *env, const char *utf);
-/*
- * Link the 'arg' class
- */
-JNIEXPORT void JNICALL
-JVM_LinkClass(JNIEnv *env, jclass classClass, jclass arg);
/*
* Find a class from a boot class loader. Returns NULL if class not found.
--- a/src/hotspot/share/jfr/recorder/checkpoint/types/traceid/jfrTraceId.inline.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/jfr/recorder/checkpoint/types/traceid/jfrTraceId.inline.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -42,7 +42,10 @@
template <typename T>
inline traceid set_used_and_get(const T* type) {
assert(type != NULL, "invariant");
- SET_USED_THIS_EPOCH(type);
+ if (SHOULD_TAG(type)) {
+ SET_USED_THIS_EPOCH(type);
+ JfrTraceIdEpoch::set_changed_tag_state();
+ }
assert(USED_THIS_EPOCH(type), "invariant");
return TRACE_ID(type);
}
@@ -58,19 +61,10 @@
}
inline traceid JfrTraceId::use(const Klass* klass) {
- assert(klass != NULL, "invariant");
- if (SHOULD_TAG(klass)) {
- SET_USED_THIS_EPOCH(klass);
- assert(USED_THIS_EPOCH(klass), "invariant");
- JfrTraceIdEpoch::set_changed_tag_state();
- return get(klass);
- }
- assert(USED_THIS_EPOCH(klass), "invariant");
- return TRACE_ID(klass);
+ return set_used_and_get(klass);
}
inline traceid JfrTraceId::use(const Method* method) {
- assert(method != NULL, "invariant");
return use(method->method_holder(), method);
}
@@ -91,12 +85,10 @@
}
inline traceid JfrTraceId::use(const ModuleEntry* module) {
- assert(module != NULL, "invariant");
return set_used_and_get(module);
}
inline traceid JfrTraceId::use(const PackageEntry* package) {
- assert(package != NULL, "invariant");
return set_used_and_get(package);
}
--- a/src/hotspot/share/jfr/recorder/checkpoint/types/traceid/jfrTraceIdBits.inline.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/jfr/recorder/checkpoint/types/traceid/jfrTraceIdBits.inline.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -40,10 +40,8 @@
inline void set_bits(jbyte bits, jbyte volatile* const dest) {
assert(dest != NULL, "invariant");
- if (bits != (*dest & bits)) {
- *dest |= bits;
- OrderAccess::storestore();
- }
+ *dest |= bits;
+ OrderAccess::storestore();
}
inline jbyte traceid_and(jbyte current, jbyte bits) {
--- a/src/hotspot/share/jfr/recorder/repository/jfrEmergencyDump.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/jfr/recorder/repository/jfrEmergencyDump.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -332,11 +332,7 @@
/*
* We are just about to exit the VM, so we will be very aggressive
-* at this point in order to increase overall success of dumping jfr data:
-*
-* 1. if the thread state is not "_thread_in_vm", we will quick transition
-* it to "_thread_in_vm".
-* 2. if the thread is the owner of some critical lock(s), unlock them.
+* at this point in order to increase overall success of dumping jfr data.
*
* If we end up deadlocking in the attempt of dumping out jfr data,
* we rely on the WatcherThread task "is_error_reported()",
@@ -344,19 +340,16 @@
* This "safety net" somewhat explains the aggressiveness in this attempt.
*
*/
-static bool prepare_for_emergency_dump() {
- if (JfrStream_lock->owned_by_self()) {
- // crashed during jfr rotation, disallow recursion
- return false;
- }
- Thread* const thread = Thread::current();
+static bool prepare_for_emergency_dump(Thread* thread) {
+ assert(thread != NULL, "invariant");
+
if (thread->is_Watcher_thread()) {
// need WatcherThread as a safeguard against potential deadlocks
return false;
}
-
- if (thread->is_Java_thread()) {
- ((JavaThread*)thread)->set_thread_state(_thread_in_vm);
+ if (JfrStream_lock->owned_by_self()) {
+ // crashed during jfr rotation, disallow recursion
+ return false;
}
#ifdef ASSERT
@@ -428,10 +421,43 @@
return Atomic::cmpxchg(1, &jfr_shutdown_lock, 0) == 0;
}
+class JavaThreadInVM : public StackObj {
+ private:
+ JavaThread* const _jt;
+ JavaThreadState _original_state;
+ public:
+
+ JavaThreadInVM(Thread* t) : _jt(t->is_Java_thread() ? (JavaThread*)t : NULL),
+ _original_state(_thread_max_state) {
+ if ((_jt != NULL) && (_jt->thread_state() != _thread_in_vm)) {
+ _original_state = _jt->thread_state();
+ _jt->set_thread_state(_thread_in_vm);
+ }
+ }
+
+ ~JavaThreadInVM() {
+ if (_original_state != _thread_max_state) {
+ _jt->set_thread_state(_original_state);
+ }
+ }
+
+};
+
void JfrEmergencyDump::on_vm_shutdown(bool exception_handler) {
- if (!(guard_reentrancy() && prepare_for_emergency_dump())) {
+ if (!guard_reentrancy()) {
return;
}
+
+ Thread* thread = Thread::current_or_null_safe();
+ if (thread == NULL) {
+ return;
+ }
+ // Ensure a JavaThread is _thread_in_vm when we make this call
+ JavaThreadInVM jtivm(thread);
+ if (!prepare_for_emergency_dump(thread)) {
+ return;
+ }
+
EventDumpReason event;
if (event.should_commit()) {
event.set_reason(exception_handler ? "Crash" : "Out of Memory");
--- a/src/hotspot/share/jfr/recorder/storage/jfrStorage.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/jfr/recorder/storage/jfrStorage.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -432,18 +432,17 @@
assert(oldest_age_node->identity() == NULL, "invariant");
BufferPtr const buffer = oldest_age_node->retired_buffer();
assert(buffer->retired(), "invariant");
- discarded_size += buffer->unflushed_size();
+ discarded_size += buffer->discard();
+ assert(buffer->unflushed_size() == 0, "invariant");
num_full_post_discard = control().decrement_full();
+ mspace_release_full(oldest_age_node, _age_mspace);
if (buffer->transient()) {
mspace_release_full(buffer, _transient_mspace);
- mspace_release_full(oldest_age_node, _age_mspace);
continue;
- } else {
- mspace_release_full(oldest_age_node, _age_mspace);
- buffer->reinitialize();
- buffer->release(); // publish
- break;
}
+ buffer->reinitialize();
+ buffer->release(); // publish
+ break;
}
JfrBuffer_lock->unlock();
const size_t number_of_discards = num_full_pre_discard - num_full_post_discard;
--- a/src/hotspot/share/libadt/set.cpp Fri Nov 08 16:48:20 2019 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,143 +0,0 @@
-/*
- * Copyright (c) 1997, 2019, Oracle and/or its affiliates. All rights reserved.
- * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
- *
- * This code is free software; you can redistribute it and/or modify it
- * under the terms of the GNU General Public License version 2 only, as
- * published by the Free Software Foundation.
- *
- * This code is distributed in the hope that it will be useful, but WITHOUT
- * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
- * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
- * version 2 for more details (a copy is included in the LICENSE file that
- * accompanied this code).
- *
- * You should have received a copy of the GNU General Public License version
- * 2 along with this work; if not, write to the Free Software Foundation,
- * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
- *
- * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
- * or visit www.oracle.com if you need additional information or have any
- * questions.
- *
- */
-
-#include "precompiled.hpp"
-#include "libadt/set.hpp"
-#include "memory/allocation.inline.hpp"
-
-// Sets - An Abstract Data Type
-
-#include <stdio.h>
-#include <assert.h>
-#include <string.h>
-#include <stdlib.h>
-
-//-------------------------Virtual Functions-----------------------------------
-// These functions MUST be implemented by the inheriting class.
-class VectorSet;
-const VectorSet *Set::asVectorSet() const { assert(0); return NULL; }
-
-//------------------------------setstr-----------------------------------------
-// Create a string with a printable representation of a set.
-// The caller must deallocate the string.
-char *Set::setstr() const
-{
- Set &set = clone(); // Virtually copy the basic set.
- set.Sort(); // Sort elements for in-order retrieval
-
- uint len = 128; // Total string space
- char *buf = NEW_C_HEAP_ARRAY(char,len, mtCompiler);// Some initial string space
-
- char *s = buf; // Current working string pointer
- *s++ = '{';
- *s = '\0';
-
- // For all elements of the Set
- uint hi = (uint)-2, lo = (uint)-2;
- for( SetI i(&set); i.test(); ++i ) {
- if( hi+1 == i.elem ) { // Moving sequentially thru range?
- hi = i.elem; // Yes, just update hi end of range
- } else { // Else range ended
- if( buf+len-s < 25 ) { // Generous trailing space for upcoming numbers
- int offset = (int)(s-buf);// Not enuf space; compute offset into buffer
- len <<= 1; // Double string size
- buf = REALLOC_C_HEAP_ARRAY(char,buf,len, mtCompiler); // Reallocate doubled size
- s = buf+offset; // Get working pointer into new bigger buffer
- }
- if( lo != (uint)-2 ) { // Startup? No! Then print previous range.
- if( lo != hi ) sprintf(s,"%d-%d,",lo,hi);
- else sprintf(s,"%d,",lo);
- s += strlen(s); // Advance working string
- }
- hi = lo = i.elem;
- }
- }
- if( lo != (uint)-2 ) {
- if( buf+len-s < 25 ) { // Generous trailing space for upcoming numbers
- int offset = (int)(s-buf);// Not enuf space; compute offset into buffer
- len <<= 1; // Double string size
- buf = (char*)ReallocateHeap(buf,len, mtCompiler); // Reallocate doubled size
- s = buf+offset; // Get working pointer into new bigger buffer
- }
- if( lo != hi ) sprintf(s,"%d-%d}",lo,hi);
- else sprintf(s,"%d}",lo);
- } else strcat(s,"}");
- // Don't delete the clone 'set' since it is allocated on Arena.
- return buf;
-}
-
-//------------------------------print------------------------------------------
-// Handier print routine
-void Set::print() const
-{
- char *printable_set = setstr();
- tty->print_cr("%s", printable_set);
- FreeHeap(printable_set);
-}
-
-//------------------------------parse------------------------------------------
-// Convert a textual representation of a Set, to a Set and union into "this"
-// Set. Return the amount of text parsed in "len", or zero in "len".
-int Set::parse(const char *s)
-{
- char c; // Parse character
- const char *t = s; // Save the starting position of s.
- do c = *s++; // Skip characters
- while( c && (c <= ' ') ); // Till no more whitespace or EOS
- if( c != '{' ) return 0; // Oops, not a Set openner
- if( *s == '}' ) return 2; // The empty Set
-
- // Sets are filled with values of the form "xx," or "xx-yy," with the comma
- // a "}" at the very end.
- while( 1 ) { // While have elements in the Set
- char *u; // Pointer to character ending parse
- uint hi, i; // Needed for range handling below
- uint elem = (uint)strtoul(s,&u,10);// Get element
- if( u == s ) return 0; // Bogus crude
- s = u; // Skip over the number
- c = *s++; // Get the number seperator
- switch ( c ) { // Different seperators
- case '}': // Last simple element
- case ',': // Simple element
- (*this) <<= elem; // Insert the simple element into the Set
- break; // Go get next element
- case '-': // Range
- hi = (uint)strtoul(s,&u,10); // Get element
- if( u == s ) return 0; // Bogus crude
- for( i=elem; i<=hi; i++ )
- (*this) <<= i; // Insert the entire range into the Set
- s = u; // Skip over the number
- c = *s++; // Get the number seperator
- break;
- }
- if( c == '}' ) break; // End of the Set
- if( c != ',' ) return 0; // Bogus garbage
- }
- return (int)(s-t); // Return length parsed
-}
-
-//------------------------------Iterator---------------------------------------
-SetI_::~SetI_()
-{
-}
--- a/src/hotspot/share/libadt/set.hpp Fri Nov 08 16:48:20 2019 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,231 +0,0 @@
-/*
- * Copyright (c) 1997, 2019, Oracle and/or its affiliates. All rights reserved.
- * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
- *
- * This code is free software; you can redistribute it and/or modify it
- * under the terms of the GNU General Public License version 2 only, as
- * published by the Free Software Foundation.
- *
- * This code is distributed in the hope that it will be useful, but WITHOUT
- * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
- * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
- * version 2 for more details (a copy is included in the LICENSE file that
- * accompanied this code).
- *
- * You should have received a copy of the GNU General Public License version
- * 2 along with this work; if not, write to the Free Software Foundation,
- * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
- *
- * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
- * or visit www.oracle.com if you need additional information or have any
- * questions.
- *
- */
-
-#ifndef SHARE_LIBADT_SET_HPP
-#define SHARE_LIBADT_SET_HPP
-
-#include "memory/allocation.hpp"
-
-// Sets - An Abstract Data Type
-
-class SparseSet;
-class VectorSet;
-class ListSet;
-class CoSet;
-
-class ostream;
-class SetI_;
-
-// These sets can grow or shrink, based on the initial size and the largest
-// element currently in them. Basically, they allow a bunch of bits to be
-// grouped together, tested, set & cleared, intersected, etc. The basic
-// Set class is an abstract class, and cannot be constructed. Instead,
-// one of VectorSet, SparseSet, or ListSet is created. Each variation has
-// different asymptotic running times for different operations, and different
-// constants of proportionality as well.
-// {n = number of elements, N = largest element}
-
-// VectorSet SparseSet ListSet
-// Create O(N) O(1) O(1)
-// Clear O(N) O(1) O(1)
-// Insert O(1) O(1) O(log n)
-// Delete O(1) O(1) O(log n)
-// Member O(1) O(1) O(log n)
-// Size O(N) O(1) O(1)
-// Copy O(N) O(n) O(n)
-// Union O(N) O(n) O(n log n)
-// Intersect O(N) O(n) O(n log n)
-// Difference O(N) O(n) O(n log n)
-// Equal O(N) O(n) O(n log n)
-// ChooseMember O(N) O(1) O(1)
-// Sort O(1) O(n log n) O(1)
-// Forall O(N) O(n) O(n)
-// Complement O(1) O(1) O(1)
-
-// TIME: N/32 n 8*n Accesses
-// SPACE: N/8 4*N+4*n 8*n Bytes
-
-// Create: Make an empty set
-// Clear: Remove all the elements of a Set
-// Insert: Insert an element into a Set; duplicates are ignored
-// Delete: Removes an element from a Set
-// Member: Tests for membership in a Set
-// Size: Returns the number of members of a Set
-// Copy: Copy or assign one Set to another
-// Union: Union 2 sets together
-// Intersect: Intersect 2 sets together
-// Difference: Compute A & !B; remove from set A those elements in set B
-// Equal: Test for equality between 2 sets
-// ChooseMember Pick a random member
-// Sort: If no other operation changes the set membership, a following
-// Forall will iterate the members in ascending order.
-// Forall: Iterate over the elements of a Set. Operations that modify
-// the set membership during iteration work, but the iterator may
-// skip any member or duplicate any member.
-// Complement: Only supported in the Co-Set variations. It adds a small
-// constant-time test to every Set operation.
-//
-// PERFORMANCE ISSUES:
-// If you "cast away" the specific set variation you are using, and then do
-// operations on the basic "Set" object you will pay a virtual function call
-// to get back the specific set variation. On the other hand, using the
-// generic Set means you can change underlying implementations by just
-// changing the initial declaration. Examples:
-// void foo(VectorSet vs1, VectorSet vs2) { vs1 |= vs2; }
-// "foo" must be called with a VectorSet. The vector set union operation
-// is called directly.
-// void foo(Set vs1, Set vs2) { vs1 |= vs2; }
-// "foo" may be called with *any* kind of sets; suppose it is called with
-// VectorSets. Two virtual function calls are used to figure out the that vs1
-// and vs2 are VectorSets. In addition, if vs2 is not a VectorSet then a
-// temporary VectorSet copy of vs2 will be made before the union proceeds.
-//
-// VectorSets have a small constant. Time and space are proportional to the
-// largest element. Fine for dense sets and largest element < 10,000.
-// SparseSets have a medium constant. Time is proportional to the number of
-// elements, space is proportional to the largest element.
-// Fine (but big) with the largest element < 100,000.
-// ListSets have a big constant. Time *and space* are proportional to the
-// number of elements. They work well for a few elements of *any* size
-// (i.e. sets of pointers)!
-
-//------------------------------Set--------------------------------------------
-class Set : public ResourceObj {
- protected:
-
- // Creates a new, empty set.
- Set(Arena *arena) : _set_arena(arena) {};
-
- // Creates a new set from an existing set
- Set(const Set & s) : ResourceObj(s) {};
-
- public:
- // Set assignment; deep-copy guts
- virtual Set &operator =(const Set &s)=0;
- virtual Set &clone(void) const=0;
-
- // Virtual destructor
- virtual ~Set() {};
-
- // Add member to set
- virtual Set &operator <<=(uint elem)=0;
- // virtual Set operator << (uint elem);
-
- // Delete member from set
- virtual Set &operator >>=(uint elem)=0;
- // virtual Set operator >> (uint elem);
-
- // Membership test. Result is Zero (absent)/ Non-Zero (present)
- virtual int operator [](uint elem) const=0;
-
- // Intersect sets
- virtual Set &operator &=(const Set &s)=0;
- // virtual Set operator & (const Set &s) const;
-
- // Union sets
- virtual Set &operator |=(const Set &s)=0;
- // virtual Set operator | (const Set &s) const;
-
- // Difference sets
- virtual Set &operator -=(const Set &s)=0;
- // virtual Set operator - (const Set &s) const;
-
- // Tests for equality. Result is Zero (false)/ Non-Zero (true)
- virtual int operator ==(const Set &s) const=0;
- int operator !=(const Set &s) const { return !(*this == s); }
- virtual int disjoint(const Set &s) const=0;
-
- // Tests for strict subset. Result is Zero (false)/ Non-Zero (true)
- virtual int operator < (const Set &s) const=0;
- int operator > (const Set &s) const { return s < *this; }
-
- // Tests for subset. Result is Zero (false)/ Non-Zero (true)
- virtual int operator <=(const Set &s) const=0;
- int operator >=(const Set &s) const { return s <= *this; }
-
- // Clear all the elements in the Set
- virtual void Clear(void)=0;
-
- // Return the number of members in the Set
- virtual uint Size(void) const=0;
-
- // If an iterator follows a "Sort()" without any Set-modifying operations
- // inbetween then the iterator will visit the elements in ascending order.
- virtual void Sort(void)=0;
-
- // Convert a set to printable string in an allocated buffer.
- // The caller must deallocate the string.
- virtual char *setstr(void) const;
-
- // Print the Set on "stdout". Can be conveniently called in the debugger
- void print() const;
-
- // Parse text from the string into the Set. Return length parsed.
- virtual int parse(const char *s);
-
- // Convert a generic Set to a specific Set
- virtual const VectorSet *asVectorSet(void) const;
-
- // Hash the set. Sets of different types but identical elements will NOT
- // hash the same. Same set type, same elements WILL hash the same.
- virtual int hash() const = 0;
-
-protected:
- friend class SetI;
- virtual class SetI_ *iterate(uint&) const=0;
-
- // Need storeage for the set
- Arena *_set_arena;
-};
-
-//------------------------------Iteration--------------------------------------
-// Loop thru all elements of the set, setting "elem" to the element numbers
-// in random order. Inserted or deleted elements during this operation may
-// or may not be iterated over; untouched elements will be affected once.
-
-// Usage: for( SetI i(s); i.test(); i++ ) { body = i.elem; } ...OR...
-// for( i.reset(s); i.test(); i++ ) { body = i.elem; }
-
-class SetI_ : public ResourceObj {
-protected:
- friend class SetI;
- virtual ~SetI_();
- virtual uint next(void)=0;
- virtual int test(void)=0;
-};
-
-class SetI {
-protected:
- SetI_ *impl;
-public:
- uint elem; // The publically accessible element
-
- SetI( const Set *s ) { impl = s->iterate(elem); }
- ~SetI() { delete impl; }
- void reset( const Set *s ) { delete impl; impl = s->iterate(elem); }
- void operator ++(void) { elem = impl->next(); }
- int test(void) { return impl->test(); }
-};
-
-#endif // SHARE_LIBADT_SET_HPP
--- a/src/hotspot/share/libadt/vectset.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/libadt/vectset.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -27,339 +27,61 @@
#include "memory/allocation.inline.hpp"
#include "memory/arena.hpp"
-// Vector Sets - An Abstract Data Type
-
-// BitsInByte is a lookup table which tells the number of bits that
-// are in the looked-up number. It is very useful in VectorSet_Size.
-
-uint8_t bitsInByte[BITS_IN_BYTE_ARRAY_SIZE] = {
- 0, 1, 1, 2, 1, 2, 2, 3, 1, 2, 2, 3, 2, 3, 3, 4,
- 1, 2, 2, 3, 2, 3, 3, 4, 2, 3, 3, 4, 3, 4, 4, 5,
- 1, 2, 2, 3, 2, 3, 3, 4, 2, 3, 3, 4, 3, 4, 4, 5,
- 2, 3, 3, 4, 3, 4, 4, 5, 3, 4, 4, 5, 4, 5, 5, 6,
- 1, 2, 2, 3, 2, 3, 3, 4, 2, 3, 3, 4, 3, 4, 4, 5,
- 2, 3, 3, 4, 3, 4, 4, 5, 3, 4, 4, 5, 4, 5, 5, 6,
- 2, 3, 3, 4, 3, 4, 4, 5, 3, 4, 4, 5, 4, 5, 5, 6,
- 3, 4, 4, 5, 4, 5, 5, 6, 4, 5, 5, 6, 5, 6, 6, 7,
- 1, 2, 2, 3, 2, 3, 3, 4, 2, 3, 3, 4, 3, 4, 4, 5,
- 2, 3, 3, 4, 3, 4, 4, 5, 3, 4, 4, 5, 4, 5, 5, 6,
- 2, 3, 3, 4, 3, 4, 4, 5, 3, 4, 4, 5, 4, 5, 5, 6,
- 3, 4, 4, 5, 4, 5, 5, 6, 4, 5, 5, 6, 5, 6, 6, 7,
- 2, 3, 3, 4, 3, 4, 4, 5, 3, 4, 4, 5, 4, 5, 5, 6,
- 3, 4, 4, 5, 4, 5, 5, 6, 4, 5, 5, 6, 5, 6, 6, 7,
- 3, 4, 4, 5, 4, 5, 5, 6, 4, 5, 5, 6, 5, 6, 6, 7,
- 4, 5, 5, 6, 5, 6, 6, 7, 5, 6, 6, 7, 6, 7, 7, 8
-};
-
-//------------------------------VectorSet--------------------------------------
-// Create a new, empty Set.
-VectorSet::VectorSet(Arena *arena) : Set(arena) {
+VectorSet::VectorSet(Arena *arena) {
+ _set_arena = arena;
size = 2; // Small initial size
data = (uint32_t *)_set_arena->Amalloc(size*sizeof(uint32_t));
data[0] = 0; // No elements
data[1] = 0;
}
-//------------------------------operator=--------------------------------------
-Set &VectorSet::operator = (const Set &set)
-{
- if( &set == this ) return *this;
- FREE_FAST(data);
- // The cast is a virtual function that checks that "set" is a VectorSet.
- slamin(*(set.asVectorSet()));
- return *this;
-}
-
-//------------------------------slamin-----------------------------------------
-// Initialize one set with another. No regard is made to the existing Set.
-void VectorSet::slamin(const VectorSet& s)
-{
- size = s.size; // Use new size
- data = (uint32_t*)s._set_arena->Amalloc(size*sizeof(uint32_t)); // Make array of required size
- memcpy( data, s.data, size*sizeof(uint32_t) ); // Fill the array
-}
-
-//------------------------------grow-------------------------------------------
// Expand the existing set to a bigger size
-void VectorSet::grow( uint newsize )
-{
- newsize = (newsize+31) >> 5; // Convert to longwords
+void VectorSet::grow(uint newsize) {
+ newsize = (newsize+31) >> 5;
uint x = size;
- while( x < newsize ) x <<= 1;
+ while (x < newsize) {
+ x <<= 1;
+ }
data = (uint32_t *)_set_arena->Arealloc(data, size*sizeof(uint32_t), x*sizeof(uint32_t));
- memset((char *)(data + size), 0, (x - size)*sizeof(uint32_t));
+ memset((char*)(data + size), 0, (x - size) * sizeof(uint32_t));
size = x;
}
-//------------------------------operator<<=------------------------------------
// Insert a member into an existing Set.
-Set &VectorSet::operator <<= (uint elem)
-{
- uint word = elem >> 5; // Get the longword offset
- uint32_t mask = 1L << (elem & 31); // Get bit mask
-
- if( word >= size ) // Need to grow set?
- grow(elem+1); // Then grow it
- data[word] |= mask; // Set new bit
- return *this;
-}
-
-//------------------------------operator>>=------------------------------------
-// Delete a member from an existing Set.
-Set &VectorSet::operator >>= (uint elem)
-{
- uint word = elem >> 5; // Get the longword offset
- if( word >= size ) // Beyond the last?
- return *this; // Then it's clear & return clear
- uint32_t mask = 1L << (elem & 31); // Get bit mask
- data[word] &= ~mask; // Clear bit
- return *this;
-}
-
-//------------------------------operator&=-------------------------------------
-// Intersect one set into another.
-VectorSet &VectorSet::operator &= (const VectorSet &s)
-{
- // NOTE: The intersection is never any larger than the smallest set.
- if( s.size < size ) size = s.size; // Get smaller size
- uint32_t *u1 = data; // Pointer to the destination data
- uint32_t *u2 = s.data; // Pointer to the source data
- for( uint i=0; i<size; i++) // For data in set
- *u1++ &= *u2++; // Copy and AND longwords
- return *this; // Return set
-}
-
-//------------------------------operator&=-------------------------------------
-Set &VectorSet::operator &= (const Set &set)
-{
- // The cast is a virtual function that checks that "set" is a VectorSet.
- return (*this) &= *(set.asVectorSet());
-}
-
-//------------------------------operator|=-------------------------------------
-// Union one set into another.
-VectorSet &VectorSet::operator |= (const VectorSet &s)
-{
- // This many words must be unioned
- uint cnt = ((size<s.size)?size:s.size);
- uint32_t *u1 = data; // Pointer to the destination data
- uint32_t *u2 = s.data; // Pointer to the source data
- for( uint i=0; i<cnt; i++) // Copy and OR the two sets
- *u1++ |= *u2++;
- if( size < s.size ) { // Is set 2 larger than set 1?
- // Extend result by larger set
- grow(s.size*sizeof(uint32_t)*8);
- memcpy(&data[cnt], u2, (s.size - cnt)*sizeof(uint32_t));
+void VectorSet::insert(uint elem) {
+ uint word = elem >> 5;
+ uint32_t mask = 1L << (elem & 31);
+ if (word >= size) {
+ grow(elem + 1);
}
- return *this; // Return result set
-}
-
-//------------------------------operator|=-------------------------------------
-Set &VectorSet::operator |= (const Set &set)
-{
- // The cast is a virtual function that checks that "set" is a VectorSet.
- return (*this) |= *(set.asVectorSet());
-}
-
-//------------------------------operator-=-------------------------------------
-// Difference one set from another.
-VectorSet &VectorSet::operator -= (const VectorSet &s)
-{
- // This many words must be unioned
- uint cnt = ((size<s.size)?size:s.size);
- uint32_t *u1 = data; // Pointer to the destination data
- uint32_t *u2 = s.data; // Pointer to the source data
- for( uint i=0; i<cnt; i++ ) // For data in set
- *u1++ &= ~(*u2++); // A <-- A & ~B with longwords
- return *this; // Return new set
-}
-
-//------------------------------operator-=-------------------------------------
-Set &VectorSet::operator -= (const Set &set)
-{
- // The cast is a virtual function that checks that "set" is a VectorSet.
- return (*this) -= *(set.asVectorSet());
+ data[word] |= mask;
}
-//------------------------------compare----------------------------------------
-// Compute 2 booleans: bits in A not B, bits in B not A.
-// Return X0 -- A is not a subset of B
-// X1 -- A is a subset of B
-// 0X -- B is not a subset of A
-// 1X -- B is a subset of A
-int VectorSet::compare (const VectorSet &s) const
-{
- uint32_t *u1 = data; // Pointer to the destination data
- uint32_t *u2 = s.data; // Pointer to the source data
- uint32_t AnotB = 0, BnotA = 0;
- // This many words must be unioned
- uint cnt = ((size<s.size)?size:s.size);
-
- // Get bits for both sets
- uint i; // Exit value of loop
- for( i=0; i<cnt; i++ ) { // For data in BOTH sets
- uint32_t A = *u1++; // Data from one guy
- uint32_t B = *u2++; // Data from other guy
- AnotB |= (A & ~B); // Compute bits in A not B
- BnotA |= (B & ~A); // Compute bits in B not A
- }
-
- // Get bits from bigger set
- if( size < s.size ) {
- for( ; i<s.size; i++ ) // For data in larger set
- BnotA |= *u2++; // These bits are in B not A
- } else {
- for( ; i<size; i++ ) // For data in larger set
- AnotB |= *u1++; // These bits are in A not B
- }
-
- // Set & return boolean flags
- return ((!BnotA)<<1) + (!AnotB);
-}
-
-//------------------------------operator==-------------------------------------
-// Test for set equality
-int VectorSet::operator == (const VectorSet &s) const
-{
- return compare(s) == 3; // TRUE if A and B are mutual subsets
-}
-
-//------------------------------operator==-------------------------------------
-int VectorSet::operator == (const Set &set) const
-{
- // The cast is a virtual function that checks that "set" is a VectorSet.
- return (*this) == *(set.asVectorSet());
-}
-
-//------------------------------disjoint---------------------------------------
-// Check for sets being disjoint.
-int VectorSet::disjoint(const Set &set) const
-{
- // The cast is a virtual function that checks that "set" is a VectorSet.
- const VectorSet &s = *(set.asVectorSet());
-
- // NOTE: The intersection is never any larger than the smallest set.
- uint small_size = ((size<s.size)?size:s.size);
- uint32_t *u1 = data; // Pointer to the destination data
- uint32_t *u2 = s.data; // Pointer to the source data
- for( uint i=0; i<small_size; i++) // For data in set
- if( *u1++ & *u2++ ) // If any elements in common
- return 0; // Then not disjoint
- return 1; // Else disjoint
-}
-
-//------------------------------operator<--------------------------------------
-// Test for strict subset
-int VectorSet::operator < (const VectorSet &s) const
-{
- return compare(s) == 1; // A subset B, B not subset A
-}
-
-//------------------------------operator<--------------------------------------
-int VectorSet::operator < (const Set &set) const
-{
- // The cast is a virtual function that checks that "set" is a VectorSet.
- return (*this) < *(set.asVectorSet());
-}
-
-//------------------------------operator<=-------------------------------------
-// Test for subset
-int VectorSet::operator <= (const VectorSet &s) const
-{
- return compare(s) & 1; // A subset B
-}
-
-//------------------------------operator<=-------------------------------------
-int VectorSet::operator <= (const Set &set) const
-{
- // The cast is a virtual function that checks that "set" is a VectorSet.
- return (*this) <= *(set.asVectorSet());
-}
-
-//------------------------------operator[]-------------------------------------
-// Test for membership. A Zero/Non-Zero value is returned!
-int VectorSet::operator[](uint elem) const
-{
- uint word = elem >> 5; // Get the longword offset
- if( word >= size ) // Beyond the last?
- return 0; // Then it's clear
- uint32_t mask = 1L << (elem & 31); // Get bit mask
- return ((data[word] & mask))!=0; // Return the sense of the bit
-}
-
-//------------------------------Clear------------------------------------------
// Clear a set
-void VectorSet::Clear(void)
-{
+void VectorSet::clear() {
if( size > 100 ) { // Reclaim storage only if huge
FREE_RESOURCE_ARRAY(uint32_t,data,size);
size = 2; // Small initial size
data = NEW_RESOURCE_ARRAY(uint32_t,size);
}
- memset( data, 0, size*sizeof(uint32_t) );
-}
-
-//------------------------------Size-------------------------------------------
-// Return number of elements in a Set
-uint VectorSet::Size(void) const
-{
- uint sum = 0; // Cumulative size so far.
- uint8_t* currByte = (uint8_t*) data;
- for( uint32_t i = 0; i < (size<<2); i++) // While have bytes to process
- sum += bitsInByte[*currByte++]; // Add bits in current byte to size.
- return sum;
-}
-
-//------------------------------Sort-------------------------------------------
-// Sort the elements for the next forall statement
-void VectorSet::Sort(void)
-{
-}
-
-//------------------------------hash-------------------------------------------
-int VectorSet::hash() const
-{
- uint32_t _xor = 0;
- uint lim = ((size<4)?size:4);
- for( uint i = 0; i < lim; i++ )
- _xor ^= data[i];
- return (int)_xor;
+ memset(data, 0, size*sizeof(uint32_t));
}
-//------------------------------iterate----------------------------------------
-// Used by Set::print().
-class VSetI_ : public SetI_ {
- VectorSetI vsi;
-public:
- VSetI_( const VectorSet *vset, uint &elem ) : vsi(vset) { elem = vsi.elem; }
-
- uint next(void) { ++vsi; return vsi.elem; }
- int test(void) { return vsi.test(); }
-};
-
-SetI_ *VectorSet::iterate(uint &elem) const {
- return new(ResourceObj::C_HEAP, mtInternal) VSetI_(this, elem);
+// Return true if the set is empty
+bool VectorSet::is_empty() const {
+ for (uint32_t i = 0; i < size; i++) {
+ if (data[i] != 0) {
+ return false;
+ }
+ }
+ return true;
}
-//=============================================================================
-//------------------------------next-------------------------------------------
-// Find and return the next element of a vector set, or return garbage and
-// make "VectorSetI::test()" fail.
-uint VectorSetI::next(void)
-{
- j++; // Next element in word
- mask = (mask & max_jint) << 1;// Next bit in word
- do { // Do While still have words
- while( mask ) { // While have bits in word
- if( s->data[i] & mask ) { // If found a bit
- return (i<<5)+j; // Return the bit address
- }
- j++; // Skip to next bit
- mask = (mask & max_jint) << 1;
- }
- j = 0; // No more bits in word; setup for next word
- mask = 1;
- for( i++; (i<s->size) && (!s->data[i]); i++ ); // Skip to non-zero word
- } while( i<s->size );
- return max_juint; // No element, iterated them all
+int VectorSet::hash() const {
+ uint32_t _xor = 0;
+ uint lim = ((size < 4) ? size : 4);
+ for (uint i = 0; i < lim; i++) {
+ _xor ^= data[i];
+ }
+ return (int)_xor;
}
--- a/src/hotspot/share/libadt/vectset.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/libadt/vectset.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -25,161 +25,85 @@
#ifndef SHARE_LIBADT_VECTSET_HPP
#define SHARE_LIBADT_VECTSET_HPP
-#include "libadt/set.hpp"
+#include "memory/allocation.hpp"
-#define BITS_IN_BYTE_ARRAY_SIZE 256
-
-// Vector Sets - An Abstract Data Type
-//INTERFACE
+// Vector Sets
// These sets can grow or shrink, based on the initial size and the largest
-// element currently in them. Slow and bulky for sparse sets, these sets
-// are super for dense sets. They are fast and compact when dense.
-
-// TIME:
-// O(1) - Insert, Delete, Member, Sort
-// O(max_element) - Create, Clear, Size, Copy, Union, Intersect, Difference,
-// Equal, ChooseMember, Forall
-
-// SPACE: (max_element)/(8*sizeof(int))
-
+// element currently in them.
//------------------------------VectorSet--------------------------------------
-class VectorSet : public Set {
-friend class VectorSetI; // Friendly iterator class
-protected:
+class VectorSet : public ResourceObj {
+private:
uint size; // Size of data IN LONGWORDS (32bits)
uint32_t* data; // The data, bit packed
+ Arena *_set_arena;
- void slamin( const VectorSet& s ); // Initialize one set with another
- int compare(const VectorSet &s) const; // Compare set contents
- void grow(uint newsize); // Grow vector to required bitsize
+ void grow(uint newsize); // Grow vector to required bitsize
public:
- VectorSet(Arena *arena); // Creates a new, empty set.
- VectorSet(const VectorSet &s) : Set(s._set_arena) {slamin(s);} // Set clone; deep-copy guts
- Set &operator =(const Set &s); // Set clone; deep-copy guts
- VectorSet &operator =(const VectorSet &s) // Set clone; deep-copy guts
- { if( &s != this ) { slamin(s); } return *this; }
+ VectorSet(Arena *arena);
~VectorSet() {}
- Set &clone(void) const { return *(new VectorSet(*this)); }
-
- Set &operator <<=(uint elem); // Add member to set
- VectorSet operator << (uint elem) // Add member to new set
- { VectorSet foo(*this); foo <<= elem; return foo; }
- Set &operator >>=(uint elem); // Delete member from set
- VectorSet operator >> (uint elem) // Delete member from new set
- { VectorSet foo(*this); foo >>= elem; return foo; }
-
- VectorSet &operator &=(const VectorSet &s); // Intersect sets into first set
- Set &operator &=(const Set &s); // Intersect sets into first set
- VectorSet operator & (const VectorSet &s) const
- { VectorSet foo(*this); foo &= s; return foo; }
-
- VectorSet &operator |=(const VectorSet &s); // Intersect sets into first set
- Set &operator |=(const Set &s); // Intersect sets into first set
- VectorSet operator | (const VectorSet &s) const
- { VectorSet foo(*this); foo |= s; return foo; }
+ void insert(uint elem);
- VectorSet &operator -=(const VectorSet &s); // Intersect sets into first set
- Set &operator -=(const Set &s); // Intersect sets into first set
- VectorSet operator - (const VectorSet &s) const
- { VectorSet foo(*this); foo -= s; return foo; }
-
- int operator ==(const VectorSet &s) const; // True if sets are equal
- int operator ==(const Set &s) const; // True if sets are equal
- int operator < (const VectorSet &s) const; // True if strict subset
- int operator < (const Set &s) const; // True if strict subset
- int operator <=(const VectorSet &s) const; // True if subset relation holds.
- int operator <=(const Set &s) const; // True if subset relation holds.
- int disjoint (const Set &s) const; // True if sets are disjoint
-
- int operator [](uint elem) const; // Test for membership
- void Clear(void); // Clear a set
- uint Size(void) const; // Number of elements in the Set.
- void Sort(void); // Sort before iterating
- int hash() const; // Hash function
- void Reset(void) { // Reset a set
- memset( data, 0, size*sizeof(uint32_t) );
+ void clear();
+ bool is_empty() const;
+ int hash() const;
+ void reset() {
+ memset(data, 0, size*sizeof(uint32_t));
}
- /* Removed for MCC BUG
- operator const VectorSet* (void) const { return this; } */
- const VectorSet *asVectorSet() const { return this; }
-
// Expose internals for speed-critical fast iterators
uint word_size() const { return size; }
// Fast inlined "test and set". Replaces the idiom:
- // if( visited[idx] ) return;
- // visited <<= idx;
+ // if (visited.test(idx)) return;
+ // visited.set(idx);
// With:
- // if( visited.test_set(idx) ) return;
+ // if (visited.test_set(idx)) return;
//
- int test_set( uint elem ) {
+ int test_set(uint elem) {
uint word = elem >> 5; // Get the longword offset
- if( word >= size ) // Beyond the last?
- return test_set_grow(elem); // Then grow; set; return 0;
+ if (word >= size) {
+ // Then grow; set; return 0;
+ this->insert(elem);
+ return 0;
+ }
uint32_t mask = 1L << (elem & 31); // Get bit mask
uint32_t datum = data[word] & mask;// Get bit
data[word] |= mask; // Set bit
return datum; // Return bit
}
- int test_set_grow( uint elem ) { // Insert & return 0;
- (*this) <<= elem; // Insert into set
- return 0; // Return 0!
- }
// Fast inlined test
- int test( uint elem ) const {
- uint word = elem >> 5; // Get the longword offset
- if( word >= size ) return 0; // Beyond the last?
- uint32_t mask = 1L << (elem & 31); // Get bit mask
- return data[word] & mask; // Get bit
+ int test(uint elem) const {
+ uint word = elem >> 5;
+ if (word >= size) {
+ return 0;
+ }
+ uint32_t mask = 1L << (elem & 31);
+ return data[word] & mask;
+ }
+
+ void remove(uint elem) {
+ uint word = elem >> 5;
+ if (word >= size) {
+ return;
+ }
+ uint32_t mask = 1L << (elem & 31);
+ data[word] &= ~mask; // Clear bit
}
// Fast inlined set
- void set( uint elem ) {
- uint word = elem >> 5; // Get the longword offset
- if( word >= size ) { // Beyond the last?
- test_set_grow(elem); // Then grow and set
+ void set(uint elem) {
+ uint word = elem >> 5;
+ if (word >= size) {
+ this->insert(elem);
} else {
- uint32_t mask = 1L << (elem & 31); // Get bit mask
- data[word] |= mask; // Set bit
+ uint32_t mask = 1L << (elem & 31);
+ data[word] |= mask;
}
}
-
-
-private:
- SetI_ *iterate(uint&) const;
-};
-
-//------------------------------Iteration--------------------------------------
-// Loop thru all elements of the set, setting "elem" to the element numbers
-// in random order. Inserted or deleted elements during this operation may
-// or may not be iterated over; untouched elements will be affected once.
-// Usage: for( VectorSetI i(s); i.test(); i++ ) { body = i.elem; }
-
-class VectorSetI : public StackObj {
- friend class VectorSet;
- const VectorSet *s;
- uint i, j;
- uint32_t mask;
- uint next(void);
-
-public:
- uint elem; // The publically accessible element
-
- VectorSetI( const VectorSet *vset ) :
- s(vset),
- i((uint)-1L),
- j((uint)-1L),
- mask((unsigned)(1L<<31)) {
- elem = next();
- }
-
- void operator ++(void) { elem = next(); }
- int test(void) { return i < s->size; }
};
#endif // SHARE_LIBADT_VECTSET_HPP
--- a/src/hotspot/share/memory/operator_new.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/memory/operator_new.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -89,6 +89,14 @@
fatal("Should not call global delete []");
}
+#ifdef __GNUG__
+// Warning disabled for gcc 5.4
+// Warning for unknown warning disabled for gcc 4.8.5
+PRAGMA_DIAG_PUSH
+PRAGMA_DISABLE_GCC_WARNING("-Wpragmas")
+PRAGMA_DISABLE_GCC_WARNING("-Wc++14-compat")
+#endif // __GNUG__
+
void operator delete(void* p, size_t size) throw() {
fatal("Should not call global sized delete");
}
@@ -97,4 +105,8 @@
fatal("Should not call global sized delete []");
}
+#ifdef __GNUG__
+PRAGMA_DIAG_POP
+#endif // __GNUG__
+
#endif // Non-product
--- a/src/hotspot/share/opto/arraycopynode.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/arraycopynode.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -38,7 +38,7 @@
None, // not set yet
ArrayCopy, // System.arraycopy()
CloneBasic, // A clone that can be copied by 64 bit chunks
- CloneOop, // An oop array clone
+ CloneOopArray, // An oop array clone
CopyOf, // Arrays.copyOf()
CopyOfRange // Arrays.copyOfRange()
} _kind;
@@ -147,7 +147,7 @@
bool is_arraycopy() const { assert(_kind != None, "should bet set"); return _kind == ArrayCopy; }
bool is_arraycopy_validated() const { assert(_kind != None, "should bet set"); return _kind == ArrayCopy && _arguments_validated; }
bool is_clonebasic() const { assert(_kind != None, "should bet set"); return _kind == CloneBasic; }
- bool is_cloneoop() const { assert(_kind != None, "should bet set"); return _kind == CloneOop; }
+ bool is_clone_oop_array() const { assert(_kind != None, "should bet set"); return _kind == CloneOopArray; }
bool is_copyof() const { assert(_kind != None, "should bet set"); return _kind == CopyOf; }
bool is_copyof_validated() const { assert(_kind != None, "should bet set"); return _kind == CopyOf && _arguments_validated; }
bool is_copyofrange() const { assert(_kind != None, "should bet set"); return _kind == CopyOfRange; }
@@ -155,7 +155,7 @@
void set_arraycopy(bool validated) { assert(_kind == None, "shouldn't bet set yet"); _kind = ArrayCopy; _arguments_validated = validated; }
void set_clonebasic() { assert(_kind == None, "shouldn't bet set yet"); _kind = CloneBasic; }
- void set_cloneoop() { assert(_kind == None, "shouldn't bet set yet"); _kind = CloneOop; }
+ void set_clone_oop_array() { assert(_kind == None, "shouldn't bet set yet"); _kind = CloneOopArray; }
void set_copyof(bool validated) { assert(_kind == None, "shouldn't bet set yet"); _kind = CopyOf; _arguments_validated = validated; }
void set_copyofrange(bool validated) { assert(_kind == None, "shouldn't bet set yet"); _kind = CopyOfRange; _arguments_validated = validated; }
--- a/src/hotspot/share/opto/chaitin.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/chaitin.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -1197,12 +1197,12 @@
// Check for just becoming of-low-degree just counting registers.
// _must_spill live ranges are already on the low degree list.
- if( n->just_lo_degree() && !n->_must_spill ) {
- assert(!(*_ifg->_yanked)[neighbor],"Cannot move to lo degree twice");
+ if (n->just_lo_degree() && !n->_must_spill) {
+ assert(!_ifg->_yanked->test(neighbor), "Cannot move to lo degree twice");
// Pull from hi-degree list
uint prev = n->_prev;
uint next = n->_next;
- if( prev ) lrgs(prev)._next = next;
+ if (prev) lrgs(prev)._next = next;
else _hi_degree = next;
lrgs(next)._prev = prev;
n->_next = _lo_degree;
@@ -1212,7 +1212,7 @@
} // End of while lo-degree/lo_stk_degree worklist not empty
// Check for got everything: is hi-degree list empty?
- if( !_hi_degree ) break;
+ if (!_hi_degree) break;
// Time to pick a potential spill guy
uint lo_score = _hi_degree;
@@ -1223,8 +1223,8 @@
// Find cheapest guy
debug_only( int lo_no_simplify=0; );
- for( uint i = _hi_degree; i; i = lrgs(i)._next ) {
- assert( !(*_ifg->_yanked)[i], "" );
+ for (uint i = _hi_degree; i; i = lrgs(i)._next) {
+ assert(!_ifg->_yanked->test(i), "");
// It's just vaguely possible to move hi-degree to lo-degree without
// going through a just-lo-degree stage: If you remove a double from
// a float live range it's degree will drop by 2 and you can skip the
@@ -1249,7 +1249,7 @@
// one block. In which case their area is 0 and score set to max.
// In such case choose bound live range over unbound to free registers
// or with smaller cost to spill.
- if( iscore < score ||
+ if ( iscore < score ||
(iscore == score && iarea > area && lrgs(lo_score)._was_spilled2) ||
(iscore == score && iarea == area &&
( (ibound && !bound) || (ibound == bound && (icost < cost)) )) ) {
@@ -1332,7 +1332,7 @@
uint copy_lrg = _lrg_map.find(lrg._copy_bias);
if( copy_lrg != 0 ) {
// If he has a color,
- if( !(*(_ifg->_yanked))[copy_lrg] ) {
+ if(!_ifg->_yanked->test(copy_lrg)) {
OptoReg::Name reg = lrgs(copy_lrg).reg();
// And it is legal for you,
if (is_legal_reg(lrg, reg, chunk))
--- a/src/hotspot/share/opto/compile.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/compile.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -338,7 +338,7 @@
for (uint node_idx = 0; node_idx < max_idx; node_idx++) {
// If node with index node_idx is not in useful set,
// mark it as dead in dead node list.
- if (! useful_node_set.test(node_idx) ) {
+ if (!useful_node_set.test(node_idx)) {
record_dead_node(node_idx);
}
}
@@ -648,6 +648,7 @@
_has_reserved_stack_access(target->has_reserved_stack_access()),
#ifndef PRODUCT
_trace_opto_output(directive->TraceOptoOutputOption),
+ _print_ideal(directive->PrintIdealOption),
#endif
_has_method_handle_invokes(false),
_clinit_barrier_on_entry(false),
@@ -873,7 +874,7 @@
NOT_PRODUCT( verify_graph_edges(); )
#ifndef PRODUCT
- if (PrintIdeal) {
+ if (print_ideal()) {
ttyLocker ttyl; // keep the following output all in one block
// This output goes directly to the tty, not the compiler log.
// To enable tools to match it up with the compilation activity,
@@ -983,6 +984,7 @@
_has_reserved_stack_access(false),
#ifndef PRODUCT
_trace_opto_output(directive->TraceOptoOutputOption),
+ _print_ideal(directive->PrintIdealOption),
#endif
_has_method_handle_invokes(false),
_clinit_barrier_on_entry(false),
@@ -1653,6 +1655,7 @@
}
void Compile::AliasType::Init(int i, const TypePtr* at) {
+ assert(AliasIdxTop <= i && i < Compile::current()->_max_alias_types, "Invalid alias index");
_index = i;
_adr_type = at;
_field = NULL;
--- a/src/hotspot/share/opto/compile.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/compile.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -408,6 +408,7 @@
bool _print_intrinsics; // True if we should print intrinsics for this compilation
#ifndef PRODUCT
bool _trace_opto_output;
+ bool _print_ideal;
bool _parsed_irreducible_loop; // True if ciTypeFlow detected irreducible loops during parsing
#endif
bool _has_irreducible_loop; // Found irreducible loops
@@ -724,6 +725,7 @@
#ifndef PRODUCT
bool trace_opto_output() const { return _trace_opto_output; }
+ bool print_ideal() const { return _print_ideal; }
bool parsed_irreducible_loop() const { return _parsed_irreducible_loop; }
void set_parsed_irreducible_loop(bool z) { _parsed_irreducible_loop = z; }
int _in_dump_cnt; // Required for dumping ir nodes.
@@ -915,9 +917,7 @@
void record_dead_node(uint idx) { if (_dead_node_list.test_set(idx)) return;
_dead_node_count++;
}
- bool is_dead_node(uint idx) { return _dead_node_list.test(idx) != 0; }
- uint dead_node_count() { return _dead_node_count; }
- void reset_dead_node_list() { _dead_node_list.Reset();
+ void reset_dead_node_list() { _dead_node_list.reset();
_dead_node_count = 0;
}
uint live_nodes() const {
--- a/src/hotspot/share/opto/escape.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/escape.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -1414,7 +1414,7 @@
}
}
_worklist.clear();
- _in_worklist.Reset();
+ _in_worklist.reset();
return new_edges;
}
--- a/src/hotspot/share/opto/gcm.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/gcm.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -510,6 +510,7 @@
// do not need anti-dependence edges.
int load_alias_idx = C->get_alias_index(load->adr_type());
#ifdef ASSERT
+ assert(Compile::AliasIdxTop <= load_alias_idx && load_alias_idx < C->num_alias_types(), "Invalid alias index");
if (load_alias_idx == Compile::AliasIdxBot && C->AliasLevel() > 0 &&
(PrintOpto || VerifyAliases ||
(PrintMiscellaneous && (WizardMode || Verbose)))) {
@@ -522,18 +523,6 @@
if (VerifyAliases) assert(load_alias_idx != Compile::AliasIdxBot, "");
}
#endif
- assert(load_alias_idx || (load->is_Mach() && load->as_Mach()->ideal_Opcode() == Op_StrComp),
- "String compare is only known 'load' that does not conflict with any stores");
- assert(load_alias_idx || (load->is_Mach() && load->as_Mach()->ideal_Opcode() == Op_StrEquals),
- "String equals is a 'load' that does not conflict with any stores");
- assert(load_alias_idx || (load->is_Mach() && load->as_Mach()->ideal_Opcode() == Op_StrIndexOf),
- "String indexOf is a 'load' that does not conflict with any stores");
- assert(load_alias_idx || (load->is_Mach() && load->as_Mach()->ideal_Opcode() == Op_StrIndexOfChar),
- "String indexOfChar is a 'load' that does not conflict with any stores");
- assert(load_alias_idx || (load->is_Mach() && load->as_Mach()->ideal_Opcode() == Op_AryEq),
- "Arrays equals is a 'load' that does not conflict with any stores");
- assert(load_alias_idx || (load->is_Mach() && load->as_Mach()->ideal_Opcode() == Op_HasNegatives),
- "HasNegatives is a 'load' that does not conflict with any stores");
if (!C->alias_type(load_alias_idx)->is_rewritable()) {
// It is impossible to spoil this load by putting stores before it,
@@ -850,7 +839,7 @@
stack.push(root, root->outcnt());
// Clear the visited bits
- visited.Clear();
+ visited.clear();
}
// Iterator for the Node_Backward_Iterator
@@ -1372,7 +1361,7 @@
// Find the earliest Block any instruction can be placed in. Some
// instructions are pinned into Blocks. Unpinned instructions can
// appear in last block in which all their inputs occur.
- visited.Clear();
+ visited.clear();
Node_Stack stack(arena, (C->live_nodes() >> 2) + 16); // pre-grow
if (!schedule_early(visited, stack)) {
// Bailout without retry
@@ -1392,7 +1381,7 @@
// Now schedule all codes as LATE as possible. This is the LCA in the
// dominator tree of all USES of a value. Pick the block with the least
// loop nesting depth that is lowest in the dominator tree.
- // ( visited.Clear() called in schedule_late()->Node_Backward_Iterator() )
+ // ( visited.clear() called in schedule_late()->Node_Backward_Iterator() )
schedule_late(visited, stack);
if (C->failing()) {
// schedule_late fails only when graph is incorrect.
@@ -1473,7 +1462,7 @@
// Schedule locally. Right now a simple topological sort.
// Later, do a real latency aware scheduler.
GrowableArray<int> ready_cnt(C->unique(), C->unique(), -1);
- visited.Clear();
+ visited.reset();
for (uint i = 0; i < number_of_blocks(); i++) {
Block* block = get_block(i);
if (!schedule_local(block, ready_cnt, visited, recalc_pressure_nodes)) {
--- a/src/hotspot/share/opto/graphKit.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/graphKit.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -43,6 +43,7 @@
#include "opto/runtime.hpp"
#include "runtime/deoptimization.hpp"
#include "runtime/sharedRuntime.hpp"
+#include "utilities/bitMap.inline.hpp"
//----------------------------GraphKit-----------------------------------------
// Main utility constructor.
--- a/src/hotspot/share/opto/idealGraphPrinter.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/idealGraphPrinter.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -584,7 +584,7 @@
#ifdef ASSERT
if (node->debug_orig() != NULL) {
- temp_set->Clear();
+ temp_set->clear();
stringStream dorigStream;
Node* dorig = node->debug_orig();
while (dorig && temp_set->test_set(dorig->_idx)) {
--- a/src/hotspot/share/opto/ifg.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/ifg.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -141,10 +141,10 @@
}
// Re-insert a yanked Node.
-void PhaseIFG::re_insert( uint a ) {
+void PhaseIFG::re_insert(uint a) {
assert( _is_square, "only on square" );
assert( _yanked->test(a), "" );
- (*_yanked) >>= a;
+ _yanked->remove(a);
IndexSetIterator elements(&_adjs[a]);
uint datum;
@@ -198,7 +198,7 @@
_is_square ? "square" : "triangular" );
if( _is_square ) {
for( uint i = 0; i < _maxlrg; i++ ) {
- tty->print( (*_yanked)[i] ? "XX " : " ");
+ tty->print(_yanked->test(i) ? "XX " : " ");
tty->print("L%d: { ",i);
IndexSetIterator elements(&_adjs[i]);
uint datum;
@@ -214,7 +214,7 @@
// Triangular
for( uint i = 0; i < _maxlrg; i++ ) {
uint j;
- tty->print( (*_yanked)[i] ? "XX " : " ");
+ tty->print(_yanked->test(i) ? "XX " : " ");
tty->print("L%d: { ",i);
for( j = _maxlrg; j > i; j-- )
if( test_edge(j - 1,i) ) {
@@ -249,7 +249,7 @@
void PhaseIFG::verify( const PhaseChaitin *pc ) const {
// IFG is square, sorted and no need for Find
for( uint i = 0; i < _maxlrg; i++ ) {
- assert(!((*_yanked)[i]) || !neighbor_cnt(i), "Is removed completely" );
+ assert(!_yanked->test(i) || !neighbor_cnt(i), "Is removed completely" );
IndexSet *set = &_adjs[i];
IndexSetIterator elements(set);
uint idx;
@@ -258,7 +258,7 @@
assert(idx != i, "Must have empty diagonal");
assert(pc->_lrg_map.find_const(idx) == idx, "Must not need Find");
assert(_adjs[idx].member(i), "IFG not square");
- assert(!(*_yanked)[idx], "No yanked neighbors");
+ assert(!_yanked->test(idx), "No yanked neighbors");
assert(last < idx, "not sorted increasing");
last = idx;
}
--- a/src/hotspot/share/opto/ifnode.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/ifnode.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -117,7 +117,7 @@
// No intervening control, like a simple Call
Node *r = iff->in(0);
if( !r->is_Region() ) return NULL;
- if (r->is_Loop() && r->in(LoopNode::LoopBackControl)->is_top()) return NULL; // going away anyway
+ if (r->is_Loop()) return NULL;
if( phi->region() != r ) return NULL;
// No other users of the cmp/bool
if (b->outcnt() != 1 || cmp->outcnt() != 1) {
@@ -238,16 +238,13 @@
// Make a region merging constants and a region merging the rest
uint req_c = 0;
- Node* predicate_proj = NULL;
- int nb_predicate_proj = 0;
for (uint ii = 1; ii < r->req(); ii++) {
if (phi->in(ii) == con1) {
req_c++;
}
Node* proj = PhaseIdealLoop::find_predicate(r->in(ii));
if (proj != NULL) {
- nb_predicate_proj++;
- predicate_proj = proj;
+ return NULL;
}
}
@@ -257,24 +254,6 @@
return NULL;
}
- if (nb_predicate_proj > 1) {
- // Can happen in case of loop unswitching and when the loop is
- // optimized out: it's not a loop anymore so we don't care about
- // predicates.
- assert(!r->is_Loop(), "this must not be a loop anymore");
- predicate_proj = NULL;
- }
- Node* predicate_c = NULL;
- Node* predicate_x = NULL;
- bool counted_loop = r->is_CountedLoop();
- if (counted_loop) {
- // Ignore counted loops for now because the split-if logic does not work
- // in all the cases (for example, with strip mined loops). Also, above
- // checks only pass for already degraded loops without a tripcount phi
- // and these are essentially dead and will go away during igvn.
- return NULL;
- }
-
Node *region_c = new RegionNode(req_c + 1);
Node *phi_c = con1;
uint len = r->req();
@@ -283,23 +262,11 @@
for (uint i = 1, i_c = 1, i_x = 1; i < len; i++) {
if (phi->in(i) == con1) {
region_c->init_req( i_c++, r ->in(i) );
- if (r->in(i) == predicate_proj)
- predicate_c = predicate_proj;
} else {
region_x->init_req( i_x, r ->in(i) );
phi_x ->init_req( i_x++, phi->in(i) );
- if (r->in(i) == predicate_proj)
- predicate_x = predicate_proj;
}
}
- if (predicate_c != NULL && (req_c > 1)) {
- assert(predicate_x == NULL, "only one predicate entry expected");
- predicate_c = NULL; // Do not clone predicate below merge point
- }
- if (predicate_x != NULL && ((len - req_c) > 2)) {
- assert(predicate_c == NULL, "only one predicate entry expected");
- predicate_x = NULL; // Do not clone predicate below merge point
- }
// Register the new RegionNodes but do not transform them. Cannot
// transform until the entire Region/Phi conglomerate has been hacked
@@ -341,20 +308,8 @@
// Make the true/false arms
Node *iff_c_t = phase->transform(new IfTrueNode (iff_c));
Node *iff_c_f = phase->transform(new IfFalseNode(iff_c));
- if (predicate_c != NULL) {
- assert(predicate_x == NULL, "only one predicate entry expected");
- // Clone loop predicates to each path
- iff_c_t = igvn->clone_loop_predicates(predicate_c, iff_c_t, !counted_loop);
- iff_c_f = igvn->clone_loop_predicates(predicate_c, iff_c_f, !counted_loop);
- }
Node *iff_x_t = phase->transform(new IfTrueNode (iff_x));
Node *iff_x_f = phase->transform(new IfFalseNode(iff_x));
- if (predicate_x != NULL) {
- assert(predicate_c == NULL, "only one predicate entry expected");
- // Clone loop predicates to each path
- iff_x_t = igvn->clone_loop_predicates(predicate_x, iff_x_t, !counted_loop);
- iff_x_f = igvn->clone_loop_predicates(predicate_x, iff_x_f, !counted_loop);
- }
// Merge the TRUE paths
Node *region_s = new RegionNode(3);
--- a/src/hotspot/share/opto/library_call.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/library_call.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -4234,10 +4234,7 @@
alloc->initialization()->set_complete_with_arraycopy();
}
- // Copy the fastest available way.
- // TODO: generate fields copies for small objects instead.
Node* size = _gvn.transform(obj_size);
-
access_clone(obj, alloc_obj, size, is_array);
// Do not let reads from the cloned object float above the arraycopy.
@@ -4304,12 +4301,6 @@
}
}
- Node* obj_klass = load_object_klass(obj);
- const TypeKlassPtr* tklass = _gvn.type(obj_klass)->isa_klassptr();
- const TypeOopPtr* toop = ((tklass != NULL)
- ? tklass->as_instance_type()
- : TypeInstPtr::NOTNULL);
-
// Conservatively insert a memory barrier on all memory slices.
// Do not let writes into the original float below the clone.
insert_mem_bar(Op_MemBarCPUOrder);
@@ -4328,6 +4319,7 @@
PhiNode* result_mem = new PhiNode(result_reg, Type::MEMORY, TypePtr::BOTTOM);
record_for_igvn(result_reg);
+ Node* obj_klass = load_object_klass(obj);
Node* array_ctl = generate_array_guard(obj_klass, (RegionNode*)NULL);
if (array_ctl != NULL) {
// It's an array.
@@ -4349,7 +4341,7 @@
// Generate a direct call to the right arraycopy function(s).
Node* alloc = tightly_coupled_allocation(alloc_obj, NULL);
ArrayCopyNode* ac = ArrayCopyNode::make(this, true, obj, intcon(0), alloc_obj, intcon(0), obj_length, alloc != NULL, false);
- ac->set_cloneoop();
+ ac->set_clone_oop_array();
Node* n = _gvn.transform(ac);
assert(n == ac, "cannot disappear");
ac->connect_outputs(this);
--- a/src/hotspot/share/opto/loopnode.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/loopnode.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -2121,7 +2121,7 @@
void IdealLoopTree::allpaths_check_safepts(VectorSet &visited, Node_List &stack) {
assert(stack.size() == 0, "empty stack");
stack.push(_tail);
- visited.Clear();
+ visited.clear();
visited.set(_tail->_idx);
while (stack.size() > 0) {
Node* n = stack.pop();
@@ -2930,12 +2930,12 @@
int stack_size = (C->live_nodes() >> 1) + 16; // (live_nodes>>1)+16 from Java2D stats
Node_Stack nstack( a, stack_size );
- visited.Clear();
+ visited.clear();
Node_List worklist(a);
// Don't need C->root() on worklist since
// it will be processed among C->top() inputs
- worklist.push( C->top() );
- visited.set( C->top()->_idx ); // Set C->top() as visited now
+ worklist.push(C->top());
+ visited.set(C->top()->_idx); // Set C->top() as visited now
build_loop_early( visited, worklist, nstack );
// Given early legal placement, try finding counted loops. This placement
@@ -2945,12 +2945,12 @@
}
// Find latest loop placement. Find ideal loop placement.
- visited.Clear();
+ visited.clear();
init_dom_lca_tags();
// Need C->root() on worklist when processing outs
- worklist.push( C->root() );
+ worklist.push(C->root());
NOT_PRODUCT( C->verify_graph_edges(); )
- worklist.push( C->top() );
+ worklist.push(C->top());
build_loop_late( visited, worklist, nstack );
if (_verify_only) {
@@ -3046,7 +3046,7 @@
// Check for aggressive application of split-if and other transforms
// that require basic-block info (like cloning through Phi's)
if( SplitIfBlocks && do_split_ifs ) {
- visited.Clear();
+ visited.clear();
split_if_with_blocks( visited, nstack);
NOT_PRODUCT( if( VerifyLoopOptimizations ) verify(); );
}
--- a/src/hotspot/share/opto/loopopts.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/loopopts.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -2726,7 +2726,7 @@
_igvn.register_new_node_with_optimizer(n_clone);
set_ctrl(n_clone, get_ctrl(n));
sink_list.push(n_clone);
- not_peel <<= n_clone->_idx; // add n_clone to not_peel set.
+ not_peel.set(n_clone->_idx);
#ifndef PRODUCT
if (TracePartialPeeling) {
tty->print_cr("special not_peeled cloning old: %d new: %d", n->_idx, n_clone->_idx);
@@ -3236,8 +3236,8 @@
if (n->in(0) == NULL && !n->is_Load() && !n->is_CMove()) {
cloned_for_outside_use += clone_for_use_outside_loop(loop, n, worklist);
sink_list.push(n);
- peel >>= n->_idx; // delete n from peel set.
- not_peel <<= n->_idx; // add n to not_peel set.
+ peel.remove(n->_idx);
+ not_peel.set(n->_idx);
peel_list.remove(i);
incr = false;
#ifndef PRODUCT
--- a/src/hotspot/share/opto/macroArrayCopy.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/macroArrayCopy.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -505,7 +505,7 @@
// We don't need a subtype check for validated copies and Object[].clone()
bool skip_subtype_check = ac->is_arraycopy_validated() || ac->is_copyof_validated() ||
- ac->is_copyofrange_validated() || ac->is_cloneoop();
+ ac->is_copyofrange_validated() || ac->is_clone_oop_array();
if (!skip_subtype_check) {
// Get the klass* for both src and dest
Node* src_klass = ac->in(ArrayCopyNode::SrcKlass);
@@ -1096,7 +1096,7 @@
BarrierSetC2* bs = BarrierSet::barrier_set()->barrier_set_c2();
bs->clone_at_expansion(this, ac);
return;
- } else if (ac->is_copyof() || ac->is_copyofrange() || ac->is_cloneoop()) {
+ } else if (ac->is_copyof() || ac->is_copyofrange() || ac->is_clone_oop_array()) {
Node* mem = ac->in(TypeFunc::Memory);
merge_mem = MergeMemNode::make(mem);
transform_later(merge_mem);
--- a/src/hotspot/share/opto/matcher.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/matcher.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -157,7 +157,7 @@
worklist.push(xroot);
while (worklist.size() > 0) {
Node* n = worklist.pop();
- visited <<= n->_idx;
+ visited.set(n->_idx);
assert(C->node_arena()->contains(n), "dead node");
for (uint j = 0; j < n->req(); j++) {
Node* in = n->in(j);
@@ -340,7 +340,7 @@
// Recursively match trees from old space into new space.
// Correct leaves of new-space Nodes; they point to old-space.
- _visited.Clear(); // Clear visit bits for xform call
+ _visited.clear();
C->set_cached_top_node(xform( C->top(), live_nodes ));
if (!C->failing()) {
Node* xroot = xform( C->root(), 1 );
--- a/src/hotspot/share/opto/node.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/node.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -2399,14 +2399,15 @@
//=============================================================================
//------------------------------remove-----------------------------------------
-void Unique_Node_List::remove( Node *n ) {
- if( _in_worklist[n->_idx] ) {
- for( uint i = 0; i < size(); i++ )
- if( _nodes[i] == n ) {
- map(i,Node_List::pop());
- _in_worklist >>= n->_idx;
+void Unique_Node_List::remove(Node* n) {
+ if (_in_worklist.test(n->_idx)) {
+ for (uint i = 0; i < size(); i++) {
+ if (_nodes[i] == n) {
+ map(i, Node_List::pop());
+ _in_worklist.remove(n->_idx);
return;
}
+ }
ShouldNotReachHere();
}
}
@@ -2415,11 +2416,11 @@
// Remove useless nodes from worklist
void Unique_Node_List::remove_useless_nodes(VectorSet &useful) {
- for( uint i = 0; i < size(); ++i ) {
+ for (uint i = 0; i < size(); ++i) {
Node *n = at(i);
assert( n != NULL, "Did not expect null entries in worklist");
- if( ! useful.test(n->_idx) ) {
- _in_worklist >>= n->_idx;
+ if (!useful.test(n->_idx)) {
+ _in_worklist.remove(n->_idx);
map(i,Node_List::pop());
// Node *replacement = Node_List::pop();
// if( i != size() ) { // Check if removing last entry
--- a/src/hotspot/share/opto/node.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/node.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -1521,9 +1521,9 @@
void remove( Node *n );
bool member( Node *n ) { return _in_worklist.test(n->_idx) != 0; }
- VectorSet &member_set(){ return _in_worklist; }
+ VectorSet& member_set(){ return _in_worklist; }
- void push( Node *b ) {
+ void push(Node* b) {
if( !_in_worklist.test_set(b->_idx) )
Node_List::push(b);
}
@@ -1532,24 +1532,27 @@
Node *b = at(_clock_index);
map( _clock_index, Node_List::pop());
if (size() != 0) _clock_index++; // Always start from 0
- _in_worklist >>= b->_idx;
+ _in_worklist.remove(b->_idx);
return b;
}
- Node *remove( uint i ) {
+ Node *remove(uint i) {
Node *b = Node_List::at(i);
- _in_worklist >>= b->_idx;
+ _in_worklist.remove(b->_idx);
map(i,Node_List::pop());
return b;
}
- void yank( Node *n ) { _in_worklist >>= n->_idx; Node_List::yank(n); }
+ void yank(Node *n) {
+ _in_worklist.remove(n->_idx);
+ Node_List::yank(n);
+ }
void clear() {
- _in_worklist.Clear(); // Discards storage but grows automatically
+ _in_worklist.clear(); // Discards storage but grows automatically
Node_List::clear();
_clock_index = 0;
}
// Used after parsing to remove useless nodes before Iterative GVN
- void remove_useless_nodes(VectorSet &useful);
+ void remove_useless_nodes(VectorSet& useful);
#ifndef PRODUCT
void print_set() const { _in_worklist.print(); }
--- a/src/hotspot/share/opto/parse1.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/parse1.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -41,6 +41,7 @@
#include "runtime/handles.inline.hpp"
#include "runtime/safepointMechanism.hpp"
#include "runtime/sharedRuntime.hpp"
+#include "utilities/bitMap.inline.hpp"
#include "utilities/copy.hpp"
// Static array so we can figure out which bytecodes stop us from compiling
--- a/src/hotspot/share/opto/phaseX.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/phaseX.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -91,7 +91,7 @@
return _table[table_index];
}
- void remove_useless_nodes(VectorSet &useful); // replace with sentinel
+ void remove_useless_nodes(VectorSet& useful); // replace with sentinel
void replace_with(NodeHash* nh);
void check_no_speculative_types(); // Check no speculative part for type nodes in table
--- a/src/hotspot/share/opto/stringopts.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/stringopts.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -379,7 +379,7 @@
Node_List string_calls;
Node_List worklist;
- _visited.Clear();
+ _visited.clear();
// Prime the worklist
for (uint i = 1; i < C->root()->len(); i++) {
@@ -1033,7 +1033,7 @@
// Validate that all these results produced are contained within
// this cluster of objects. First collect all the results produced
// by calls in the region.
- _stringopts->_visited.Clear();
+ _stringopts->_visited.clear();
Node_List worklist;
Node* final_result = _end->proj_out_or_null(TypeFunc::Parms);
for (uint i = 0; i < _control.size(); i++) {
--- a/src/hotspot/share/opto/superword.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/superword.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -359,11 +359,11 @@
void set_bb_idx(Node* n, int i) { _bb_idx.at_put_grow(n->_idx, i); }
// visited set accessors
- void visited_clear() { _visited.Clear(); }
+ void visited_clear() { _visited.clear(); }
void visited_set(Node* n) { return _visited.set(bb_idx(n)); }
int visited_test(Node* n) { return _visited.test(bb_idx(n)); }
int visited_test_set(Node* n) { return _visited.test_set(bb_idx(n)); }
- void post_visited_clear() { _post_visited.Clear(); }
+ void post_visited_clear() { _post_visited.clear(); }
void post_visited_set(Node* n) { return _post_visited.set(bb_idx(n)); }
int post_visited_test(Node* n) { return _post_visited.test(bb_idx(n)); }
--- a/src/hotspot/share/opto/type.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/opto/type.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -290,6 +290,7 @@
const TypeF *isa_float_constant() const; // Returns NULL if not a FloatCon
const TypeTuple *is_tuple() const; // Collection of fields, NOT a pointer
const TypeAry *is_ary() const; // Array, NOT array pointer
+ const TypeAry *isa_ary() const; // Returns NULL of not ary
const TypeVect *is_vect() const; // Vector
const TypeVect *isa_vect() const; // Returns NULL if not a Vector
const TypePtr *is_ptr() const; // Asserts it is a ptr type
@@ -1615,6 +1616,10 @@
return (TypeAry*)this;
}
+inline const TypeAry *Type::isa_ary() const {
+ return ((_base == Array) ? (TypeAry*)this : NULL);
+}
+
inline const TypeVect *Type::is_vect() const {
assert( _base >= VectorS && _base <= VectorZ, "Not a Vector" );
return (TypeVect*)this;
--- a/src/hotspot/share/prims/jni.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/prims/jni.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -419,7 +419,7 @@
}
TempNewSymbol sym = SymbolTable::new_symbol(name);
- result = find_class_from_class_loader(env, sym, true, true, loader,
+ result = find_class_from_class_loader(env, sym, true, loader,
protection_domain, true, thread);
if (log_is_enabled(Debug, class, resolve) && result != NULL) {
@@ -3208,7 +3208,7 @@
Handle protection_domain; // null protection domain
TempNewSymbol sym = SymbolTable::new_symbol(name);
- jclass result = find_class_from_class_loader(env, sym, true, true, loader, protection_domain, true, CHECK_NULL);
+ jclass result = find_class_from_class_loader(env, sym, true, loader, protection_domain, true, CHECK_NULL);
if (log_is_enabled(Debug, class, resolve) && result != NULL) {
trace_class_resolution(java_lang_Class::as_Klass(JNIHandles::resolve_non_null(result)));
--- a/src/hotspot/share/prims/jvm.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/prims/jvm.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -742,17 +742,6 @@
// Misc. class handling ///////////////////////////////////////////////////////////
-JVM_ENTRY(void, JVM_LinkClass(JNIEnv* env, jclass classClass, jclass arg))
- JVMWrapper("JVM_LinkClass");
-
- oop r = JNIHandles::resolve(arg);
- Klass* klass = java_lang_Class::as_Klass(r);
-
- if (!ClassForNameDeferLinking && klass->is_instance_klass()) {
- InstanceKlass::cast(klass)->link_class(CHECK);
- }
-JVM_END
-
JVM_ENTRY(jclass, JVM_GetCallerClass(JNIEnv* env))
JVMWrapper("JVM_GetCallerClass");
@@ -863,10 +852,9 @@
Handle h_loader(THREAD, loader_oop);
Handle h_prot(THREAD, protection_domain);
-
- jboolean link = !ClassForNameDeferLinking;
- jclass result = find_class_from_class_loader(env, h_name, init, link, h_loader,
+ jclass result = find_class_from_class_loader(env, h_name, init, h_loader,
h_prot, false, THREAD);
+
if (log_is_enabled(Debug, class, resolve) && result != NULL) {
trace_class_resolution(java_lang_Class::as_Klass(JNIHandles::resolve_non_null(result)));
}
@@ -903,7 +891,7 @@
}
Handle h_loader(THREAD, class_loader);
Handle h_prot (THREAD, protection_domain);
- jclass result = find_class_from_class_loader(env, h_name, init, false, h_loader,
+ jclass result = find_class_from_class_loader(env, h_name, init, h_loader,
h_prot, true, thread);
if (log_is_enabled(Debug, class, resolve) && result != NULL) {
@@ -3410,12 +3398,9 @@
// Shared JNI/JVM entry points //////////////////////////////////////////////////////////////
-jclass find_class_from_class_loader(JNIEnv* env, Symbol* name, jboolean init, jboolean link,
+jclass find_class_from_class_loader(JNIEnv* env, Symbol* name, jboolean init,
Handle loader, Handle protection_domain,
jboolean throwError, TRAPS) {
- // Initialization also implies linking - check for coherent args
- assert((init && link) || !init, "incorrect use of init/link arguments");
-
// Security Note:
// The Java level wrapper will perform the necessary security check allowing
// us to pass the NULL as the initiating class loader. The VM is responsible for
@@ -3424,11 +3409,9 @@
// if there is no security manager in 3-arg Class.forName().
Klass* klass = SystemDictionary::resolve_or_fail(name, loader, protection_domain, throwError != 0, CHECK_NULL);
- // Check if we should initialize the class (which implies linking), or just link it
+ // Check if we should initialize the class
if (init && klass->is_instance_klass()) {
klass->initialize(CHECK_NULL);
- } else if (link && klass->is_instance_klass()) {
- InstanceKlass::cast(klass)->link_class(CHECK_NULL);
}
return (jclass) JNIHandles::make_local(env, klass->java_mirror());
}
--- a/src/hotspot/share/prims/jvm_misc.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/prims/jvm_misc.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -31,8 +31,7 @@
// Useful entry points shared by JNI and JVM interface.
// We do not allow real JNI or JVM entry point to call each other.
-jclass find_class_from_class_loader(JNIEnv* env, Symbol* name, jboolean init, jboolean link,
- Handle loader, Handle protection_domain, jboolean throwError, TRAPS);
+jclass find_class_from_class_loader(JNIEnv* env, Symbol* name, jboolean init, Handle loader, Handle protection_domain, jboolean throwError, TRAPS);
void trace_class_resolution(Klass* to_class);
--- a/src/hotspot/share/runtime/arguments.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/runtime/arguments.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -4029,6 +4029,12 @@
no_shared_spaces("CDS Disabled");
#endif // INCLUDE_CDS
+#ifndef TIERED
+ if (FLAG_IS_CMDLINE(CompilationMode)) {
+ warning("CompilationMode has no effect in non-tiered VMs");
+ }
+#endif
+
return JNI_OK;
}
--- a/src/hotspot/share/runtime/fieldDescriptor.inline.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/runtime/fieldDescriptor.inline.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -31,11 +31,11 @@
// must be put in this file, as they require runtime/handles.inline.hpp.
inline Symbol* fieldDescriptor::name() const {
- return field()->name(_cp());
+ return field()->name(_cp);
}
inline Symbol* fieldDescriptor::signature() const {
- return field()->signature(_cp());
+ return field()->signature(_cp);
}
inline InstanceKlass* fieldDescriptor::field_holder() const {
--- a/src/hotspot/share/runtime/flags/jvmFlagConstraintsCompiler.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/runtime/flags/jvmFlagConstraintsCompiler.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -67,7 +67,7 @@
int min_number_of_compiler_threads = 0;
#if !defined(COMPILER1) && !defined(COMPILER2) && !INCLUDE_JVMCI
// case 1
-#else
+#elif defined(TIERED)
if (TieredCompilation) {
if (TieredStopAtLevel < CompLevel_full_optimization || CompilationModeFlag::quick_only()) {
min_number_of_compiler_threads = 1; // case 3
@@ -84,6 +84,8 @@
} else {
min_number_of_compiler_threads = 1; // case 2
}
+#else
+ min_number_of_compiler_threads = 1; // case 2
#endif
// The default CICompilerCount's value is CI_COMPILER_COUNT.
--- a/src/hotspot/share/runtime/globals.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/runtime/globals.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -2223,9 +2223,6 @@
"Maximum total size of NIO direct-buffer allocations") \
range(0, max_jlong) \
\
- product(bool, ClassForNameDeferLinking, false, \
- "Revert to not linking in Class.forName()") \
- \
/* Flags used for temporary code during development */ \
\
diagnostic(bool, UseNewCode, false, \
--- a/src/hotspot/share/runtime/os.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/runtime/os.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -755,8 +755,8 @@
NOT_PRODUCT(inc_stat_counter(&num_mallocs, 1));
NOT_PRODUCT(inc_stat_counter(&alloc_bytes, size));
// NMT support
- void* membase = MemTracker::record_free(memblock);
NMT_TrackingLevel level = MemTracker::tracking_level();
+ void* membase = MemTracker::record_free(memblock, level);
size_t nmt_header_size = MemTracker::malloc_header_size(level);
void* ptr = ::realloc(membase, size + nmt_header_size);
return MemTracker::record_malloc(ptr, size, memflags, stack, level);
@@ -797,7 +797,7 @@
log_warning(malloc, free)("os::free caught " PTR_FORMAT, p2i(memblock));
breakpoint();
}
- void* membase = MemTracker::record_free(memblock);
+ void* membase = MemTracker::record_free(memblock, MemTracker::tracking_level());
verify_memory(membase);
GuardedMemory guarded(membase);
@@ -806,7 +806,7 @@
membase = guarded.release_for_freeing();
::free(membase);
#else
- void* membase = MemTracker::record_free(memblock);
+ void* membase = MemTracker::record_free(memblock, MemTracker::tracking_level());
::free(membase);
#endif
}
--- a/src/hotspot/share/runtime/sharedRuntime.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/runtime/sharedRuntime.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -2615,7 +2615,7 @@
AdapterHandlerEntry* AdapterHandlerLibrary::get_adapter(const methodHandle& method) {
AdapterHandlerEntry* entry = get_adapter0(method);
- if (method->is_shared()) {
+ if (entry != NULL && method->is_shared()) {
// See comments around Method::link_method()
MutexLocker mu(AdapterHandlerLibrary_lock);
if (method->adapter() == NULL) {
--- a/src/hotspot/share/runtime/thread.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/runtime/thread.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -1741,6 +1741,16 @@
bool JavaThread::is_interrupted(bool clear_interrupted) {
debug_only(check_for_dangling_thread_pointer(this);)
+
+ if (threadObj() == NULL) {
+ // If there is no j.l.Thread then it is impossible to have
+ // been interrupted. We can find NULL during VM initialization
+ // or when a JNI thread is still in the process of attaching.
+ // In such cases this must be the current thread.
+ assert(this == Thread::current(), "invariant");
+ return false;
+ }
+
bool interrupted = java_lang_Thread::interrupted(threadObj());
// NOTE that since there is no "lock" around the interrupt and
@@ -1759,6 +1769,7 @@
// state if we are going to report that we were interrupted; otherwise
// an interrupt that happens just after we read the field would be lost.
if (interrupted && clear_interrupted) {
+ assert(this == Thread::current(), "only the current thread can clear");
java_lang_Thread::set_interrupted(threadObj(), false);
osthread()->set_interrupted(false);
}
--- a/src/hotspot/share/services/mallocTracker.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/services/mallocTracker.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -119,6 +119,7 @@
// Record a malloc memory allocation
void* MallocTracker::record_malloc(void* malloc_base, size_t size, MEMFLAGS flags,
const NativeCallStack& stack, NMT_TrackingLevel level) {
+ assert(level != NMT_off, "precondition");
void* memblock; // the address for user data
MallocHeader* header = NULL;
@@ -128,10 +129,6 @@
// Uses placement global new operator to initialize malloc header
- if (level == NMT_off) {
- return malloc_base;
- }
-
header = ::new (malloc_base)MallocHeader(size, flags, stack, level);
memblock = (void*)((char*)malloc_base + sizeof(MallocHeader));
@@ -151,14 +148,9 @@
}
void* MallocTracker::record_free(void* memblock) {
- // Never turned on
- if (MemTracker::tracking_level() == NMT_off ||
- memblock == NULL) {
- return memblock;
- }
+ assert(MemTracker::tracking_level() != NMT_off && memblock != NULL, "precondition");
MallocHeader* header = malloc_header(memblock);
header->release();
-
return (void*)header;
}
--- a/src/hotspot/share/services/memTracker.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/services/memTracker.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -147,7 +147,7 @@
// Shutdown can only be issued via JCmd, and NMT JCmd is serialized by lock
void MemTracker::shutdown() {
// We can only shutdown NMT to minimal tracking level if it is ever on.
- if (tracking_level () > NMT_minimal) {
+ if (tracking_level() > NMT_minimal) {
transition_to(NMT_minimal);
}
}
--- a/src/hotspot/share/services/memTracker.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/services/memTracker.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -59,7 +59,7 @@
static inline size_t malloc_header_size(NMT_TrackingLevel level) { return 0; }
static inline size_t malloc_header_size(void* memblock) { return 0; }
static inline void* malloc_base(void* memblock) { return memblock; }
- static inline void* record_free(void* memblock) { return memblock; }
+ static inline void* record_free(void* memblock, NMT_TrackingLevel level) { return memblock; }
static inline void record_new_arena(MEMFLAGS flag) { }
static inline void record_arena_free(MEMFLAGS flag) { }
@@ -157,7 +157,10 @@
static inline void* record_malloc(void* mem_base, size_t size, MEMFLAGS flag,
const NativeCallStack& stack, NMT_TrackingLevel level) {
- return MallocTracker::record_malloc(mem_base, size, flag, stack, level);
+ if (level != NMT_off) {
+ return MallocTracker::record_malloc(mem_base, size, flag, stack, level);
+ }
+ return mem_base;
}
static inline size_t malloc_header_size(NMT_TrackingLevel level) {
@@ -177,7 +180,11 @@
static void* malloc_base(void* memblock);
// Record malloc free and return malloc base address
- static inline void* record_free(void* memblock) {
+ static inline void* record_free(void* memblock, NMT_TrackingLevel level) {
+ // Never turned on
+ if (level == NMT_off || memblock == NULL) {
+ return memblock;
+ }
return MallocTracker::record_free(memblock);
}
--- a/src/hotspot/share/utilities/bitMap.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/utilities/bitMap.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -26,6 +26,7 @@
#define SHARE_UTILITIES_BITMAP_HPP
#include "memory/allocation.hpp"
+#include "runtime/atomic.hpp"
#include "utilities/align.hpp"
// Forward decl;
@@ -105,6 +106,8 @@
void set_word (idx_t word) { set_word(word, ~(bm_word_t)0); }
void clear_word(idx_t word) { _map[word] = 0; }
+ static inline const bm_word_t load_word_ordered(const volatile bm_word_t* const addr, atomic_memory_order memory_order);
+
// Utilities for ranges of bits. Ranges are half-open [beg, end).
// Ranges within a single word.
@@ -204,6 +207,9 @@
return (*word_addr(index) & bit_mask(index)) != 0;
}
+ // memory_order must be memory_order_relaxed or memory_order_acquire.
+ bool par_at(idx_t index, atomic_memory_order memory_order = memory_order_acquire) const;
+
// Align bit index up or down to the next bitmap word boundary, or check
// alignment.
static idx_t word_align_up(idx_t bit) {
@@ -220,9 +226,14 @@
inline void set_bit(idx_t bit);
inline void clear_bit(idx_t bit);
- // Atomically set or clear the specified bit.
- inline bool par_set_bit(idx_t bit);
- inline bool par_clear_bit(idx_t bit);
+ // Attempts to change a bit to a desired value. The operation returns true if
+ // this thread changed the value of the bit. It was changed with a RMW operation
+ // using the specified memory_order. The operation returns false if the change
+ // could not be set due to the bit already being observed in the desired state.
+ // The atomic access that observed the bit in the desired state has acquire
+ // semantics, unless memory_order is memory_order_relaxed or memory_order_release.
+ inline bool par_set_bit(idx_t bit, atomic_memory_order memory_order = memory_order_conservative);
+ inline bool par_clear_bit(idx_t bit, atomic_memory_order memory_order = memory_order_conservative);
// Put the given value at the given offset. The parallel version
// will CAS the value into the bitmap and is quite a bit slower.
--- a/src/hotspot/share/utilities/bitMap.inline.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/utilities/bitMap.inline.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -26,6 +26,7 @@
#define SHARE_UTILITIES_BITMAP_INLINE_HPP
#include "runtime/atomic.hpp"
+#include "runtime/orderAccess.hpp"
#include "utilities/bitMap.hpp"
#include "utilities/count_trailing_zeros.hpp"
@@ -39,18 +40,39 @@
*word_addr(bit) &= ~bit_mask(bit);
}
-inline bool BitMap::par_set_bit(idx_t bit) {
+inline const BitMap::bm_word_t BitMap::load_word_ordered(const volatile bm_word_t* const addr, atomic_memory_order memory_order) {
+ if (memory_order == memory_order_relaxed || memory_order == memory_order_release) {
+ return Atomic::load(addr);
+ } else {
+ assert(memory_order == memory_order_acq_rel ||
+ memory_order == memory_order_acquire ||
+ memory_order == memory_order_conservative,
+ "unexpected memory ordering");
+ return OrderAccess::load_acquire(addr);
+ }
+}
+
+inline bool BitMap::par_at(idx_t index, atomic_memory_order memory_order) const {
+ verify_index(index);
+ assert(memory_order == memory_order_acquire ||
+ memory_order == memory_order_relaxed,
+ "unexpected memory ordering");
+ const volatile bm_word_t* const addr = word_addr(index);
+ return (load_word_ordered(addr, memory_order) & bit_mask(index)) != 0;
+}
+
+inline bool BitMap::par_set_bit(idx_t bit, atomic_memory_order memory_order) {
verify_index(bit);
volatile bm_word_t* const addr = word_addr(bit);
const bm_word_t mask = bit_mask(bit);
- bm_word_t old_val = *addr;
+ bm_word_t old_val = load_word_ordered(addr, memory_order);
do {
const bm_word_t new_val = old_val | mask;
if (new_val == old_val) {
return false; // Someone else beat us to it.
}
- const bm_word_t cur_val = Atomic::cmpxchg(new_val, addr, old_val);
+ const bm_word_t cur_val = Atomic::cmpxchg(new_val, addr, old_val, memory_order);
if (cur_val == old_val) {
return true; // Success.
}
@@ -58,18 +80,18 @@
} while (true);
}
-inline bool BitMap::par_clear_bit(idx_t bit) {
+inline bool BitMap::par_clear_bit(idx_t bit, atomic_memory_order memory_order) {
verify_index(bit);
volatile bm_word_t* const addr = word_addr(bit);
const bm_word_t mask = ~bit_mask(bit);
- bm_word_t old_val = *addr;
+ bm_word_t old_val = load_word_ordered(addr, memory_order);
do {
const bm_word_t new_val = old_val & mask;
if (new_val == old_val) {
return false; // Someone else beat us to it.
}
- const bm_word_t cur_val = Atomic::cmpxchg(new_val, addr, old_val);
+ const bm_word_t cur_val = Atomic::cmpxchg(new_val, addr, old_val, memory_order);
if (cur_val == old_val) {
return true; // Success.
}
--- a/src/hotspot/share/utilities/globalDefinitions.hpp Fri Nov 08 16:48:20 2019 -0500
+++ b/src/hotspot/share/utilities/globalDefinitions.hpp Fri Nov 08 20:41:14 2019 -0500
@@ -1110,6 +1110,33 @@
#undef JAVA_INTEGER_OP
+// Provide integer shift operations with Java semantics. No overflow
+// issues - left shifts simply discard shifted out bits. No undefined
+// behavior for large or negative shift quantities; instead the actual
+// shift distance is the argument modulo the lhs value's size in bits.
+// No undefined or implementation defined behavior for shifting negative
+// values; left shift discards bits, right shift sign extends. We use
+// the same safe conversion technique as above for java_add and friends.
+#define JAVA_INTEGER_SHIFT_OP(OP, NAME, TYPE, XTYPE) \
+inline TYPE NAME (TYPE lhs, jint rhs) { \
+ const uint rhs_mask = (sizeof(TYPE) * 8) - 1; \
+ STATIC_ASSERT(rhs_mask == 31 || rhs_mask == 63); \
+ XTYPE xres = static_cast<XTYPE>(lhs); \
+ xres OP ## = (rhs & rhs_mask); \
+ return reinterpret_cast<TYPE&>(xres); \
+}
+
+JAVA_INTEGER_SHIFT_OP(<<, java_shift_left, jint, juint)
+JAVA_INTEGER_SHIFT_OP(<<, java_shift_left, jlong, julong)
+// For signed shift right, assume C++ implementation >> sign extends.
+JAVA_INTEGER_SHIFT_OP(>>, java_shift_right, jint, jint)
+JAVA_INTEGER_SHIFT_OP(>>, java_shift_right, jlong, jlong)
+// For >>> use C++ unsigned >>.
+JAVA_INTEGER_SHIFT_OP(>>, java_shift_right_unsigned, jint, juint)
+JAVA_INTEGER_SHIFT_OP(>>, java_shift_right_unsigned, jlong, julong)
+
+#undef JAVA_INTEGER_SHIFT_OP
+
//----------------------------------------------------------------------------------------------------
// The goal of this code is to provide saturating operations for int/uint.
// Checks overflow conditions and saturates the result to min_jint/max_jint.
--- a/src/java.base/macosx/classes/sun/util/locale/provider/HostLocaleProviderAdapterImpl.java Fri Nov 08 16:48:20 2019 -0500
+++ b/src/java.base/macosx/classes/sun/util/locale/provider/HostLocaleProviderAdapterImpl.java Fri Nov 08 20:41:14 2019 -0500
@@ -1,5 +1,5 @@
/*
- * Copyright (c) 2012, 2016, Oracle and/or its affiliates. All rights reserved.
+ * Copyright (c) 2012, 2019, Oracle and/or its affiliates. All rights reserved.
* DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
*
* This code is free software; you can redistribute it and/or modify it
@@ -33,6 +33,7 @@
import java.text.spi.NumberFormatProvider;
import java.util.Collections;
import java.util.Calendar;
+import java.util.HashMap;
import java.util.HashSet;
import java.util.Locale;
import java.util.Map;
@@ -550,15 +551,33 @@
}
@Override
- public String getDisplayName(String calType, int field, int value,
- int style, Locale locale) {
- return null;
+ public String getDisplayName(String calendarType, int field,
+ int value, int style, Locale locale) {
+ String[] names = getCalendarDisplayStrings(locale.toLanguageTag(),
+ field, style);
+ if (names != null && value >= 0 && value < names.length) {
+ return names[value];
+ } else {
+ return null;
+ }
}
@Override
- public Map<String, Integer> getDisplayNames(String calType,
- int field, int style, Locale locale) {
- return null;
+ public Map<String, Integer> getDisplayNames(String calendarType,
+ int field, int style, Locale locale) {
+ Map<String, Integer> map = null;
+ String[] names = getCalendarDisplayStrings(locale.toLanguageTag(),
+ field, style);
+ if (names != null) {
+ map = new HashMap<>((int)Math.ceil(names.length / 0.75));
+ for (int value = 0; value < names.length; value++) {
+ if (names[value] != null) {
+ map.put(names[value], value);
+ }
+ }
+ map = map.isEmpty() ? null : map;
+ }
+ return map;
}
};
}
@@ -901,6 +920,9 @@
// For CalendarDataProvider
private static native int getCalendarInt(String langTag, int type);
+ // For CalendarNameProvider
+ private static native String[] getCalendarDisplayStrings(String langTag, int field, int style);
+
// For Locale/CurrencyNameProvider
private static native String getDisplayString(String langTag, int key, String value);
--- a/src/java.base/macosx/native/libjava/HostLocaleProviderAdapter_md.c Fri Nov 08 16:48:20 2019 -0500
+++ b/src/java.base/macosx/native/libjava/HostLocaleProviderAdapter_md.c Fri Nov 08 20:41:14 2019 -0500
@@ -1,5 +1,5 @@
/*
- * Copyright (c) 2012, 2013, Oracle and/or its affiliates. All rights reserved.
+ * Copyright (c) 2012, 2019, Oracle and/or its affiliates. All rights reserved.
* DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
*
* This code is free software; you can redistribute it and/or modify it
@@ -30,11 +30,20 @@
#define BUFLEN 256
+// java.util.Calendar constants
+#define CALENDAR_FIELD_ERA 0 // Calendar.ERA
+#define CALENDAR_FIELD_DAY_OF_WEEK 7 // Calendar.DAY_OF_WEEK
+#define CALENDAR_FIELD_AM_PM 9 // Calendar.AM_PM
+#define JAPANESE_MEIJI_INDEX 232
+
static CFDateFormatterStyle convertDateFormatterStyle(jint javaStyle);
static CFNumberFormatterStyle convertNumberFormatterStyle(jint javaStyle);
static void copyArrayElements(JNIEnv *env, CFArrayRef cfarray, jobjectArray jarray, CFIndex sindex, int dindex, int count);
static jstring getNumberSymbolString(JNIEnv *env, jstring jlangtag, jstring jdefault, CFStringRef type);
static jchar getNumberSymbolChar(JNIEnv *env, jstring jlangtag, jchar jdefault, CFStringRef type);
+jobjectArray getErasImpl(JNIEnv *env, jstring jlangtag, jint style, jobjectArray eras);
+jobjectArray getWeekdaysImpl(JNIEnv *env, jclass cls, jstring jlangtag, jint style, jobjectArray wdays);
+jobjectArray getAmPmImpl(JNIEnv *env, jclass cls, jstring jlangtag, jint style, jobjectArray ampms);
// from java_props_macosx.c
extern char * getMacOSXLocale(int cat);
@@ -131,41 +140,7 @@
*/
JNIEXPORT jobjectArray JNICALL Java_sun_util_locale_provider_HostLocaleProviderAdapterImpl_getAmPmStrings
(JNIEnv *env, jclass cls, jstring jlangtag, jobjectArray ampms) {
- CFLocaleRef cflocale = CFLocaleCopyCurrent();
- jstring tmp_string;
- if (cflocale != NULL) {
- CFDateFormatterRef df = CFDateFormatterCreate(kCFAllocatorDefault,
- cflocale,
- kCFDateFormatterFullStyle,
- kCFDateFormatterFullStyle);
- if (df != NULL) {
- char buf[BUFLEN];
- CFStringRef amStr = CFDateFormatterCopyProperty(df, kCFDateFormatterAMSymbol);
- if (amStr != NULL) {
- CFStringGetCString(amStr, buf, BUFLEN, kCFStringEncodingUTF8);
- CFRelease(amStr);
- tmp_string = (*env)->NewStringUTF(env, buf);
- if (tmp_string != NULL) {
- (*env)->SetObjectArrayElement(env, ampms, 0, tmp_string);
- }
- }
- if (!(*env)->ExceptionCheck(env)){
- CFStringRef pmStr = CFDateFormatterCopyProperty(df, kCFDateFormatterPMSymbol);
- if (pmStr != NULL) {
- CFStringGetCString(pmStr, buf, BUFLEN, kCFStringEncodingUTF8);
- CFRelease(pmStr);
- tmp_string = (*env)->NewStringUTF(env, buf);
- if (tmp_string != NULL) {
- (*env)->SetObjectArrayElement(env, ampms, 1, tmp_string);
- }
- }
- }
- CFRelease(df);
- }
- CFRelease(cflocale);
- }
-
- return ampms;
+ return getAmPmImpl(env, cls, jlangtag, 0, ampms);
}
/*
@@ -175,24 +150,7 @@
*/
JNIEXPORT jobjectArray JNICALL Java_sun_util_locale_provider_HostLocaleProviderAdapterImpl_getEras
(JNIEnv *env, jclass cls, jstring jlangtag, jobjectArray eras) {
- CFLocaleRef cflocale = CFLocaleCopyCurrent();
- if (cflocale != NULL) {
- CFDateFormatterRef df = CFDateFormatterCreate(kCFAllocatorDefault,
- cflocale,
- kCFDateFormatterFullStyle,
- kCFDateFormatterFullStyle);
- if (df != NULL) {
- CFArrayRef cferas = CFDateFormatterCopyProperty(df, kCFDateFormatterEraSymbols);
- if (cferas != NULL) {
- copyArrayElements(env, cferas, eras, 0, 0, CFArrayGetCount(cferas));
- CFRelease(cferas);
- }
- CFRelease(df);
- }
- CFRelease(cflocale);
- }
-
- return eras;
+ return getErasImpl(env, jlangtag, 0, eras);
}
/*
@@ -255,25 +213,8 @@
* Signature: (Ljava/lang/String;[Ljava/lang/String;)[Ljava/lang/String;
*/
JNIEXPORT jobjectArray JNICALL Java_sun_util_locale_provider_HostLocaleProviderAdapterImpl_getWeekdays
- (JNIEnv *env, jclass cls, jstring jlangtag, jobjectArray wdays) {
- CFLocaleRef cflocale = CFLocaleCopyCurrent();
- if (cflocale != NULL) {
- CFDateFormatterRef df = CFDateFormatterCreate(kCFAllocatorDefault,
- cflocale,
- kCFDateFormatterFullStyle,
- kCFDateFormatterFullStyle);
- if (df != NULL) {
- CFArrayRef cfwdays = CFDateFormatterCopyProperty(df, kCFDateFormatterWeekdaySymbols);
- if (cfwdays != NULL) {
- copyArrayElements(env, cfwdays, wdays, 0, 1, CFArrayGetCount(cfwdays));
- CFRelease(cfwdays);
- }
- CFRelease(df);
- }
- CFRelease(cflocale);
- }
-
- return wdays;
+ (JNIEnv *env, jclass cls, jstring jlangtag, jobjectArray wdays) {
+ return getWeekdaysImpl(env, cls, jlangtag, 0, wdays);
}
/*
@@ -508,6 +449,29 @@
/*
* Class: sun_util_locale_provider_HostLocaleProviderAdapterImpl
+ * Method: getCalendarDisplayStrings
+ * Signature: (Ljava/lang/String;III)[Ljava/lang/String;
+ */
+JNIEXPORT jobjectArray JNICALL Java_sun_util_locale_provider_HostLocaleProviderAdapterImpl_getCalendarDisplayStrings
+ (JNIEnv *env, jclass cls, jstring jlangtag, jint field, jint style) {
+ switch (field) {
+ case CALENDAR_FIELD_ERA:
+ return getErasImpl(env, jlangtag, style, NULL);
+
+ case CALENDAR_FIELD_DAY_OF_WEEK:
+ return getWeekdaysImpl(env, cls, jlangtag, style, NULL);
+
+ case CALENDAR_FIELD_AM_PM:
+ return getAmPmImpl(env, cls, jlangtag, style, NULL);
+
+ default:
+ // not supported
+ return NULL;
+ }
+}
+
+/*
+ * Class: sun_util_locale_provider_HostLocaleProviderAdapterImpl
* Method: getDisplayString
* Signature: (Ljava/lang/String;ILjava/lang/String;)Ljava/lang/String;
*/
@@ -725,3 +689,104 @@
return ret;
}
+
+jobjectArray getErasImpl(JNIEnv *env, jstring jlangtag, jint style, jobjectArray eras) {
+ jobjectArray ret = eras;
+ CFLocaleRef cflocale = CFLocaleCopyCurrent();
+ if (cflocale != NULL) {
+ CFDateFormatterRef df = CFDateFormatterCreate(kCFAllocatorDefault,
+ cflocale,
+ convertDateFormatterStyle(style),
+ convertDateFormatterStyle(style));
+ if (df != NULL) {
+ CFArrayRef cferas = CFDateFormatterCopyProperty(df, kCFDateFormatterEraSymbols);
+ if (cferas != NULL) {
+ int eraCount = CFArrayGetCount(cferas);
+
+ if (eras == NULL) {
+ ret = (*env)->NewObjectArray(env, (jsize)eraCount,
+ (*env)->FindClass(env, "java/lang/String"), NULL);
+ }
+ CFTypeRef cal = CFLocaleGetValue(cflocale, kCFLocaleCalendarIdentifier);
+ int sindex = cal == kCFJapaneseCalendar ? JAPANESE_MEIJI_INDEX : 0;
+ int dindex = cal == kCFJapaneseCalendar ? 1 : 0; // 0 is "BeforeMeiji" in JCal
+ copyArrayElements(env, cferas, ret, sindex, dindex, eraCount - sindex);
+ CFRelease(cferas);
+ }
+ CFRelease(df);
+ }
+ CFRelease(cflocale);
+ }
+
+ return ret;
+}
+
+jobjectArray getWeekdaysImpl(JNIEnv *env, jclass cls, jstring jlangtag, jint style, jobjectArray wdays) {
+ jobjectArray ret = wdays;
+ CFLocaleRef cflocale = CFLocaleCopyCurrent();
+ if (cflocale != NULL) {
+ CFDateFormatterRef df = CFDateFormatterCreate(kCFAllocatorDefault,
+ cflocale,
+ convertDateFormatterStyle(style),
+ convertDateFormatterStyle(style));
+ if (df != NULL) {
+ CFArrayRef cfwdays = CFDateFormatterCopyProperty(df, kCFDateFormatterWeekdaySymbols);
+ if (cfwdays != NULL) {
+ int dayCount = CFArrayGetCount(cfwdays);
+
+ if (wdays == NULL) {
+ ret = (*env)->NewObjectArray(env, dayCount + 1,
+ (*env)->FindClass(env, "java/lang/String"), NULL);
+ }
+ copyArrayElements(env, cfwdays, ret, 0, 1, dayCount);
+ CFRelease(cfwdays);
+ }
+ CFRelease(df);
+ }
+ CFRelease(cflocale);
+ }
+
+ return ret;
+}
+
+jobjectArray getAmPmImpl(JNIEnv *env, jclass cls, jstring jlangtag, jint style, jobjectArray ampms) {
+ CFLocaleRef cflocale = CFLocaleCopyCurrent();
+ jstring tmp_string;
+ if (cflocale != NULL) {
+ CFDateFormatterRef df = CFDateFormatterCreate(kCFAllocatorDefault,
+ cflocale,
+ convertDateFormatterStyle(style),
+ convertDateFormatterStyle(style));
+ if (df != NULL) {
+ char buf[BUFLEN];
+ if (ampms == NULL) {
+ ampms = (*env)->NewObjectArray(env, 2,
+ (*env)->FindClass(env, "java/lang/String"), NULL);
+ }
+ CFStringRef amStr = CFDateFormatterCopyProperty(df, kCFDateFormatterAMSymbol);
+ if (amStr != NULL) {
+ CFStringGetCString(amStr, buf, BUFLEN, kCFStringEncodingUTF8);
+ CFRelease(amStr);
+ tmp_string = (*env)->NewStringUTF(env, buf);
+ if (tmp_string != NULL) {
+ (*env)->SetObjectArrayElement(env, ampms, 0, tmp_string);
+ }
+ }
+ if (!(*env)->ExceptionCheck(env)){
+ CFStringRef pmStr = CFDateFormatterCopyProperty(df, kCFDateFormatterPMSymbol);
+ if (pmStr != NULL) {
+ CFStringGetCString(pmStr, buf, BUFLEN, kCFStringEncodingUTF8);
+ CFRelease(pmStr);
+ tmp_string = (*env)->NewStringUTF(env, buf);
+ if (tmp_string != NULL) {
+ (*env)->SetObjectArrayElement(env, ampms, 1, tmp_string);
+ }
+ }
+ }
+ CFRelease(df);
+ }
+ CFRelease(cflocale);
+ }
+
+ return ampms;
+}
--- a/src/java.base/share/classes/java/lang/Class.java Fri Nov 08 16:48:20 2019 -0500
+++ b/src/java.base/share/classes/java/lang/Class.java Fri Nov 08 20:41:14 2019 -0500
@@ -392,10 +392,6 @@
*
* @see java.lang.Class#forName(String)
* @see java.lang.ClassLoader
- *
- * @jls 12.2 Loading of Classes and Interfaces
- * @jls 12.3 Linking of Classes and Interfaces
- * @jls 12.4 Initialization of Classes and Interfaces
* @since 1.2
*/
@CallerSensitive
@@ -442,10 +438,6 @@
* <p> This method does not check whether the requested class is
* accessible to its caller. </p>
*
- * <p> Note that this method throws errors related to loading and linking as
- * specified in Sections 12.2 and 12.3 of <em>The Java Language
- * Specification</em>.
- *
* @apiNote
* This method returns {@code null} on failure rather than
* throwing a {@link ClassNotFoundException}, as is done by
@@ -473,8 +465,6 @@
* in a module.</li>
* </ul>
*
- * @jls 12.2 Loading of Classes and Interfaces
- * @jls 12.3 Linking of Classes and Interfaces
* @since 9
* @spec JPMS
*/
@@ -498,21 +488,13 @@
cl = module.getClassLoader();
}
- Class<?> ret;
if (cl != null) {
- ret = cl.loadClass(module, name);
+ return cl.loadClass(module, name);
} else {
- ret = BootLoader.loadClass(module, name);
+ return BootLoader.loadClass(module, name);
}
- if (ret != null) {
- // The loaded class should also be linked
- linkClass(ret);
- }
- return ret;
}
- private static native void linkClass(Class<?> c);
-
/**
* Creates a new instance of the class represented by this {@code Class}
* object. The class is instantiated as if by a {@code new}
--- a/src/java.base/share/classes/java/lang/Math.java Fri Nov 08 16:48:20 2019 -0500
+++ b/src/java.base/share/classes/java/lang/Math.java Fri Nov 08 20:41:14 2019 -0500
@@ -1259,16 +1259,17 @@
* Examples:
* <ul>
* <li>If the signs of the arguments are the same, the results
- * of {@code floorMod} and the {@code %} operator are the same. <br>
+ * of {@code floorMod} and the {@code %} operator are the same.<br>
* <ul>
- * <li>{@code floorMod(4, 3) == 1}; and {@code (4 % 3) == 1}</li>
+ * <li>{@code floorMod(+4, +3) == +1}; and {@code (+4 % +3) == +1}</li>
+ * <li>{@code floorMod(-4, -3) == -1}; and {@code (-4 % -3) == -1}</li>
* </ul>
- * <li>If the signs of the arguments are different, the results differ from the {@code %} operator.<br>
- * <ul>
- * <li>{@code floorMod(+4, -3) == -2}; and {@code (+4 % -3) == +1} </li>
- * <li>{@code floorMod(-4, +3) == +2}; and {@code (-4 % +3) == -1} </li>
- * <li>{@code floorMod(-4, -3) == -1}; and {@code (-4 % -3) == -1 } </li>
- * </ul>
+ * <li>If the signs of the arguments are different, the results
+ * differ from the {@code %} operator.<br>
+ * <ul>
+ * <li>{@code floorMod(+4, -3) == -2}; and {@code (+4 % -3) == +1}</li>
+ * <li>{@code floorMod(-4, +3) == +2}; and {@code (-4 % +3) == -1}</li>
+ * </ul>
* </li>
* </ul>
* <p>
--- a/src/java.base/share/classes/java/lang/Runtime.java Fri Nov 08 16:48:20 2019 -0500
+++ b/src/java.base/share/classes/java/lang/Runtime.java Fri Nov 08 20:41:14 2019 -0500
@@ -896,7 +896,7 @@
* <blockquote><pre>
* $VNUM(-$PRE)?\+$BUILD(-$OPT)?
* $VNUM-$PRE(-$OPT)?
- * $VNUM(+-$OPT)?
+ * $VNUM(\+-$OPT)?
* </pre></blockquote>
*
* <p> where: </p>
--- a/src/java.base/share/classes/java/lang/invoke/MethodHandles.java Fri Nov 08 16:48:20 2019 -0500
+++ b/src/java.base/share/classes/java/lang/invoke/MethodHandles.java Fri Nov 08 20:41:14 2019 -0500
@@ -1933,17 +1933,12 @@
}
/**
- * Looks up a class by name from the lookup context defined by this {@code Lookup} object.
- * This method attempts to locate, load, and link the class, and then determines whether
- * the class is accessible to this {@code Lookup} object. The static
+ * Looks up a class by name from the lookup context defined by this {@code Lookup} object. The static
* initializer of the class is not run.
* <p>
* The lookup context here is determined by the {@linkplain #lookupClass() lookup class}, its class
- * loader, and the {@linkplain #lookupModes() lookup modes}.
- * <p>
- * Note that this method throws errors related to loading and linking as
- * specified in Sections 12.2 and 12.3 of <em>The Java Language
- * Specification</em>.
+ * loader, and the {@linkplain #lookupModes() lookup modes}. In particular, the method first attempts to
+ * load the requested class, and then determines whether the class is accessible to this lookup object.
*
* @param targetName the fully qualified name of the class to be looked up.
* @return the requested class.
@@ -1955,9 +1950,6 @@
* modes.
* @throws SecurityException if a security manager is present and it
* <a href="MethodHandles.Lookup.html#secmgr">refuses access</a>
- *
- * @jls 12.2 Loading of Classes and Interfaces
- * @jls 12.3 Linking of Classes and Interfaces
* @since 9
*/
public Class<?> findClass(String targetName) throws ClassNotFoundException, IllegalAccessException {
--- a/src/java.base/share/classes/sun/launcher/LauncherHelper.java Fri Nov 08 16:48:20 2019 -0500
+++ b/src/java.base/share/classes/sun/launcher/LauncherHelper.java Fri Nov 08 20:41:14 2019 -0500
@@ -62,7 +62,6 @@
import java.nio.file.DirectoryStream;
import java.nio.file.Files;
import java.nio.file.Path;
-import java.security.AccessControlException;
import java.text.Normalizer;
import java.text.MessageFormat;
import java.util.ArrayList;
@@ -725,9 +724,6 @@
} catch (LinkageError le) {
abort(null, "java.launcher.module.error3", mainClass, m.getName(),
le.getClass().getName() + ": " + le.getLocalizedMessage());
- } catch (AccessControlException ace) {
- abort(ace, "java.launcher.module.error5", mainClass, m.getName(),
- ace.getClass().getName(), ace.getLocalizedMessage());
}
if (c == null) {
abort(null, "java.launcher.module.error2", mainClass, mainModule);
@@ -784,9 +780,6 @@
} catch (LinkageError le) {
abort(le, "java.launcher.cls.error6", cn,
le.getClass().getName() + ": " + le.getLocalizedMessage());
- } catch (AccessControlException ace) {
- abort(ace, "java.launcher.cls.error7", cn,
- ace.getClass().getName(), ace.getLocalizedMessage());
}
return mainClass;
}
--- a/src/java.base/share/classes/sun/security/ssl/CertificateVerify.java Fri Nov 08 16:48:20 2019 -0500
+++ b/src/java.base/share/classes/sun/security/ssl/CertificateVerify.java Fri Nov 08 20:41:14 2019 -0500
@@ -31,6 +31,7 @@
import java.text.MessageFormat;
import java.util.Arrays;
import java.util.Locale;
+import java.util.Map;
import sun.security.ssl.SSLHandshake.HandshakeMessage;
import sun.security.ssl.X509Authentication.X509Credentials;
import sun.security.ssl.X509Authentication.X509Possession;
@@ -563,31 +564,28 @@
// This happens in client side only.
ClientHandshakeContext chc = (ClientHandshakeContext)context;
- this.signatureScheme = SignatureScheme.getPreferableAlgorithm(
+ Map.Entry<SignatureScheme, Signature> schemeAndSigner =
+ SignatureScheme.getSignerOfPreferableAlgorithm(
chc.algorithmConstraints,
chc.peerRequestedSignatureSchemes,
x509Possession,
chc.negotiatedProtocol);
- if (signatureScheme == null) {
+ if (schemeAndSigner == null) {
// Unlikely, the credentials generator should have
// selected the preferable signature algorithm properly.
throw chc.conContext.fatal(Alert.INTERNAL_ERROR,
- "No preferred signature algorithm for CertificateVerify");
+ "No supported CertificateVerify signature algorithm for " +
+ x509Possession.popPrivateKey.getAlgorithm() +
+ " key");
}
+ this.signatureScheme = schemeAndSigner.getKey();
byte[] temproary = null;
try {
- Signature signer =
- signatureScheme.getSignature(x509Possession.popPrivateKey);
+ Signature signer = schemeAndSigner.getValue();
signer.update(chc.handshakeHash.archived());
temproary = signer.sign();
- } catch (NoSuchAlgorithmException |
- InvalidAlgorithmParameterException nsae) {
- throw chc.conContext.fatal(Alert.INTERNAL_ERROR,
- "Unsupported signature algorithm (" +
- signatureScheme.name +
- ") used in CertificateVerify handshake message", nsae);
- } catch (InvalidKeyException | SignatureException ikse) {
+ } catch (SignatureException ikse) {
throw chc.conContext.fatal(Alert.HANDSHAKE_FAILURE,
"Cannot produce CertificateVerify signature", ikse);
}
@@ -647,7 +645,7 @@
this.signature = Record.getBytes16(m);
try {
Signature signer =
- signatureScheme.getSignature(x509Credentials.popPublicKey);
+ signatureScheme.getVerifier(x509Credentials.popPublicKey);
signer.update(shc.handshakeHash.archived());
if (!signer.verify(signature)) {
throw shc.conContext.fatal(Alert.HANDSHAKE_FAILURE,
@@ -865,18 +863,23 @@
X509Possession x509Possession) throws IOException {
super(context);
- this.signatureScheme = SignatureScheme.getPreferableAlgorithm(
+ Map.Entry<SignatureScheme, Signature> schemeAndSigner =
+ SignatureScheme.getSignerOfPreferableAlgorithm(
context.algorithmConstraints,
context.peerRequestedSignatureSchemes,
x509Possession,
context.negotiatedProtocol);
- if (signatureScheme == null) {
+ if (schemeAndSigner == null) {
// Unlikely, the credentials generator should have
// selected the preferable signature algorithm properly.
throw context.conContext.fatal(Alert.INTERNAL_ERROR,
- "No preferred signature algorithm for CertificateVerify");
+ "No supported CertificateVerify signature algorithm for " +
+ x509Possession.popPrivateKey.getAlgorithm() +
+ " key");
}
+ this.signatureScheme = schemeAndSigner.getKey();
+
byte[] hashValue = context.handshakeHash.digest();
byte[] contentCovered;
if (context.sslConfig.isClientMode) {
@@ -893,17 +896,10 @@
byte[] temproary = null;
try {
- Signature signer =
- signatureScheme.getSignature(x509Possession.popPrivateKey);
+ Signature signer = schemeAndSigner.getValue();
signer.update(contentCovered);
temproary = signer.sign();
- } catch (NoSuchAlgorithmException |
- InvalidAlgorithmParameterException nsae) {
- throw context.conContext.fatal(Alert.INTERNAL_ERROR,
- "Unsupported signature algorithm (" +
- signatureScheme.name +
- ") used in CertificateVerify handshake message", nsae);
- } catch (InvalidKeyException | SignatureException ikse) {
+ } catch (SignatureException ikse) {
throw context.conContext.fatal(Alert.HANDSHAKE_FAILURE,
"Cannot produce CertificateVerify signature", ikse);
}
@@ -974,7 +970,7 @@
try {
Signature signer =
- signatureScheme.getSignature(x509Credentials.popPublicKey);
+ signatureScheme.getVerifier(x509Credentials.popPublicKey);
signer.update(contentCovered);
if (!signer.verify(signature)) {
throw context.conContext.fatal(Alert.HANDSHAKE_FAILURE,
--- a/src/java.base/share/classes/sun/security/ssl/DHServerKeyExchange.java Fri Nov 08 16:48:20 2019 -0500
+++ b/src/java.base/share/classes/sun/security/ssl/DHServerKeyExchange.java Fri Nov 08 20:41:14 2019 -0500
@@ -42,6 +42,7 @@
import java.text.MessageFormat;
import java.util.EnumSet;
import java.util.Locale;
+import java.util.Map;
import javax.crypto.interfaces.DHPublicKey;
import javax.crypto.spec.DHParameterSpec;
import javax.crypto.spec.DHPublicKeySpec;
@@ -124,25 +125,22 @@
shc.negotiatedProtocol.useTLS12PlusSpec();
Signature signer = null;
if (useExplicitSigAlgorithm) {
- signatureScheme = SignatureScheme.getPreferableAlgorithm(
- shc.algorithmConstraints,
- shc.peerRequestedSignatureSchemes,
- x509Possession,
- shc.negotiatedProtocol);
- if (signatureScheme == null) {
+ Map.Entry<SignatureScheme, Signature> schemeAndSigner =
+ SignatureScheme.getSignerOfPreferableAlgorithm(
+ shc.algorithmConstraints,
+ shc.peerRequestedSignatureSchemes,
+ x509Possession,
+ shc.negotiatedProtocol);
+ if (schemeAndSigner == null) {
// Unlikely, the credentials generator should have
// selected the preferable signature algorithm properly.
throw shc.conContext.fatal(Alert.INTERNAL_ERROR,
- "No preferred signature algorithm");
- }
- try {
- signer = signatureScheme.getSignature(
- x509Possession.popPrivateKey);
- } catch (NoSuchAlgorithmException | InvalidKeyException |
- InvalidAlgorithmParameterException nsae) {
- throw shc.conContext.fatal(Alert.INTERNAL_ERROR,
- "Unsupported signature algorithm: " +
- signatureScheme.name, nsae);
+ "No supported signature algorithm for " +
+ x509Possession.popPrivateKey.getAlgorithm() +
+ " key");
+ } else {
+ signatureScheme = schemeAndSigner.getKey();
+ signer = schemeAndSigner.getValue();
}
} else {
signatureScheme = null;
@@ -241,7 +239,7 @@
Signature signer;
if (useExplicitSigAlgorithm) {
try {
- signer = signatureScheme.getSignature(
+ signer = signatureScheme.getVerifier(
x509Credentials.popPublicKey);
} catch (NoSuchAlgorithmException | InvalidKeyException |
InvalidAlgorithmParameterException nsae) {
--- a/src/java.base/share/classes/sun/security/ssl/ECDHServerKeyExchange.java Fri Nov 08 16:48:20 2019 -0500
+++ b/src/java.base/share/classes/sun/security/ssl/ECDHServerKeyExchange.java Fri Nov 08 20:41:14 2019 -0500
@@ -38,7 +38,7 @@
import java.security.SignatureException;
import java.text.MessageFormat;
import java.util.Locale;
-import sun.security.ssl.NamedGroup.NamedGroupSpec;
+import java.util.Map;
import sun.security.ssl.SSLHandshake.HandshakeMessage;
import sun.security.ssl.SupportedGroupsExtension.SupportedGroups;
import sun.security.ssl.X509Authentication.X509Credentials;
@@ -135,27 +135,22 @@
shc.negotiatedProtocol.useTLS12PlusSpec();
Signature signer = null;
if (useExplicitSigAlgorithm) {
- signatureScheme = SignatureScheme.getPreferableAlgorithm(
- shc.algorithmConstraints,
- shc.peerRequestedSignatureSchemes,
- x509Possession,
- shc.negotiatedProtocol);
- if (signatureScheme == null) {
+ Map.Entry<SignatureScheme, Signature> schemeAndSigner =
+ SignatureScheme.getSignerOfPreferableAlgorithm(
+ shc.algorithmConstraints,
+ shc.peerRequestedSignatureSchemes,
+ x509Possession,
+ shc.negotiatedProtocol);
+ if (schemeAndSigner == null) {
// Unlikely, the credentials generator should have
// selected the preferable signature algorithm properly.
throw shc.conContext.fatal(Alert.INTERNAL_ERROR,
- "No preferred signature algorithm for " +
+ "No supported signature algorithm for " +
x509Possession.popPrivateKey.getAlgorithm() +
" key");
- }
- try {
- signer = signatureScheme.getSignature(
- x509Possession.popPrivateKey);
- } catch (NoSuchAlgorithmException | InvalidKeyException |
- InvalidAlgorithmParameterException nsae) {
- throw shc.conContext.fatal(Alert.INTERNAL_ERROR,
- "Unsupported signature algorithm: " +
- signatureScheme.name, nsae);
+ } else {
+ signatureScheme = schemeAndSigner.getKey();
+ signer = schemeAndSigner.getValue();
}
} else {
signatureScheme = null;
@@ -276,7 +271,7 @@
Signature signer;
if (useExplicitSigAlgorithm) {
try {
- signer = signatureScheme.getSignature(
+ signer = signatureScheme.getVerifier(
x509Credentials.popPublicKey);
} catch (NoSuchAlgorithmException | InvalidKeyException |
InvalidAlgorithmParameterException nsae) {
--- a/src/java.base/share/classes/sun/security/ssl/SignatureScheme.java Fri Nov 08 16:48:20 2019 -0500
+++ b/src/java.base/share/classes/sun/security/ssl/SignatureScheme.java Fri Nov 08 20:41:14 2019 -0500
@@ -30,6 +30,7 @@
import java.security.spec.ECParameterSpec;
import java.security.spec.MGF1ParameterSpec;
import java.security.spec.PSSParameterSpec;
+import java.util.AbstractMap.SimpleImmutableEntry;
import java.util.ArrayList;
import java.util.Arrays;
import java.util.Collection;
@@ -37,6 +38,7 @@
import java.util.EnumSet;
import java.util.LinkedList;
import java.util.List;
+import java.util.Map;
import java.util.Set;
import sun.security.ssl.NamedGroup.NamedGroupSpec;
import sun.security.ssl.SupportedGroupsExtension.SupportedGroups;
@@ -425,7 +427,7 @@
return null;
}
- static SignatureScheme getPreferableAlgorithm(
+ static Map.Entry<SignatureScheme, Signature> getSignerOfPreferableAlgorithm(
AlgorithmConstraints constraints,
List<SignatureScheme> schemes,
X509Possession x509Possession,
@@ -452,7 +454,10 @@
x509Possession.getECParameterSpec();
if (params != null &&
ss.namedGroup == NamedGroup.valueOf(params)) {
- return ss;
+ Signature signer = ss.getSigner(signingKey);
+ if (signer != null) {
+ return new SimpleImmutableEntry<>(ss, signer);
+ }
}
if (SSLLogger.isOn &&
@@ -477,7 +482,10 @@
NamedGroup keyGroup = NamedGroup.valueOf(params);
if (keyGroup != null &&
SupportedGroups.isSupported(keyGroup)) {
- return ss;
+ Signature signer = ss.getSigner(signingKey);
+ if (signer != null) {
+ return new SimpleImmutableEntry<>(ss, signer);
+ }
}
}
@@ -488,7 +496,10 @@
"), unsupported EC parameter spec: " + params);
}
} else {
- return ss;
+ Signature signer = ss.getSigner(signingKey);
+ if (signer != null) {
+ return new SimpleImmutableEntry<>(ss, signer);
+ }
}
}
}
@@ -509,24 +520,49 @@
return new String[0];
}
- Signature getSignature(Key key) throws NoSuchAlgorithmException,
+ // This method is used to get the signature instance of this signature
+ // scheme for the specific public key. Unlike getSigner(), the exception
+ // is bubbled up. If the public key does not support this signature
+ // scheme, it normally means the TLS handshaking cannot continue and
+ // the connection should be terminated.
+ Signature getVerifier(PublicKey publicKey) throws NoSuchAlgorithmException,
InvalidAlgorithmParameterException, InvalidKeyException {
if (!isAvailable) {
return null;
}
- Signature signer = Signature.getInstance(algorithm);
- if (key instanceof PublicKey) {
- SignatureUtil.initVerifyWithParam(signer, (PublicKey)key,
- (signAlgParams != null ?
- signAlgParams.parameterSpec : null));
- } else {
- SignatureUtil.initSignWithParam(signer, (PrivateKey)key,
- (signAlgParams != null ?
- signAlgParams.parameterSpec : null),
- null);
+ Signature verifier = Signature.getInstance(algorithm);
+ SignatureUtil.initVerifyWithParam(verifier, publicKey,
+ (signAlgParams != null ? signAlgParams.parameterSpec : null));
+
+ return verifier;
+ }
+
+ // This method is also used to choose preferable signature scheme for the
+ // specific private key. If the private key does not support the signature
+ // scheme, {@code null} is returned, and the caller may fail back to next
+ // available signature scheme.
+ private Signature getSigner(PrivateKey privateKey) {
+ if (!isAvailable) {
+ return null;
}
- return signer;
+ try {
+ Signature signer = Signature.getInstance(algorithm);
+ SignatureUtil.initSignWithParam(signer, privateKey,
+ (signAlgParams != null ? signAlgParams.parameterSpec : null),
+ null);
+ return signer;
+ } catch (NoSuchAlgorithmException | InvalidKeyException |
+ InvalidAlgorithmParameterException nsae) {
+ if (SSLLogger.isOn &&
+ SSLLogger.isOn("ssl,handshake,verbose")) {
+ SSLLogger.finest(
+ "Ignore unsupported signature algorithm (" +
+ this.name + ")", nsae);
+ }
+ }
+
+ return null;
}
}
--- a/src/java.base/share/native/libjava/Class.c Fri Nov 08 16:48:20 2019 -0500
+++ b/src/java.base/share/native/libjava/Class.c Fri Nov 08 20:41:14 2019 -0500
@@ -73,7 +73,6 @@
{"getRawTypeAnnotations", "()" BA, (void *)&JVM_GetClassTypeAnnotations},
{"getNestHost0", "()" CLS, (void *)&JVM_GetNestHost},
{"getNestMembers0", "()[" CLS, (void *)&JVM_GetNestMembers},
- {"linkClass", "(" CLS ")V", (void *)&JVM_LinkClass},
};
#undef OBJ
--- a/src/jdk.hotspot.agent/share/classes/sun/jvm/hotspot/gc/g1/G1CollectedHeap.java Fri Nov 08 16:48:20 2019 -0500
+++ b/src/jdk.hotspot.agent/share/classes/sun/jvm/hotspot/gc/g1/G1CollectedHeap.java Fri Nov 08 20:41:14 2019 -0500
@@ -30,11 +30,11 @@
import java.util.Observer;
import sun.jvm.hotspot.debugger.Address;
+import sun.jvm.hotspot.gc.g1.HeapRegionClosure;
+import sun.jvm.hotspot.gc.g1.PrintRegionClosure;
import sun.jvm.hotspot.gc.shared.CollectedHeap;
import sun.jvm.hotspot.gc.shared.CollectedHeapName;
import sun.jvm.hotspot.gc.shared.LiveRegionsClosure;
-import sun.jvm.hotspot.gc.shared.PrintRegionClosure;
-import sun.jvm.hotspot.gc.shared.SpaceClosure;
import sun.jvm.hotspot.memory.MemRegion;
import sun.jvm.hotspot.runtime.VM;
import sun.jvm.hotspot.runtime.VMObjectFactory;
@@ -126,11 +126,11 @@
return hrm().heapRegionIterator();
}
- public void heapRegionIterate(SpaceClosure scl) {
+ public void heapRegionIterate(HeapRegionClosure hrcl) {
Iterator<HeapRegion> iter = heapRegionIterator();
while (iter.hasNext()) {
HeapRegion hr = iter.next();
- scl.doSpace(hr);
+ hrcl.doHeapRegion(hr);
}
}
--- a/src/jdk.hotspot.agent/share/classes/sun/jvm/hotspot/gc/g1/HeapRegion.java Fri Nov 08 16:48:20 2019 -0500
+++ b/src/jdk.hotspot.agent/share/classes/sun/jvm/hotspot/gc/g1/HeapRegion.java Fri Nov 08 20:41:14 2019 -0500
@@ -45,9 +45,12 @@
// any of its fields but only iterate over it.
public class HeapRegion extends CompactibleSpace implements LiveRegionsProvider {
- // static int GrainBytes;
+ private static AddressField bottomField;
+ static private AddressField topField;
+ private static AddressField endField;
+ private static AddressField compactionTopField;
+
static private CIntegerField grainBytesField;
- static private AddressField topField;
private static long typeFieldOffset;
private static long pointerSize;
@@ -64,8 +67,12 @@
static private synchronized void initialize(TypeDataBase db) {
Type type = db.lookupType("HeapRegion");
+ bottomField = type.getAddressField("_bottom");
+ topField = type.getAddressField("_top");
+ endField = type.getAddressField("_end");
+ compactionTopField = type.getAddressField("_compaction_top");
+
grainBytesField = type.getCIntegerField("GrainBytes");
- topField = type.getAddressField("_top");
typeFieldOffset = type.getField("_type").getOffset();
pointerSize = db.lookupType("HeapRegion*").getSize();
@@ -82,9 +89,11 @@
type = (HeapRegionType)VMObjectFactory.newObject(HeapRegionType.class, typeAddr);
}
- public Address top() {
- return topField.getValue(addr);
- }
+ public Address bottom() { return bottomField.getValue(addr); }
+ public Address top() { return topField.getValue(addr); }
+ public Address end() { return endField.getValue(addr); }
+
+ public Address compactionTop() { return compactionTopField.getValue(addr); }
@Override
public List<MemRegion> getLiveRegions() {
@@ -93,12 +102,16 @@
return res;
}
- @Override
+ /** Returns a subregion of the space containing all the objects in
+ the space. */
+ public MemRegion usedRegion() {
+ return new MemRegion(bottom(), end());
+ }
+
public long used() {
return top().minus(bottom());
}
- @Override
public long free() {
return end().minus(top());
}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/src/jdk.hotspot.agent/share/classes/sun/jvm/hotspot/gc/g1/HeapRegionClosure.java Fri Nov 08 20:41:14 2019 -0500
@@ -0,0 +1,29 @@
+/*
+ * Copyright (c) 2019, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+package sun.jvm.hotspot.gc.g1;
+
+public interface HeapRegionClosure {
+ public void doHeapRegion(HeapRegion hr);
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/src/jdk.hotspot.agent/share/classes/sun/jvm/hotspot/gc/g1/PrintRegionClosure.java Fri Nov 08 20:41:14 2019 -0500
@@ -0,0 +1,40 @@
+/*
+ * Copyright (c) 2018, 2019, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+package sun.jvm.hotspot.gc.g1;
+
+import java.io.PrintStream;
+import sun.jvm.hotspot.gc.g1.HeapRegion;
+
+public class PrintRegionClosure implements HeapRegionClosure {
+ private PrintStream tty;
+
+ public PrintRegionClosure(PrintStream tty) {
+ this.tty = tty;
+ }
+
+ public void doHeapRegion(HeapRegion hr) {
+ hr.printOn(tty);
+ }
+}
--- a/src/jdk.hotspot.agent/share/classes/sun/jvm/hotspot/gc/shared/PrintRegionClosure.java Fri Nov 08 16:48:20 2019 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,40 +0,0 @@
-/*
- * Copyright (c) 2018, Oracle and/or its affiliates. All rights reserved.
- * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
- *
- * This code is free software; you can redistribute it and/or modify it
- * under the terms of the GNU General Public License version 2 only, as
- * published by the Free Software Foundation.
- *
- * This code is distributed in the hope that it will be useful, but WITHOUT
- * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
- * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
- * version 2 for more details (a copy is included in the LICENSE file that
- * accompanied this code).
- *
- * You should have received a copy of the GNU General Public License version
- * 2 along with this work; if not, write to the Free Software Foundation,
- * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
- *
- * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
- * or visit www.oracle.com if you need additional information or have any
- * questions.
- *
- */
-
-package sun.jvm.hotspot.gc.shared;
-
-import java.io.PrintStream;
-import sun.jvm.hotspot.gc.g1.HeapRegion;
-
-public class PrintRegionClosure implements SpaceClosure {
- private PrintStream tty;
-
- public PrintRegionClosure(PrintStream tty) {
- this.tty = tty;
- }
-
- public void doSpace(Space hr) {
- ((HeapRegion)hr).printOn(tty);
- }
-}
--- a/src/jdk.scripting.nashorn/share/legal/double-conversion.md Fri Nov 08 16:48:20 2019 -0500
+++ b/src/jdk.scripting.nashorn/share/legal/double-conversion.md Fri Nov 08 20:41:14 2019 -0500
@@ -1,4 +1,4 @@
-## Double-conversion v1.1.5
+## Double-conversion v3.1.5
### Double-conversion License
--- a/test/hotspot/gtest/gc/g1/test_g1HeapVerifier.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/gtest/gc/g1/test_g1HeapVerifier.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -26,6 +26,7 @@
#include "gc/g1/g1Arguments.hpp"
#include "gc/g1/g1HeapVerifier.hpp"
#include "logging/logConfiguration.hpp"
+#include "logging/logTag.hpp"
#include "logging/logTestFixture.hpp"
#include "unittest.hpp"
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/gtest/utilities/test_java_arithmetic.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -0,0 +1,346 @@
+/*
+ * Copyright (c) 2019, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+#include "precompiled.hpp"
+#include "memory/allocation.hpp"
+#include "utilities/globalDefinitions.hpp"
+#include "unittest.hpp"
+
+class TestJavaArithSupport : public AllStatic {
+public:
+ template<typename T> struct BinOpData { T x; T y; T r; };
+ template<typename T> struct ShiftOpData { T x; jint shift; T r; };
+};
+
+typedef TestJavaArithSupport::BinOpData<jint> BinOpJintData;
+typedef TestJavaArithSupport::BinOpData<jlong> BinOpJlongData;
+
+typedef TestJavaArithSupport::ShiftOpData<jint> ShiftOpJintData;
+typedef TestJavaArithSupport::ShiftOpData<jlong> ShiftOpJlongData;
+
+const BinOpJintData add_jint_data[] = {
+ { 0, 0, 0 },
+ { 0, 1, 1 },
+ { 0, -1, -1 },
+ { max_jint, 1, min_jint },
+ { max_jint, -1, max_jint - 1 },
+ { min_jint, 1, min_jint + 1 },
+ { min_jint, -1, max_jint },
+ { max_jint, 10, min_jint + 9 },
+ { max_jint, -10, max_jint - 10 },
+ { min_jint, 10, min_jint + 10 },
+ { min_jint, -10, max_jint - 9 },
+ { max_jint, max_jint, -2 },
+ { min_jint, min_jint, 0 }
+};
+
+const BinOpJlongData add_jlong_data[] = {
+ { 0, 0, 0 },
+ { 0, 1, 1 },
+ { 0, -1, -1 },
+ { max_jlong, 1, min_jlong },
+ { max_jlong, -1, max_jlong - 1 },
+ { min_jlong, 1, min_jlong + 1 },
+ { min_jlong, -1, max_jlong },
+ { max_jlong, 10, min_jlong + 9 },
+ { max_jlong, -10, max_jlong - 10 },
+ { min_jlong, 10, min_jlong + 10 },
+ { min_jlong, -10, max_jlong - 9 },
+ { max_jlong, max_jlong, -2 },
+ { min_jlong, min_jlong, 0 }
+};
+
+TEST(TestJavaArithmetic, add_sub_jint) {
+ const volatile BinOpJintData* data = add_jint_data;
+ for (size_t i = 0; i < ARRAY_SIZE(add_jint_data); ++i) {
+ ASSERT_EQ(data[i].r, java_add(data[i].x, data[i].y));
+ ASSERT_EQ(data[i].r, java_add(data[i].y, data[i].x));
+ ASSERT_EQ(data[i].x, java_subtract(data[i].r, data[i].y));
+ ASSERT_EQ(data[i].y, java_subtract(data[i].r, data[i].x));
+ }
+}
+
+TEST(TestJavaArithmetic, add_sub_jlong) {
+ const volatile BinOpJlongData* data = add_jlong_data;
+ for (size_t i = 0; i < ARRAY_SIZE(add_jlong_data); ++i) {
+ ASSERT_EQ(data[i].r, java_add(data[i].x, data[i].y));
+ ASSERT_EQ(data[i].r, java_add(data[i].y, data[i].x));
+ ASSERT_EQ(data[i].x, java_subtract(data[i].r, data[i].y));
+ ASSERT_EQ(data[i].y, java_subtract(data[i].r, data[i].x));
+ }
+}
+
+static const BinOpJintData mul_jint_data[] = {
+ { 0, 0, 0 },
+ { 0, 1, 0 },
+ { 0, max_jint, 0 },
+ { 0, min_jint, 0 },
+ { 1, 1, 1 },
+ { 1, max_jint, max_jint },
+ { 1, min_jint, min_jint },
+ { -1, 1, -1 },
+ { -1, max_jint, min_jint + 1 },
+ { 5, max_jint, max_jint - 4 },
+ { -5, max_jint, min_jint + 5 },
+ { max_jint, max_jint, 1 },
+ { max_jint, min_jint, min_jint },
+ { min_jint, min_jint, 0 }
+};
+
+static const BinOpJlongData mul_jlong_data[] = {
+ { 0, 0, 0 },
+ { 0, 1, 0 },
+ { 0, max_jlong, 0 },
+ { 0, min_jlong, 0 },
+ { 1, 1, 1 },
+ { 1, max_jlong, max_jlong },
+ { 1, min_jlong, min_jlong },
+ { -1, 1, -1 },
+ { -1, max_jlong, min_jlong + 1 },
+ { 5, max_jlong, max_jlong - 4 },
+ { -5, max_jlong, min_jlong + 5 },
+ { max_jlong, max_jlong, 1 },
+ { max_jlong, min_jlong, min_jlong },
+ { min_jlong, min_jlong, 0 }
+};
+
+TEST(TestJavaArithmetic, mul_jint) {
+ const volatile BinOpJintData* data = mul_jint_data;
+ for (size_t i = 0; i < ARRAY_SIZE(mul_jint_data); ++i) {
+ ASSERT_EQ(data[i].r, java_multiply(data[i].x, data[i].y));
+ ASSERT_EQ(data[i].r, java_multiply(data[i].y, data[i].x));
+ }
+}
+
+TEST(TestJavaArithmetic, mul_jlong) {
+ const volatile BinOpJlongData* data = mul_jlong_data;
+ for (size_t i = 0; i < ARRAY_SIZE(mul_jlong_data); ++i) {
+ ASSERT_EQ(data[i].r, java_multiply(data[i].x, data[i].y));
+ ASSERT_EQ(data[i].r, java_multiply(data[i].y, data[i].x));
+ }
+}
+
+static const ShiftOpJintData asl_jint_data[] = {
+ { 0, 0, 0 },
+ { 0, 10, 0 },
+ { 0, 50, 0 },
+ { 1, 0, 1 },
+ { 1, 10, (jint)1 << 10 },
+ { 1, 50, (jint)1 << 18 },
+ { 5, 0, 5 },
+ { 5, 10, (jint)5 << 10 },
+ { 5, 50, (jint)5 << 18 },
+ { -1, 0, -1 },
+ { -1, 10, (jint)-1 * (1 << 10) },
+ { -1, 50, (jint)-1 * (1 << 18) },
+ { -5, 0, -5 },
+ { -5, 10, (jint)-5 * (1 << 10) },
+ { -5, 50, (jint)-5 * (1 << 18) },
+ { max_jint, 0, max_jint },
+ { max_jint, 10, (jint)0xFFFFFC00 },
+ { max_jint, 50, (jint)0xFFFC0000 },
+ { min_jint, 0, min_jint },
+ { min_jint, 10, 0 },
+ { min_jint, 50, 0 }
+};
+
+static const ShiftOpJlongData asl_jlong_data[] = {
+ { 0, 0, 0 },
+ { 0, 10, 0 },
+ { 0, 82, 0 },
+ { 1, 0, 1 },
+ { 1, 10, (jlong)1 << 10 },
+ { 1, 82, (jlong)1 << 18 },
+ { 5, 0, 5 },
+ { 5, 10, (jlong)5 << 10 },
+ { 5, 82, (jlong)5 << 18 },
+ { -1, 0, -1 },
+ { -1, 10, (jlong)-1 * (1 << 10) },
+ { -1, 82, (jlong)-1 * (1 << 18) },
+ { -5, 0, -5 },
+ { -5, 10, (jlong)-5 * (1 << 10) },
+ { -5, 82, (jlong)-5 * (1 << 18) },
+ { max_jlong, 0, max_jlong },
+ { max_jlong, 10, (jlong)0xFFFFFFFFFFFFFC00 },
+ { max_jlong, 82, (jlong)0xFFFFFFFFFFFC0000 },
+ { min_jlong, 0, min_jlong },
+ { min_jlong, 10, 0 },
+ { min_jlong, 82, 0 }
+};
+
+TEST(TestJavaArithmetic, shift_left_jint) {
+ const volatile ShiftOpJintData* data = asl_jint_data;
+ for (size_t i = 0; i < ARRAY_SIZE(asl_jint_data); ++i) {
+ ASSERT_EQ(data[i].r, java_shift_left(data[i].x, data[i].shift));
+ }
+}
+
+TEST(TestJavaArithmetic, shift_left_jlong) {
+ const volatile ShiftOpJlongData* data = asl_jlong_data;
+ for (size_t i = 0; i < ARRAY_SIZE(asl_jlong_data); ++i) {
+ ASSERT_EQ(data[i].r, java_shift_left(data[i].x, data[i].shift));
+ }
+}
+
+static const ShiftOpJintData asr_jint_data[] = {
+ { 0, 0, 0 },
+ { 0, 10, 0 },
+ { 0, 50, 0 },
+ { 1, 0, 1 },
+ { 1, 10, 0 },
+ { 1, 50, 0 },
+ { 5, 0, 5 },
+ { 5, 1, 2 },
+ { 5, 10, 0 },
+ { 5, 33, 2 },
+ { 5, 50, 0 },
+ { -1, 0, -1 },
+ { -1, 10, -1 },
+ { -1, 50, -1 },
+ { -5, 0, -5 },
+ { -5, 1, -3 },
+ { -5, 10, -1 },
+ { -5, 33, -3 },
+ { -5, 50, -1 },
+ { max_jint, 0, max_jint },
+ { max_jint, 10, (jint)0x001FFFFF },
+ { max_jint, 50, (jint)0x00001FFF },
+ { min_jint, 0, min_jint },
+ { min_jint, 10, (jint)0xFFE00000 },
+ { min_jint, 50, (jint)0xFFFFE000 }
+};
+
+static const ShiftOpJlongData asr_jlong_data[] = {
+ { 0, 0, 0 },
+ { 0, 10, 0 },
+ { 0, 82, 0 },
+ { 1, 0, 1 },
+ { 1, 10, 0 },
+ { 1, 82, 0 },
+ { 5, 0, 5 },
+ { 5, 1, 2 },
+ { 5, 10, 0 },
+ { 5, 65, 2 },
+ { 5, 82, 0 },
+ { -1, 0, -1 },
+ { -1, 10, -1 },
+ { -1, 82, -1 },
+ { -5, 0, -5 },
+ { -5, 1, -3 },
+ { -5, 10, -1 },
+ { -5, 65, -3 },
+ { -5, 82, -1 },
+ { max_jlong, 0, max_jlong },
+ { max_jlong, 10, (jlong)0x001FFFFFFFFFFFFF },
+ { max_jlong, 82, (jlong)0x00001FFFFFFFFFFF },
+ { min_jlong, 0, min_jlong },
+ { min_jlong, 10, (jlong)0xFFE0000000000000 },
+ { min_jlong, 82, (jlong)0xFFFFE00000000000 }
+};
+
+TEST(TestJavaArithmetic, shift_right_jint) {
+ const volatile ShiftOpJintData* data = asr_jint_data;
+ for (size_t i = 0; i < ARRAY_SIZE(asr_jint_data); ++i) {
+ ASSERT_EQ(data[i].r, java_shift_right(data[i].x, data[i].shift));
+ }
+}
+
+TEST(TestJavaArithmetic, shift_right_jlong) {
+ const volatile ShiftOpJlongData* data = asr_jlong_data;
+ for (size_t i = 0; i < ARRAY_SIZE(asr_jlong_data); ++i) {
+ ASSERT_EQ(data[i].r, java_shift_right(data[i].x, data[i].shift));
+ }
+}
+
+static const ShiftOpJintData lsr_jint_data[] = {
+ { 0, 0, 0 },
+ { 0, 10, 0 },
+ { 0, 50, 0 },
+ { 1, 0, 1 },
+ { 1, 10, 0 },
+ { 1, 50, 0 },
+ { 5, 0, 5 },
+ { 5, 1, 2 },
+ { 5, 10, 0 },
+ { 5, 33, 2 },
+ { 5, 50, 0 },
+ { -1, 0, -1 },
+ { -1, 10, (jint)0x003FFFFF },
+ { -1, 50, (jint)0x00003FFF },
+ { -5, 0, -5 },
+ { -5, 1, (jint)0x7FFFFFFD },
+ { -5, 10, (jint)0x003FFFFF },
+ { -5, 50, (jint)0x00003FFF },
+ { max_jint, 0, max_jint },
+ { max_jint, 1, (jint)0x3FFFFFFF },
+ { max_jint, 10, (jint)0x001FFFFF },
+ { max_jint, 50, (jint)0x00001FFF },
+ { min_jint, 0, min_jint },
+ { min_jint, 1, (jint)0x40000000 },
+ { min_jint, 10, (jint)0x00200000 },
+ { min_jint, 50, (jint)0x00002000 }
+};
+
+static const ShiftOpJlongData lsr_jlong_data[] = {
+ { 0, 0, 0 },
+ { 0, 10, 0 },
+ { 0, 82, 0 },
+ { 1, 0, 1 },
+ { 1, 10, 0 },
+ { 1, 82, 0 },
+ { 5, 0, 5 },
+ { 5, 1, 2 },
+ { 5, 10, 0 },
+ { 5, 65, 2 },
+ { 5, 82, 0 },
+ { -1, 0, -1 },
+ { -1, 10, (jlong)0x003FFFFFFFFFFFFF },
+ { -1, 82, (jlong)0x00003FFFFFFFFFFF },
+ { -5, 0, -5 },
+ { -5, 1, (jlong)0x7FFFFFFFFFFFFFFD },
+ { -5, 10, (jlong)0x003FFFFFFFFFFFFF },
+ { -5, 82, (jlong)0x00003FFFFFFFFFFF },
+ { max_jlong, 0, max_jlong },
+ { max_jlong, 1, (jlong)0x3FFFFFFFFFFFFFFF },
+ { max_jlong, 10, (jlong)0x001FFFFFFFFFFFFF },
+ { max_jlong, 82, (jlong)0x00001FFFFFFFFFFF },
+ { min_jlong, 0, min_jlong },
+ { min_jlong, 1, (jlong)0x4000000000000000 },
+ { min_jlong, 10, (jlong)0x0020000000000000 },
+ { min_jlong, 82, (jlong)0x0000200000000000 }
+};
+
+TEST(TestJavaArithmetic, shift_right_unsigned_jint) {
+ const volatile ShiftOpJintData* data = lsr_jint_data;
+ for (size_t i = 0; i < ARRAY_SIZE(lsr_jint_data); ++i) {
+ ASSERT_EQ(data[i].r, java_shift_right_unsigned(data[i].x, data[i].shift));
+ }
+}
+
+TEST(TestJavaArithmetic, shift_right_unsigned_jlong) {
+ const volatile ShiftOpJlongData* data = lsr_jlong_data;
+ for (size_t i = 0; i < ARRAY_SIZE(lsr_jlong_data); ++i) {
+ ASSERT_EQ(data[i].r, java_shift_right_unsigned(data[i].x, data[i].shift));
+ }
+}
--- a/test/hotspot/gtest/utilities/test_population_count.cpp Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/gtest/utilities/test_population_count.cpp Fri Nov 08 20:41:14 2019 -0500
@@ -23,12 +23,13 @@
*/
#include "precompiled.hpp"
-#include "libadt/vectset.hpp"
#include "runtime/os.hpp"
#include "utilities/population_count.hpp"
#include "utilities/globalDefinitions.hpp"
#include "unittest.hpp"
+#define BITS_IN_BYTE_ARRAY_SIZE 256
+
uint8_t test_popcnt_bitsInByte[BITS_IN_BYTE_ARRAY_SIZE] = {
0, 1, 1, 2, 1, 2, 2, 3, 1, 2, 2, 3, 2, 3, 3, 4,
1, 2, 2, 3, 2, 3, 3, 4, 2, 3, 3, 4, 3, 4, 4, 5,
--- a/test/hotspot/jtreg/ProblemList.txt Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/ProblemList.txt Fri Nov 08 20:41:14 2019 -0500
@@ -206,4 +206,16 @@
vmTestbase/nsk/jdwp/ThreadReference/ForceEarlyReturn/forceEarlyReturn001/forceEarlyReturn001.java 7199837 generic-all
+vmTestbase/nsk/jvmti/scenarios/allocation/AP01/ap01t001/TestDescription.java 8233549 generic-all
+vmTestbase/nsk/jvmti/scenarios/allocation/AP04/ap04t001/TestDescription.java 8233549 generic-all
+vmTestbase/nsk/jvmti/scenarios/allocation/AP04/ap04t002/TestDescription.java 8233549 generic-all
+vmTestbase/nsk/jvmti/scenarios/allocation/AP04/ap04t003/TestDescription.java 8233549 generic-all
+vmTestbase/nsk/jvmti/scenarios/allocation/AP10/ap10t001/TestDescription.java 8233549 generic-all
+vmTestbase/nsk/jvmti/scenarios/allocation/AP12/ap12t001/TestDescription.java 8233549 generic-all
+vmTestbase/nsk/jvmti/scenarios/capability/CM02/cm02t001/TestDescription.java 8233549 generic-all
+vmTestbase/nsk/jvmti/scenarios/events/EM02/em02t002/TestDescription.java 8233549 generic-all
+vmTestbase/nsk/jvmti/scenarios/events/EM02/em02t003/TestDescription.java 8233549 generic-all
+vmTestbase/nsk/jvmti/scenarios/events/EM02/em02t005/TestDescription.java 8233549 generic-all
+vmTestbase/nsk/jvmti/scenarios/events/EM02/em02t006/TestDescription.java 8233549 generic-all
+vmTestbase/nsk/jvmti/scenarios/events/EM07/em07t002/TestDescription.java 8233549 generic-all
#############################################################################
--- a/test/hotspot/jtreg/compiler/aot/DeoptimizationTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/DeoptimizationTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.aot.DeoptimizationTest
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler -libname libDeoptimizationTest.so
--- a/test/hotspot/jtreg/compiler/aot/RecompilationTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/RecompilationTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.aot.RecompilationTest
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler -libname libRecompilationTest1.so
--- a/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeDynamic2AotTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeDynamic2AotTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -28,8 +28,7 @@
* @modules java.base/jdk.internal.org.objectweb.asm
* java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeDynamic
- * compiler.calls.common.InvokeDynamicPatcher
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver compiler.calls.common.InvokeDynamicPatcher
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
--- a/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeDynamic2CompiledTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeDynamic2CompiledTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -28,8 +28,7 @@
* @modules java.base/jdk.internal.org.objectweb.asm
* java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeDynamic
- * compiler.calls.common.InvokeDynamicPatcher
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver compiler.calls.common.InvokeDynamicPatcher
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
--- a/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeDynamic2InterpretedTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeDynamic2InterpretedTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -28,8 +28,7 @@
* @modules java.base/jdk.internal.org.objectweb.asm
* java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeDynamic
- * compiler.calls.common.InvokeDynamicPatcher
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver compiler.calls.common.InvokeDynamicPatcher
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
--- a/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeDynamic2NativeTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeDynamic2NativeTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -28,8 +28,7 @@
* @modules java.base/jdk.internal.org.objectweb.asm
* java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeDynamic
- * compiler.calls.common.InvokeDynamicPatcher
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver compiler.calls.common.InvokeDynamicPatcher
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
--- a/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeInterface2AotTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeInterface2AotTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeInterface
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler -libname AotInvokeInterface2AotTest.so
--- a/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeInterface2CompiledTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeInterface2CompiledTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeInterface
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler
--- a/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeInterface2InterpretedTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeInterface2InterpretedTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeInterface
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler
--- a/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeInterface2NativeTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeInterface2NativeTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeInterface
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler -libname AotInvokeInterface2NativeTest.so
--- a/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeSpecial2AotTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeSpecial2AotTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeSpecial
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler -libname AotInvokeSpecial2AotTest.so
--- a/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeSpecial2CompiledTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeSpecial2CompiledTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeSpecial
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler -libname AotInvokeSpecial2CompiledTest.so
--- a/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeSpecial2InterpretedTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeSpecial2InterpretedTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeSpecial
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler
--- a/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeSpecial2NativeTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeSpecial2NativeTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeSpecial
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler -libname AotInvokeSpecial2NativeTest.so
--- a/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeStatic2AotTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeStatic2AotTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeStatic
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler -libname AotInvokeStatic2AotTest.so
--- a/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeStatic2CompiledTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeStatic2CompiledTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeStatic
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler -libname AotInvokeStatic2CompiledTest.so
--- a/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeStatic2InterpretedTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeStatic2InterpretedTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeStatic
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler
--- a/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeStatic2NativeTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeStatic2NativeTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeStatic
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler -libname AotInvokeStatic2NativeTest.so
--- a/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeVirtual2AotTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeVirtual2AotTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeVirtual
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler -libname AotInvokeVirtual2AotTest.so
--- a/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeVirtual2CompiledTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeVirtual2CompiledTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeVirtual
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler -libname AotInvokeVirtual2CompiledTest.so
--- a/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeVirtual2InterpretedTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeVirtual2InterpretedTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeVirtual
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler
--- a/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeVirtual2NativeTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromAot/AotInvokeVirtual2NativeTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeVirtual
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler -libname AotInvokeVirtual2NativeTest.so
--- a/test/hotspot/jtreg/compiler/aot/calls/fromCompiled/CompiledInvokeDynamic2AotTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromCompiled/CompiledInvokeDynamic2AotTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -28,8 +28,7 @@
* @modules java.base/jdk.internal.org.objectweb.asm
* java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeDynamic
- * compiler.calls.common.InvokeDynamicPatcher
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.calls.common.InvokeDynamicPatcher
--- a/test/hotspot/jtreg/compiler/aot/calls/fromCompiled/CompiledInvokeInterface2AotTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromCompiled/CompiledInvokeInterface2AotTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeInterface
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler
--- a/test/hotspot/jtreg/compiler/aot/calls/fromCompiled/CompiledInvokeSpecial2AotTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromCompiled/CompiledInvokeSpecial2AotTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeSpecial
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler -libname CompiledInvokeSpecial2AotTest.so
--- a/test/hotspot/jtreg/compiler/aot/calls/fromCompiled/CompiledInvokeStatic2AotTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromCompiled/CompiledInvokeStatic2AotTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeStatic
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler -libname CompiledInvokeStatic2AotTest.so
--- a/test/hotspot/jtreg/compiler/aot/calls/fromCompiled/CompiledInvokeVirtual2AotTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromCompiled/CompiledInvokeVirtual2AotTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeVirtual
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler -libname CompiledInvokeVirtual2AotTest.so
--- a/test/hotspot/jtreg/compiler/aot/calls/fromInterpreted/InterpretedInvokeDynamic2AotTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromInterpreted/InterpretedInvokeDynamic2AotTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -28,8 +28,7 @@
* @modules java.base/jdk.internal.org.objectweb.asm
* java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeDynamic
- * compiler.calls.common.InvokeDynamicPatcher
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.calls.common.InvokeDynamicPatcher
--- a/test/hotspot/jtreg/compiler/aot/calls/fromInterpreted/InterpretedInvokeInterface2AotTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromInterpreted/InterpretedInvokeInterface2AotTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeInterface
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler
--- a/test/hotspot/jtreg/compiler/aot/calls/fromInterpreted/InterpretedInvokeSpecial2AotTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromInterpreted/InterpretedInvokeSpecial2AotTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeSpecial
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler
--- a/test/hotspot/jtreg/compiler/aot/calls/fromInterpreted/InterpretedInvokeStatic2AotTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromInterpreted/InterpretedInvokeStatic2AotTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeStatic
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler
--- a/test/hotspot/jtreg/compiler/aot/calls/fromInterpreted/InterpretedInvokeVirtual2AotTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromInterpreted/InterpretedInvokeVirtual2AotTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeVirtual
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler
--- a/test/hotspot/jtreg/compiler/aot/calls/fromNative/NativeInvokeSpecial2AotTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromNative/NativeInvokeSpecial2AotTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeSpecial
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler -libname NativeInvokeSpecial2AotTest.so
--- a/test/hotspot/jtreg/compiler/aot/calls/fromNative/NativeInvokeStatic2AotTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromNative/NativeInvokeStatic2AotTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeStatic
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler -libname NativeInvokeStatic2AotTest.so
--- a/test/hotspot/jtreg/compiler/aot/calls/fromNative/NativeInvokeVirtual2AotTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/calls/fromNative/NativeInvokeVirtual2AotTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -27,7 +27,7 @@
* @library /test/lib /testlibrary /
* @modules java.base/jdk.internal.misc
* @build compiler.calls.common.InvokeVirtual
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
* @run driver ClassFileInstaller sun.hotspot.WhiteBox
* sun.hotspot.WhiteBox$WhiteBoxPermission
* @run driver compiler.aot.AotCompiler -libname NativeInvokeVirtual2AotTest.so
--- a/test/hotspot/jtreg/compiler/aot/fingerprint/SelfChangedCDS.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/aot/fingerprint/SelfChangedCDS.java Fri Nov 08 20:41:14 2019 -0500
@@ -29,7 +29,7 @@
* java.management
* @requires vm.aot & vm.cds
* @build compiler.aot.fingerprint.SelfChanged
- * compiler.aot.AotCompiler
+ * sun.hotspot.WhiteBox
*
* @run main compiler.aot.fingerprint.SelfChanged WRITE-UNMODIFIED-CLASS
* @run driver compiler.aot.AotCompiler -libname libSelfChanged.so
--- a/test/hotspot/jtreg/compiler/intrinsics/klass/TestIsPrimitive.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/intrinsics/klass/TestIsPrimitive.java Fri Nov 08 20:41:14 2019 -0500
@@ -24,12 +24,13 @@
/*
* @test
* @bug 8150669
+ * @bug 8233019
* @summary C1 intrinsic for Class.isPrimitive
* @modules java.base/jdk.internal.misc
*
* @run main/othervm -ea -Diters=200 -Xint
* compiler.intrinsics.klass.TestIsPrimitive
- * @run main/othervm -ea -Diters=30000 -XX:TieredStopAtLevel=1
+ * @run main/othervm -ea -XX:-UseSharedSpaces -Diters=30000 -XX:TieredStopAtLevel=1
* compiler.intrinsics.klass.TestIsPrimitive
* @run main/othervm -ea -Diters=30000 -XX:TieredStopAtLevel=4
* compiler.intrinsics.klass.TestIsPrimitive
@@ -53,6 +54,7 @@
testOK(true, InlineConstants::testDouble);
testOK(false, InlineConstants::testObject);
testOK(false, InlineConstants::testArray);
+ testOK(false, InlineConstants::testBooleanArray);
testOK(true, StaticConstants::testBoolean);
testOK(true, StaticConstants::testByte);
@@ -64,6 +66,7 @@
testOK(true, StaticConstants::testDouble);
testOK(false, StaticConstants::testObject);
testOK(false, StaticConstants::testArray);
+ testOK(false, StaticConstants::testBooleanArray);
testNPE( StaticConstants::testNull);
testOK(true, NoConstants::testBoolean);
@@ -76,6 +79,7 @@
testOK(true, NoConstants::testDouble);
testOK(false, NoConstants::testObject);
testOK(false, NoConstants::testArray);
+ testOK(false, NoConstants::testBooleanArray);
testNPE( NoConstants::testNull);
}
@@ -112,6 +116,7 @@
static volatile Class<?> classObject = Object.class;
static volatile Class<?> classArray = Object[].class;
static volatile Class<?> classNull = null;
+ static volatile Class<?> classBooleanArray = boolean[].class;
static final Class<?> staticClassBoolean = boolean.class;
static final Class<?> staticClassByte = byte.class;
@@ -124,6 +129,7 @@
static final Class<?> staticClassObject = Object.class;
static final Class<?> staticClassArray = Object[].class;
static final Class<?> staticClassNull = null;
+ static final Class<?> staticClassBooleanArray = boolean[].class;
static class InlineConstants {
static boolean testBoolean() { return boolean.class.isPrimitive(); }
@@ -136,6 +142,7 @@
static boolean testDouble() { return double.class.isPrimitive(); }
static boolean testObject() { return Object.class.isPrimitive(); }
static boolean testArray() { return Object[].class.isPrimitive(); }
+ static boolean testBooleanArray() { return boolean[].class.isPrimitive(); }
}
static class StaticConstants {
@@ -150,6 +157,7 @@
static boolean testObject() { return staticClassObject.isPrimitive(); }
static boolean testArray() { return staticClassArray.isPrimitive(); }
static boolean testNull() { return staticClassNull.isPrimitive(); }
+ static boolean testBooleanArray() { return staticClassBooleanArray.isPrimitive(); }
}
static class NoConstants {
@@ -164,7 +172,9 @@
static boolean testObject() { return classObject.isPrimitive(); }
static boolean testArray() { return classArray.isPrimitive(); }
static boolean testNull() { return classNull.isPrimitive(); }
+ static boolean testBooleanArray() { return classBooleanArray.isPrimitive(); }
}
+
}
--- a/test/hotspot/jtreg/compiler/jvmci/jdk.vm.ci.hotspot.test/src/jdk/vm/ci/hotspot/test/TestHotSpotJVMCIRuntime.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/jvmci/jdk.vm.ci.hotspot.test/src/jdk/vm/ci/hotspot/test/TestHotSpotJVMCIRuntime.java Fri Nov 08 20:41:14 2019 -0500
@@ -20,6 +20,22 @@
* or visit www.oracle.com if you need additional information or have any
* questions.
*/
+
+/*
+ * @test
+ * @requires vm.jvmci
+ * @modules jdk.internal.vm.ci/jdk.vm.ci.hotspot
+ * jdk.internal.vm.ci/jdk.vm.ci.runtime
+ * jdk.internal.vm.ci/jdk.vm.ci.meta
+ * jdk.internal.vm.ci/jdk.vm.ci.code
+ * jdk.internal.vm.ci/jdk.vm.ci.common
+ * @library /compiler/jvmci/jdk.vm.ci.hotspot.test/src
+ * /compiler/jvmci/jdk.vm.ci.code.test/src
+ * @run testng/othervm
+ * -XX:+UnlockExperimentalVMOptions -XX:+EnableJVMCI -XX:-UseJVMCICompiler
+ * jdk.vm.ci.hotspot.test.TestHotSpotJVMCIRuntime
+ */
+
package jdk.vm.ci.hotspot.test;
import java.util.ArrayList;
@@ -27,8 +43,8 @@
import java.util.List;
import java.util.function.Predicate;
-import org.junit.Assert;
-import org.junit.Test;
+import org.testng.Assert;
+import org.testng.annotations.Test;
import jdk.vm.ci.hotspot.HotSpotJVMCIRuntime;
import jdk.vm.ci.meta.MetaAccessProvider;
@@ -74,7 +90,7 @@
if (expect instanceof Integer) {
Assert.fail("expected " + expect + ", got " + e + " for bytes == " + Arrays.toString(bytes));
} else {
- Assert.assertTrue(e.toString(), ((Class<?>) expect).isInstance(e));
+ Assert.assertTrue(((Class<?>) expect).isInstance(e), e.toString());
}
}
}
@@ -98,20 +114,12 @@
// Extension classes not available
}
ClassLoader jvmciLoader = HotSpotJVMCIRuntime.class.getClassLoader();
- ClassLoader extLoader = getExtensionLoader();
+ ClassLoader platformLoader = ClassLoader.getPlatformClassLoader();
for (Class<?> c : classes) {
ClassLoader cl = c.getClassLoader();
- boolean expected = cl == null || cl == jvmciLoader || cl == extLoader;
+ boolean expected = cl == null || cl == jvmciLoader || cl == platformLoader;
boolean actual = predicate.test(metaAccess.lookupJavaType(c));
- Assert.assertEquals(c + ": cl=" + cl, expected, actual);
+ Assert.assertEquals(expected, actual, c + ": cl=" + cl);
}
}
-
- private static ClassLoader getExtensionLoader() throws Exception {
- Object launcher = Class.forName("sun.misc.Launcher").getMethod("getLauncher").invoke(null);
- ClassLoader appLoader = (ClassLoader) launcher.getClass().getMethod("getClassLoader").invoke(launcher);
- ClassLoader extLoader = appLoader.getParent();
- assert extLoader.getClass().getName().equals("sun.misc.Launcher$ExtClassLoader") : extLoader;
- return extLoader;
- }
}
--- a/test/hotspot/jtreg/compiler/jvmci/jdk.vm.ci.hotspot.test/src/jdk/vm/ci/hotspot/test/TestHotSpotSpeculationLog.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/jvmci/jdk.vm.ci.hotspot.test/src/jdk/vm/ci/hotspot/test/TestHotSpotSpeculationLog.java Fri Nov 08 20:41:14 2019 -0500
@@ -20,13 +20,25 @@
* or visit www.oracle.com if you need additional information or have any
* questions.
*/
+
+/*
+ * @test
+ * @requires vm.jvmci
+ * @modules jdk.internal.vm.ci/jdk.vm.ci.hotspot
+ * jdk.internal.vm.ci/jdk.vm.ci.meta
+ * @library /compiler/jvmci/jdk.vm.ci.hotspot.test/src
+ * @run testng/othervm
+ * -XX:+UnlockExperimentalVMOptions -XX:+EnableJVMCI -XX:-UseJVMCICompiler
+ * jdk.vm.ci.hotspot.test.TestHotSpotSpeculationLog
+ */
+
package jdk.vm.ci.hotspot.test;
import java.util.function.Supplier;
-import org.junit.Assert;
-import org.junit.Assume;
-import org.junit.Test;
+import org.testng.Assert;
+import org.testng.SkipException;
+import org.testng.annotations.Test;
import jdk.vm.ci.hotspot.HotSpotSpeculationLog;
import jdk.vm.ci.meta.SpeculationLog;
@@ -87,16 +99,20 @@
SpeculationLog.Speculation s2 = log.speculate(reason2);
boolean added = log.addFailedSpeculation(s1);
- Assume.assumeTrue(added);
+ if (!added) {
+ throw new SkipException("log.addFailedSpeculation(s1) is false");
+ }
+
log.collectFailedSpeculations();
Assert.assertFalse(log.maySpeculate(reason1));
Assert.assertTrue(log.maySpeculate(reason2));
added = log.addFailedSpeculation(s2);
- Assume.assumeTrue(added);
+ if (!added) {
+ throw new SkipException("log.addFailedSpeculation(s2) is false");
+ }
log.collectFailedSpeculations();
- Assume.assumeTrue(added);
Assert.assertFalse(log.maySpeculate(reason1));
- Assert.assertFalse(log.toString(), log.maySpeculate(reason2));
+ Assert.assertFalse(log.maySpeculate(reason2), log.toString());
}
}
--- a/test/hotspot/jtreg/compiler/jvmci/jdk.vm.ci.hotspot.test/src/jdk/vm/ci/hotspot/test/TestServices.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/jvmci/jdk.vm.ci.hotspot.test/src/jdk/vm/ci/hotspot/test/TestServices.java Fri Nov 08 20:41:14 2019 -0500
@@ -20,6 +20,17 @@
* or visit www.oracle.com if you need additional information or have any
* questions.
*/
+
+/*
+ * @test
+ * @requires vm.jvmci
+ * @modules jdk.internal.vm.ci/jdk.vm.ci.services:+open
+ * @library /compiler/jvmci/jdk.vm.ci.hotspot.test/src
+ * @run testng/othervm
+ * -XX:+UnlockExperimentalVMOptions -XX:+EnableJVMCI -XX:-UseJVMCICompiler
+ * jdk.vm.ci.hotspot.test.TestServices
+ */
+
package jdk.vm.ci.hotspot.test;
import java.lang.reflect.Field;
@@ -27,8 +38,8 @@
import java.util.HashMap;
import java.util.Map;
-import org.junit.Assert;
-import org.junit.Test;
+import org.testng.Assert;
+import org.testng.annotations.Test;
import jdk.vm.ci.services.Services;
--- a/test/hotspot/jtreg/compiler/jvmci/jdk.vm.ci.hotspot.test/src/jdk/vm/ci/hotspot/test/TestTranslatedException.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/jvmci/jdk.vm.ci.hotspot.test/src/jdk/vm/ci/hotspot/test/TestTranslatedException.java Fri Nov 08 20:41:14 2019 -0500
@@ -20,6 +20,18 @@
* or visit www.oracle.com if you need additional information or have any
* questions.
*/
+
+/*
+ * @test
+ * @requires vm.jvmci
+ * @modules jdk.internal.vm.ci/jdk.vm.ci.hotspot:open
+ * @library /compiler/jvmci/jdk.vm.ci.hotspot.test/src
+ * @ignore 8233745
+ * @run testng/othervm
+ * -XX:+UnlockExperimentalVMOptions -XX:+EnableJVMCI -XX:-UseJVMCICompiler
+ * jdk.vm.ci.hotspot.test.TestTranslatedException
+ */
+
package jdk.vm.ci.hotspot.test;
import java.io.ByteArrayOutputStream;
@@ -27,8 +39,8 @@
import java.lang.reflect.InvocationTargetException;
import java.lang.reflect.Method;
-import org.junit.Assert;
-import org.junit.Test;
+import org.testng.Assert;
+import org.testng.annotations.Test;
public class TestTranslatedException {
@@ -71,6 +83,6 @@
"jdk.vm.ci.hotspot.TranslatedException: [java.lang.ClassNotFoundException: jdk/vm/ci/hotspot/test/TestTranslatedException$Untranslatable]",
"jdk.vm.ci.hotspot.test.TestTranslatedException$Untranslatable: test exception");
- Assert.assertEquals("before:\n" + before + "\nafter:\n" + after, before, after);
+ Assert.assertEquals(before, after);
}
}
--- a/test/hotspot/jtreg/compiler/jvmci/jdk.vm.ci.hotspot.test/src/jdk/vm/ci/hotspot/test/VirtualObjectLayoutTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/compiler/jvmci/jdk.vm.ci.hotspot.test/src/jdk/vm/ci/hotspot/test/VirtualObjectLayoutTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -20,10 +20,26 @@
* or visit www.oracle.com if you need additional information or have any
* questions.
*/
+
+/*
+ * @test
+ * @requires vm.jvmci
+ * @modules jdk.internal.vm.ci/jdk.vm.ci.hotspot
+ * jdk.internal.vm.ci/jdk.vm.ci.runtime
+ * jdk.internal.vm.ci/jdk.vm.ci.meta
+ * jdk.internal.vm.ci/jdk.vm.ci.code
+ * jdk.internal.vm.ci/jdk.vm.ci.common
+ * @library /compiler/jvmci/jdk.vm.ci.hotspot.test/src
+ * /compiler/jvmci/jdk.vm.ci.code.test/src
+ * @run testng/othervm
+ * -XX:+UnlockExperimentalVMOptions -XX:+EnableJVMCI -XX:-UseJVMCICompiler
+ * jdk.vm.ci.hotspot.test.VirtualObjectLayoutTest
+ */
+
package jdk.vm.ci.hotspot.test;
-import org.junit.Assert;
-import org.junit.Test;
+import org.testng.Assert;
+import org.testng.annotations.Test;
import jdk.vm.ci.code.VirtualObject;
import jdk.vm.ci.code.test.VirtualObjectTestBase;
@@ -43,10 +59,10 @@
try {
HotSpotCompiledCode.verifyVirtualObject(virtual);
} catch (JVMCIError e) {
- Assert.assertTrue("Unexpected error verifying " + virtual, error);
+ Assert.assertTrue(error, "Unexpected error verifying " + virtual);
return;
}
- Assert.assertFalse("Expected error but passed verifying " + virtual, error);
+ Assert.assertFalse(error, "Expected error but passed verifying " + virtual);
}
@Test
--- a/test/hotspot/jtreg/gc/logging/TestMetaSpaceLog.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/gc/logging/TestMetaSpaceLog.java Fri Nov 08 20:41:14 2019 -0500
@@ -130,7 +130,7 @@
public static void loadClass(WhiteBox wb) {
try {
URLClassLoader ucl = new URLClassLoader(urls);
- ucl.loadClass("case00");
+ Class.forName("case00", false, ucl);
} catch (Exception e) {
e.printStackTrace();
}
--- a/test/hotspot/jtreg/runtime/cds/appcds/CommandLineFlagCombo.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/runtime/cds/appcds/CommandLineFlagCombo.java Fri Nov 08 20:41:14 2019 -0500
@@ -44,6 +44,7 @@
import jdk.test.lib.process.OutputAnalyzer;
import sun.hotspot.code.Compiler;
+import sun.hotspot.WhiteBox;
public class CommandLineFlagCombo {
@@ -128,6 +129,12 @@
return true;
}
+ if (!WhiteBox.getWhiteBox().isJFRIncludedInVmBuild() && testEntry.equals("-XX:+FlightRecorder"))
+ {
+ System.out.println("JFR does not exist");
+ return true;
+ }
+
return false;
}
}
--- a/test/hotspot/jtreg/runtime/cds/appcds/ExtraSymbols.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/runtime/cds/appcds/ExtraSymbols.java Fri Nov 08 20:41:14 2019 -0500
@@ -34,6 +34,7 @@
import java.io.*;
import jdk.test.lib.process.OutputAnalyzer;
+import jdk.test.lib.cds.CDSTestUtils;
public class ExtraSymbols {
static final String CDS_LOGGING = "-Xlog:cds,cds+hashtables";
@@ -46,10 +47,9 @@
checkOutput(output);
int numEntries1 = numOfEntries(output);
- // 2. Dump an archive with extra symbols. All symbols in
- // ExtraSymbols.symbols.txt are valid. Dumping should succeed.
+ // 2. Dump an archive with lots of extra symbols.
output = TestCommon.dump(appJar, TestCommon.list("Hello"), CDS_LOGGING,
- "-XX:SharedArchiveConfigFile=" + TestCommon.getSourceFile("ExtraSymbols.symbols.txt"));
+ "-XX:SharedArchiveConfigFile=" + makeLotsExtraSymbols());
checkOutput(output);
int numEntries2 = numOfEntries(output);
if (numEntries2 <= numEntries1) {
@@ -86,4 +86,30 @@
output.shouldContain("Shared symbol table stats -------- base:");
output.shouldHaveExitValue(0);
}
+
+ static String makeLotsExtraSymbols() throws Exception {
+ String fileName = "LotsExtraSymbols.txt";
+ File f = new File(fileName);
+ try (FileWriter fw = new FileWriter(f)) {
+ fw.write("VERSION: 1.0\n");
+ fw.write("@SECTION: Symbol\n");
+ appendSymbol(fw, "This file is auto-generated by test/hotspot/jtreg/runtime/cds/appcds/ExtraSymbols.java. Do not edit.");
+ appendSymbol(fw, "Hello");
+ appendSymbol(fw, ""); // empty string
+ appendSymbol(fw, "Hello_\u0001"); // <128 escaping with \x
+ appendSymbol(fw, "Hello_\u00ff"); // <256 escaping with \x
+ appendSymbol(fw, "Hello_\u1234"); // >= 256 escaping with \x
+ appendSymbol(fw, "Hello_\uffff"); // >= 256 escaping with \x
+
+ for (int i = 0; i < 10000; i++) {
+ appendSymbol(fw, "NewSymbol" + Integer.toString(i));
+ }
+ }
+ return fileName;
+ }
+
+ private static void appendSymbol(FileWriter fw, String symbol) throws Exception {
+ fw.write(CDSTestUtils.formatArchiveConfigSymbol(symbol));
+ fw.write("\n");
+ }
}
--- a/test/hotspot/jtreg/runtime/cds/appcds/ExtraSymbols.symbols.txt Fri Nov 08 16:48:20 2019 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,10826 +0,0 @@
-VERSION: 1.0
-@SECTION: Symbol
-69 -1: ------------------------------------------------------------123456789
-68 -1: # The values in this file are only used for testing the operation of
-63 -1: # adding extra symbols into the CDS archive. None of the values
-70 -1: # are interpreted in any way. So even if they contain names of classes
-70 -1: # that have been renamed or removed, or string literals that have been
-66 -1: # changed or remove from Java source code, it would not affect the
-26 -1: # correctness of the test.
-0 -1:
-41 -1: (Ljava/util/Set<TE;>;Ljava/lang/Object;)V
-11 -1: linkMethod
-18 -1: type can't be null
-20 -1: isAlphaNumericString
-43 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;)Z
-72 -1: (Ljava/lang/String;[Ljava/lang/String;Ljava/io/File;)Ljava/lang/Process;
-1 -1: \t
-15 -1: IntCumulateTask
-1 -1: \n
-33 -1: java/util/Locale$LocaleNameGetter
-23 -1: sun/invoke/util/Wrapper
-57 -1: (Ljava/io/InputStream;Ljava/nio/charset/CharsetDecoder;)V
-12 -1: reduceToLong
-11 -1: setReadOnly
-34 -1: (Ljava/lang/reflect/Executable;)[B
-54 -1: ([Ljava/net/URL;Ljava/security/AccessControlContext;)V
-15 -1: LegacyMergeSort
-8 -1: endsWith
-55 -1: <T:Ljava/lang/Object;>(Ljava/lang/ClassValue<TT;>;TT;)V
-20 -1: createAnnotationData
-6 -1: OfLong
-90 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/Map<TK;TV;>;)Ljava/util/Map<TK;TV;>;
-1 -1:
-17 -1: getClassSignature
-1 -1: "
-1 -1: #
-1 -1: (
-21 -1: MethodHandleImpl.java
-10 -1: getUTF8At0
-1 -1: )
-1 -1: *
-1 -1: +
-1 -1: ,
-1 -1: -
-1 -1: .
-18 -1: unsignedEntryNames
-1 -1: /
-1 -1: 0
-19 -1: java/io/InputStream
-38 -1: java/util/concurrent/ThreadLocalRandom
-1 -1: :
-1 -1: ;
-1 -1: <
-13 -1: getAndAddLong
-1 -1: =
-1 -1: >
-1 -1: ?
-20 -1: getMethodAtIfLoaded0
-1 -1: @
-1 -1: A
-7 -1: isAlive
-1 -1: B
-10 -1: checkIndex
-1 -1: C
-1 -1: D
-1 -1: E
-1 -1: F
-1 -1: I
-30 -1: sun/misc/JavaUtilZipFileAccess
-11 -1: classloader
-1 -1: J
-1 -1: L
-14 -1: packageEnabled
-8 -1: ([BIII)V
-24 -1: Ljava/io/BufferedWriter;
-1 -1: S
-32 -1: (Ljava/util/function/Consumer;)V
-11 -1: refKindName
-1 -1: U
-1 -1: V
-3 1: yyy
-18 -1: JavaNetAccess.java
-1 -1: Z
-7 -1: members
-1 -1: [
-1 -1: ]
-13 -1: ShortLanguage
-1 -1: _
-9 -1: invoke__L
-28 -1: (D)Ljava/lang/StringBuilder;
-15 -1: isInvokeSpecial
-1 -1: c
-17 -1: subListRangeCheck
-1 -1: e
-29 -1: Ljava/security/AllPermission;
-27 -1: (C)Ljava/lang/StringBuffer;
-28 -1: ([Ljava/lang/Comparable;II)V
-50 -1: (Ljava/util/zip/ZipFile;Ljava/util/zip/Inflater;)V
-9 -1: invoke__V
-1 -1: m
-101 -1: (Ljava/io/OutputStream;Ljava/lang/Object;Ljava/nio/charset/CharsetEncoder;)Lsun/nio/cs/StreamEncoder;
-13 -1: MAX_SURROGATE
-18 -1: Ljava/lang/String;
-21 -1: ensureProtectedAccess
-18 -1: getIfModifiedSince
-1 -1: r
-9 -1: setExtra0
-1 -1: s
-47 -1: Ljava/lang/Enum<Lsun/launcher/LauncherHelper;>;
-1 -1: x
-1 -1: {
-7 -1: getLast
-1 -1: |
-1 -1: }
-1 -1: ~
-71 -1: (Ljava/lang/Object;)Ljava/util/concurrent/ConcurrentHashMap$KeySetView;
-34 -1: (Ljava/nio/charset/Charset;[BII)[C
-10 -1: DST_NSHIFT
-25 -1: ForEachTransformedKeyTask
-26 -1: Ljava/nio/charset/Charset;
-56 -1: (Ljava/lang/reflect/Method;)Lsun/reflect/MethodAccessor;
-22 -1: StackTraceElement.java
-24 -1: sun.zip.zipFile.openTime
-27 -1: JNI_COPY_TO_ARRAY_THRESHOLD
-26 -1: java/lang/ClassValue$Entry
-19 -1: [Ljava/lang/Thread;
-56 -1: (Ljava/lang/ClassLoader$NativeLibrary;)Ljava/lang/Class;
-7 -1: message
-18 -1: parameterToArgSlot
-20 -1: [[Ljava/lang/String;
-11 -1: bumpVersion
-26 -1: Ljava/lang/reflect/Method;
-9 -1: getMethod
-6 -1: (I)TE;
-49 -1: (Ljava/lang/String;)Ljava/lang/invoke/MemberName;
-33 -1: sun/misc/URLClassPath$JarLoader$1
-57 -1: (BLjava/lang/Class;Ljava/lang/String;Ljava/lang/Object;)V
-33 -1: sun/misc/URLClassPath$JarLoader$2
-33 -1: sun/misc/URLClassPath$JarLoader$3
-87 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/HashMap$Node;)Ljava/util/HashMap$Node;
-19 -1: FileDescriptor.java
-12 -1: forEachValue
-36 -1: (Ljava/util/List;)[Ljava/lang/Class;
-53 -1: (Ljava/lang/CharSequence;II)Ljava/lang/StringBuilder;
-8 -1: hasArray
-4 -1: ROWS
-10 -1: linkMethod
-9 -1: remaining
-23 -1: ARRAY_FLOAT_BASE_OFFSET
-35 -1: java/lang/reflect/ReflectPermission
-24 -1: ()Ljava/net/InetAddress;
-7 -1: ngroups
-81 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction<Ljava/lang/Class<*>;>;
-10 -1: putTreeVal
-4 -1: list
-5 -1: trace
-7 -1: blocker
-21 -1: reset() not supported
-8 -1: JAPANESE
-11 -1: PRIVATE_USE
-53 -1: (Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodHandle;
-32 -1: Invalid JavaFX launch parameters
-15 -1: SECONDS_PER_DAY
-11 -1: UTF_16.java
-24 -1: sun/nio/cs/UTF_8$Encoder
-102 -1: (Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;[Ljava/security/Permission;)V
-20 -1: (Lsun/misc/Signal;)V
-22 -1: MagicAccessorImpl.java
-84 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;Ljava/security/CodeSource;)Ljava/lang/Class;
-14 -1: altMetafactory
-13 -1: queryOverflow
-30 -1: exists, but is not accessible
-3 -1: edt
-14 -1: MAX_ARRAY_SIZE
-20 -1: aliases_UTF_16LE_BOM
-34 -1: Ljava/lang/reflect/Constructor<*>;
-20 -1: (S)Ljava/lang/Short;
-6 -1: STRICT
-19 -1: internalCallerClass
-27 -1: java/nio/DirectLongBufferRU
-13 -1: TIMED_WAITING
-15 -1: toGenericString
-6 -1: client
-10 -1: attachImpl
-22 -1: ReflectionFactory.java
-8 -1: jsse.jar
-37 -1: (IZ)Ljava/lang/AbstractStringBuilder;
-41 -1: java/util/LinkedHashMap$LinkedKeyIterator
-15 -1: computeIfAbsent
-10 -1: GET_TARGET
-53 -1: <E:Ljava/lang/Enum<TE;>;>(Ljava/lang/Class<TE;>;)[TE;
-35 -1: java/util/Collections$SingletonList
-7 -1: addYear
-35 -1: Ljava/lang/Class<Ljava/lang/Byte;>;
-65 -1: (Ljava/util/LinkedHashMap$Entry;Ljava/util/LinkedHashMap$Entry;)V
-14 -1: image/x-bitmap
-10 -1: (IIII[JI)V
-50 -1: (Lsun/misc/URLClassPath$JarLoader;Ljava/net/URL;)V
-13 -1: getLineNumber
-20 -1: toUpperCaseCharArray
-62 -1: (Ljava/util/concurrent/locks/Condition;)Ljava/util/Collection;
-11 -1: rotateRight
-10 -1: checkPtype
-85 -1: (JLjava/util/function/ToLongFunction<-TK;>;JLjava/util/function/LongBinaryOperator;)J
-81 -1: (Ljava/lang/Class;Ljava/lang/reflect/Constructor;)Ljava/lang/reflect/Constructor;
-15 -1: Illegal style:
-28 -1: (Ljava/lang/StringBuilder;)V
-41 -1: 1.8.0-internal-iklam_2013_11_27_21_25-b00
-25 -1: Invalid authority field:
-55 -1: (Ljava/lang/CharSequence;)Ljava/util/function/Supplier;
-12 -1: staticOffset
-32 -1: java/util/HashMap$KeySpliterator
-13 -1: javaNioAccess
-24 -1: (Ljava/util/SortedSet;)V
-17 -1: thenComparingLong
-2 -1: \n\n
-22 -1: registerFieldsToFilter
-34 -1: java/lang/invoke/LambdaMetafactory
-225 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceMappingsTask;Ljava/util/function/BiFunction;Ljava/util/function/BiFunction;)V
-26 -1: [[Ljava/lang/CharSequence;
-32 -1: java/util/Collections$CheckedMap
-147 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractSequentialList<TE;>;Ljava/util/List<TE;>;Ljava/util/Deque<TE;>;Ljava/lang/Cloneable;Ljava/io/Serializable;
-204 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/CallSite;
-27 -1: sun/nio/cs/UTF_16BE$Decoder
-12 -1: getZoneInfo0
-77 -1: (Ljava/lang/Class;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodType;
-9 -1: Traverser
-35 -1: Ljava/lang/ref/ReferenceQueue<TT;>;
-27 -1: lambda$comparing$ea9a8b3a$1
-7 -1: ([CI)[C
-6 -1: getenv
-9 -1: newMethod
-52 -1: <T:Ljava/lang/Object;>Ljava/lang/reflect/Executable;
-164 -1: (Ljava/security/ProtectionDomain;Ljava/security/DomainCombiner;Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;[Ljava/security/Permission;)V
-40 -1: (Ljava/lang/String;)Ljava/util/TimeZone;
-11 -1: countTokens
-202 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/concurrent/ConcurrentHashMap$CollectionView<TK;TV;Ljava/util/Map$Entry<TK;TV;>;>;Ljava/util/Set<Ljava/util/Map$Entry<TK;TV;>;>;Ljava/io/Serializable;
-78 -1: <T:Ljava/lang/Object;>(Ljava/util/Collection<TT;>;)Ljava/util/Collection<TT;>;
-34 -1: (Ljava/lang/reflect/Constructor;)I
-15 -1: comparingDouble
-24 -1: ()Ljava/util/Collection;
-14 -1: invokeFinalize
-14 -1: encodeISOArray
-77 -1: (Ljava/lang/ref/Reference;Ljava/lang/ref/Reference;)Ljava/lang/ref/Reference;
-11 -1: bad index:
-34 -1: (Ljava/lang/reflect/Constructor;)V
-68 -1: (Ljava/util/jar/JarEntry;Lsun/security/util/ManifestEntryVerifier;)V
-53 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;IIIJ)V
-27 -1: ([CII)Ljava/nio/CharBuffer;
-6 -1: setOut
-41 -1: (ILjava/lang/Object;Ljava/lang/Object;I)V
-12 -1: MIN_EXPONENT
-30 -1: PrivilegedExceptionAction.java
-18 -1: key cannot be null
-6 -1: CENHDR
-73 -1: (ITK;TV;Ljava/util/HashMap$Node<TK;TV;>;)Ljava/util/HashMap$Node<TK;TV;>;
-23 -1: java/lang/reflect/Array
-8 -1: AF_LIMIT
-2 -1: \r\n
-11 -1: getFileName
-10 -1: parseShort
-22 -1: java/lang/LinkageError
-15 -1: FT_LAST_WRAPPER
-32 -1: java/util/ArrayDeque$DeqIterator
-24 -1: pc-multilingual-850+euro
-3 -1: zfc
-14 -1: incrementExact
-38 -1: (IIII)Lsun/util/calendar/CalendarDate;
-8 -1: (II[BI)V
-8 -1: isLocked
-13 -1: ZoneInfo.java
-36 -1: (Lsun/util/calendar/CalendarDate;J)V
-35 -1: java/lang/invoke/MethodHandleImpl$1
-31 -1: (Ljava/util/Comparator<-TE;>;)V
-19 -1: CharsetEncoder.java
-52 -1: <T:Ljava/lang/Object;>()Ljava/util/Enumeration<TT;>;
-44 -1: (Ljava/io/InputStream;)Ljava/io/InputStream;
-7 -1: field
-5 -1: abort
-25 -1: java/lang/SecurityManager
-66 -1: java/util/concurrent/ConcurrentHashMap$MapReduceValuesToDoubleTask
-1316 -1: \xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe5\xa0\x80\xe4\x80\x8f\xe5\x80\x80\xe4\x80\x8f\xe5\xa0\x80\xe4\x80\x8f\xe6\x80\x80\xe4\x80\x8f\xe5\x80\x80\xe4\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe5\x80\x80\xe4\x80\x8f\xe5\x80\x80\xe4\x80\x8f\xe5\x80\x80\xe4\x80\x8f\xe5\xa0\x80\xe4\x80\x8f\xe6\x80\x80\xe4\x80\x8c\xe6\xa0\x80\x18\xe6\xa0\x80\x18\xe2\xa0\x80\x18\xe2\xa0\x80\xe6\x80\x9a\xe2\xa0\x80\x18\xe6\xa0\x80\x18\xe6\xa0\x80\x18\xee\xa0\x80\x15\xee\xa0\x80\x16\xe6\xa0\x80\x18\xe2\x80\x80\x19\xe3\xa0\x80\x18\xe2\x80\x80\x14\xe3\xa0\x80\x18\xe3\xa0\x80\x18\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe3\xa0\x80\x18\xe6\xa0\x80\x18\xee\xa0\x80\x19\xe6\xa0\x80\x19\xee\xa0\x80\x19\xe6\xa0\x80\x18\xe6\xa0\x80\x18\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xee\xa0\x80\x15\xe6\xa0\x80\x18\xee\xa0\x80\x16\xe6\xa0\x80\x1b\xe6\xa0\x80\xe5\x80\x97\xe6\xa0\x80\x1b\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xee\xa0\x80\x15\xe6\xa0\x80\x19\xee\xa0\x80\x16\xe6\xa0\x80\x19\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe5\x80\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe3\xa0\x80\x0c\xe6\xa0\x80\x18\xe2\xa0\x80\xe6\x80\x9a\xe2\xa0\x80\xe6\x80\x9a\xe2\xa0\x80\xe6\x80\x9a\xe2\xa0\x80\xe6\x80\x9a\xe6\xa0\x80\x1c\xe6\xa0\x80\x18\xe6\xa0\x80\x1b\xe6\xa0\x80\x1c\xc0\x80\xe7\x80\x85\xee\xa0\x80\x1d\xe6\xa0\x80\x19\xe4\xa0\x80\xe1\x80\x90\xe6\xa0\x80\x1c\xe6\xa0\x80\x1b\xe2\xa0\x80\x1c\xe2\xa0\x80\x19\xe1\xa0\x80\xd8\x8b\xe1\xa0\x80\xd8\x8b\xe6\xa0\x80\x1b\xdf\xbd\xe7\x80\x82\xe6\xa0\x80\x18\xe6\xa0\x80\x18\xe6\xa0\x80\x1b\xe1\xa0\x80\xd4\x8b\xc0\x80\xe7\x80\x85\xee\xa0\x80\x1e\xe6\xa0\x80\xe0\xa0\x8b\xe6\xa0\x80\xe0\xa0\x8b\xe6\xa0\x80\xe0\xa0\x8b\xe6\xa0\x80\x18\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xe6\xa0\x80\x19\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xdf\xbd\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xe6\xa0\x80\x19\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xd8\x9d\xe7\x80\x82
-6 -1: (J[I)I
-162 -1: (Ljava/util/List<Ljava/util/Locale$LanguageRange;>;Ljava/util/Collection<Ljava/util/Locale;>;Ljava/util/Locale$FilteringMode;)Ljava/util/List<Ljava/util/Locale;>;
-21 -1: getQualifiedFieldName
-46 -1: Ljava/util/Set<Ljava/util/Map$Entry<TK;TV;>;>;
-47 -1: (Ljava/util/Collection;Ljava/util/Collection;)Z
-10 -1: getRuntime
-30 -1: threadLocalRandomSecondarySeed
-18 -1: (Ljava/io/File;I)J
-10 -1: methodName
-34 -1: sun/reflect/generics/tree/TypeTree
-35 -1: (Ljava/io/File;)[Ljava/lang/String;
-31 -1: java/util/Collections$EmptyList
-15 -1: LF_INVINTERFACE
-9 -1: notifyAll
-18 -1: (Ljava/io/File;I)V
-94 -1: (Ljava/lang/String;[BIILjava/security/ProtectionDomain;Ljava/lang/String;)Ljava/lang/Class<*>;
-45 -1: (Ljava/lang/String;)Ljava/net/ContentHandler;
-3 -1: enc
-3 -1: end
-18 -1: (Ljava/io/File;I)Z
-47 -1: (Ljava/lang/Object;Ljava/lang/reflect/Method;)V
-76 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Z)V
-19 -1: getURLStreamHandler
-46 -1: (Ljava/lang/ClassLoader;Ljava/lang/Class<*>;)V
-17 -1: COMPILE_THRESHOLD
-15 -1: charset is null
-7 -1: ibm-912
-10 -1: basicTypes
-7 -1: ibm-914
-78 -1: (Ljava/lang/Class;Ljava/lang/ref/SoftReference;Ljava/lang/ref/SoftReference;)Z
-7 -1: ibm-915
-12 -1: JarFileEntry
-12 -1: setThreshold
-22 -1: (ILjava/lang/Object;)V
-55 -1: <T::Lsun/reflect/generics/tree/Tree;>Ljava/lang/Object;
-16 -1: Unknown signal:
-3 -1: zip
-13 -1: CR_UNMAPPABLE
-19 -1: getClassAtIfLoaded0
-21 -1: WindowsClientCounters
-29 -1: Ljava/lang/invoke/MethodType;
-91 -1: <E:Ljava/lang/Object;>Ljava/util/Collections$UnmodifiableList<TE;>;Ljava/util/RandomAccess;
-23 -1: StackOverflowError.java
-13 -1: Launcher.java
-9 -1: Signature
-7 -1: ibm-920
-153 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>([Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;ILjava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;)V
-13 -1: setExtensions
-26 -1: [Ljava/lang/ref/Reference;
-7 -1: ibm-923
-12 -1: BMH.reinvoke
-34 -1: java/lang/IllegalArgumentException
-53 -1: (Ljava/lang/String;)Ljava/lang/NumberFormatException;
-5 -1: .dirs
-13 -1: finishToArray
-22 -1: (ZI)Ljava/lang/String;
-84 -1: (Ljava/lang/String;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/RuntimeException;
-15 -1: charsetProvider
-24 -1: ()Ljava/lang/Class<TT;>;
-10 -1: wordsInUse
-26 -1: (Ljava/io/ExpiringCache;)I
-53 -1: ()Ljava/util/Iterator<Ljava/util/Map$Entry<TK;TV;>;>;
-25 -1: com/sun/management/GcInfo
-26 -1: getCompatibilityExtensions
-69 -1: (Ljava/lang/ref/ReferenceQueue;Ljava/util/concurrent/ConcurrentMap;)V
-15 -1: getConstantPool
-24 -1: [[Ljava/lang/Comparable;
-26 -1: (Ljava/io/ExpiringCache;)V
-8 -1: getTable
-53 -1: sun/reflect/generics/repository/ConstructorRepository
-5 -1: range
-36 -1: (Ljava/lang/String;)Ljava/lang/Byte;
-72 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class;)V
-60 -1: <T:Ljava/lang/Object;>([TT;TT;Ljava/util/Comparator<-TT;>;)I
-20 -1: (Ljava/nio/Bits$1;)V
-30 -1: ()Ljava/util/Spliterator<TK;>;
-6 -1: ([BB)I
-53 -1: (Ljava/lang/ref/Finalizer;Lsun/misc/JavaLangAccess;)V
-11 -1: memberTypes
-45 -1: (ILjava/lang/String;)Ljava/lang/StringBuffer;
-12 -1: OTHER_SYMBOL
-65 -1: (Ljava/lang/Class;Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
-43 -1: (Ljava/util/Set;)[Ljava/lang/reflect/Field;
-30 -1: (Ljava/lang/ref/Reference$1;)V
-18 -1: GREGORIAN_INSTANCE
-31 -1: Ljava/lang/FunctionalInterface;
-57 -1: (Ljava/lang/Error;Ljava/lang/Exception;)Ljava/lang/Error;
-54 -1: ([Ljava/lang/reflect/Field;)[Ljava/lang/reflect/Field;
-14 -1: not an array:
-6 -1: ([BB)V
-9 -1: ISO8859_1
-8 -1: addTrans
-27 -1: getFunctionalInterfaceClass
-29 -1: lambda$comparingInt$7b0bb60$1
-8 -1: TreeNode
-138 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/Dictionary<TK;TV;>;Ljava/util/Map<TK;TV;>;Ljava/lang/Cloneable;Ljava/io/Serializable;
-3 -1: era
-22 -1: fakeMethodHandleInvoke
-9 -1: addToList
-39 -1: (Ljava/lang/Class;[Ljava/lang/String;)V
-17 -1: launchApplication
-21 -1: randomNumberGenerator
-51 -1: Ljava/lang/ThreadLocal<Ljava/lang/ThreadLocal<*>;>;
-35 -1: java/io/ObjectOutputStream$PutField
-42 -1: (ILjava/util/function/IntBinaryOperator;)I
-3 -1: err
-13 -1: cachedDecoder
-32 -1: sun/util/calendar/ZoneInfoFile$1
-23 -1: doIntersectionPrivilege
-19 -1: cspc850multilingual
-56 -1: Ljava/util/Map<Ljava/lang/Class<*>;[Ljava/lang/String;>;
-11 -1: loader_data
-27 -1: (Ljava/util/jar/Manifest;)V
-5 -1: files
-90 -1: Ljava/util/concurrent/ConcurrentMap<Ljava/lang/String;Lsun/util/calendar/CalendarSystem;>;
-36 -1: [[Ljava/lang/invoke/LambdaForm$Name;
-5 -1: lines
-55 -1: (Lsun/misc/URLClassPath$JarLoader;)Lsun/misc/MetaIndex;
-9 -1: ansi-1251
-15 -1: refKindIsMethod
-29 -1: java/lang/reflect/Constructor
-3 -1: est
-19 -1: Lsun/misc/Launcher;
-109 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedExceptionAction<TT;>;Ljava/security/AccessControlContext;)TT;
-10 -1: getOffsets
-9 -1: removeAll
-23 -1: java/util/regex/Matcher
-8 -1: sumCount
-7 -1: implies
-10 -1: MAIN_CLASS
-75 -1: (Ljava/util/List<Lsun/launcher/LauncherHelper$StdArg;>;)[Ljava/lang/String;
-11 -1: getISO3Code
-4 -1: high
-53 -1: (TK;Ljava/util/function/BiFunction<-TK;-TV;+TV;>;)TV;
-17 -1: setNormalizedDate
-23 -1: AbstractRepository.java
-28 -1: java/util/LinkedList$ListItr
-8 -1: isFrozen
-38 -1: (Ljava/lang/String;Z)Ljava/lang/Class;
-16 -1: ReflectUtil.java
-30 -1: ()Ljava/util/stream/IntStream;
-57 -1: (Ljava/lang/Object;JLjava/lang/Object;)Ljava/lang/Object;
-11 -1: getResource
-16 -1: ThreadDeath.java
-24 -1: unmodifiableNavigableSet
-59 -1: (Ljava/lang/String;)Ljava/util/Enumeration<Ljava/net/URL;>;
-24 -1: java.security.auth.debug
-58 -1: (Ljava/io/FileInputStream;)Ljava/nio/channels/FileChannel;
-25 -1: ()Ljava/util/Enumeration;
-11 -1: getInstance
-6 -1: MONDAY
-15 -1: jdkMinorVersion
-16 -1: newThreadWithAcc
-6 -1: CENHOW
-32 -1: Max. Heap Size (Estimated):
-61 -1: (Ljava/lang/invoke/MethodType;Z)Ljava/lang/invoke/LambdaForm;
-11 -1: windows-932
-7 -1: Index:
-11 -1: composeList
-6 -1: utf-16
-6 -1: ibm437
-10 -1: getJarFile
-8 -1: , rem =
-13 -1: multiNewArray
-14 -1: getDefaultPort
-39 -1: Ljava/security/cert/CertificateFactory;
-10 -1: L_RESERVED
-19 -1: getMethodAtIfLoaded
-8 -1: needCast
-8 -1: IS_FIELD
-15 -1: ClassValue.java
-31 -1: ()Ljava/util/function/Supplier;
-125 -1: (Ljava/lang/Class<*>;)Ljava/util/Map<Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;Ljava/lang/annotation/Annotation;>;
-34 -1: lambda$comparingByValue$827a17d5$1
-4 -1: NONE
-21 -1: java/nio/DoubleBuffer
-33 -1: ()Lsun/reflect/LangReflectAccess;
-26 -1: invalid compression method
-6 -1: (TK;)Z
-16 -1: FT_UNCHECKED_REF
-14 -1: getGenericType
-17 -1: pathSeparatorChar
-8 -1: writeUTF
-8 -1: NO_PROXY
-188 -1: (Ljava/lang/String;Ljava/util/Map<Ljava/lang/String;Ljava/lang/String;>;Ljava/util/Map<Ljava/lang/String;Ljava/lang/String;>;Ljava/util/Map<Ljava/lang/String;Ljava/nio/charset/Charset;>;)V
-13 -1: finalRefCount
-12 -1: NF_checkCast
-6 -1: utf-32
-26 -1: (Ljava/util/ArrayDeque;I)Z
-19 -1: prefetchWriteStatic
-14 -1: computeInvoker
-5 -1: cap=
-19 -1: generateCertificate
-15 -1: methodModifiers
-3 -1: exc
-27 -1: ()Lsun/misc/JavaLangAccess;
-5 -1: State
-14 -1: NullComparator
-10 -1: getClassAt
-15 -1: printProperties
-110 -1: (Ljava/lang/Class;[Ljava/lang/Class;[Ljava/lang/Class;IILjava/lang/String;[B[B)Ljava/lang/reflect/Constructor;
-40 -1: (Ljava/util/List<*>;Ljava/util/Random;)V
-63 -1: ()[Ljava/lang/reflect/TypeVariable<Ljava/lang/reflect/Method;>;
-28 -1: (I)Ljava/lang/StringBuilder;
-48 -1: ([DIILjava/util/function/DoubleBinaryOperator;)V
-3 -1: exp
-11 -1: interpret_L
-17 -1: Serializable.java
-8 -1: FJDouble
-12 -1: HashMap.java
-9 -1: sys_paths
-17 -1: getMainAttributes
-14 -1: asDoubleBuffer
-10 -1: buildNames
-26 -1: TOPLEVEL_WINDOW_PERMISSION
-4 -1: Type
-31 -1: (Ljava/util/Collection<+TE;>;)V
-64 -1: (Ljava/lang/String;ZLjava/lang/ClassLoader;)Ljava/lang/Class<*>;
-100 -1: <E:Ljava/lang/Object;>(Ljava/util/Collection<TE;>;Ljava/lang/Class<TE;>;)Ljava/util/Collection<TE;>;
-10 -1: checkError
-31 -1: (Ljava/util/Collection<+TE;>;)Z
-31 -1: java/lang/NoSuchMethodException
-6 -1: attach
-87 -1: (BLjava/lang/Class;Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle;
-9 -1: writeChar
-44 -1: java/util/ArraysParallelSortHelpers$FJObject
-34 -1: (Ljava/lang/Class;Ljava/io/File;)Z
-21 -1: java/util/zip/ZipFile
-5 -1: dirty
-6 -1: (JIZ)V
-12 -1: leftoverChar
-39 -1: is being loaded in another classloader
-10 -1: writeBytes
-6 -1: unlink
-41 -1: (TT;Ljava/lang/ref/ReferenceQueue<TT;>;)V
-21 -1: getBootstrapResources
-95 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/AbstractMap<TK;TV;>;Ljava/io/Serializable;
-10 -1: PathStatus
-25 -1: java/io/InputStreamReader
-15 -1: ISO_8859-9:1989
-37 -1: java/lang/ExceptionInInitializerError
-14 -1: exceptionTypes
-19 -1: BufferedReader.java
-34 -1: Could not create SecurityManager:
-13 -1: definePackage
-12 -1: getAndAddInt
-50 -1: (Ljava/lang/Class;)Ljava/lang/invoke/MethodHandle;
-30 -1: (Ljava/lang/SecurityManager;)V
-12 -1: fxLaunchName
-22 -1: BINARYSEARCH_THRESHOLD
-29 -1: JVMTI_THREAD_STATE_TERMINATED
-9 -1: fullFence
-60 -1: (Ljava/lang/String;Z)Ljava/util/Enumeration<Ljava/net/URL;>;
-29 -1: java/lang/Thread$WeakClassKey
-47 -1: (Ljava/nio/charset/Charset;Ljava/lang/String;)V
-8 -1: (TV;)TV;
-60 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Object;I)V
-47 -1: java/security/cert/CertificateEncodingException
-12 -1: BA_DIRECTORY
-53 -1: (Ljava/lang/Class;ZLjava/lang/Class;)Ljava/util/List;
-9 -1: checkRead
-6 -1: <init>
-4 -1: args
-17 -1: genericMethodType
-10 -1: writeFloat
-26 -1: Can't handle static method
-49 -1: (Ljava/lang/String;)Ljava/lang/invoke/MethodType;
-22 -1: MapReduceKeysToIntTask
-17 -1: jvm_micro_version
-29 -1: (Ljava/util/Map<+TK;+TV;>;Z)V
-40 -1: ([Ljava/lang/Object;Ljava/lang/Object;)I
-7 -1: vmindex
-22 -1: maybeCompileToBytecode
-89 -1: Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater$AtomicReferenceFieldUpdaterImpl;
-11 -1: getLauncher
-17 -1: jvm_major_version
-36 -1: ([IIII)Ljava/util/Spliterator$OfInt;
-40 -1: ([Ljava/lang/Object;Ljava/lang/Object;)V
-33 -1: IllegalMonitorStateException.java
-73 -1: ([ILjava/util/function/IntUnaryOperator;)Ljava/util/function/IntConsumer;
-39 -1: (Ljava/lang/String;)Ljava/lang/Package;
-29 -1: java/lang/CharacterDataLatin1
-52 -1: (Ljava/lang/annotation/Annotation;)Ljava/lang/Class;
-49 -1: (Ljava/lang/CharSequence;II)Ljava/nio/CharBuffer;
-53 -1: (Ljava/lang/Object;)Ljava/nio/charset/CharsetDecoder;
-22 -1: Ljava/net/FileNameMap;
-16 -1: isAnonymousClass
-4 -1: item
-7 -1: compute
-12 -1: user.country
-22 -1: malformed context url:
-16 -1: jvm_build_number
-69 -1: (Ljava/lang/ThreadLocal;)Ljava/lang/ThreadLocal$ThreadLocalMap$Entry;
-17 -1: getDirectionality
-4 -1: save
-8 -1: UNMARKED
-58 -1: (Ljava/lang/String;Ljava/lang/Object;[Ljava/lang/Object;)V
-12 -1: searchFields
-9 -1: frequency
-23 -1: getLocalizedInputStream
-2 -1:
-126 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Object;ILjava/lang/Class<*>;)Ljava/util/List<Ljava/lang/invoke/MemberName;>;
-39 -1: (Ljava/lang/String;Z)Ljava/lang/String;
-7 -1: setZone
-2 -1: "
-9 -1: checkRef(
-11 -1: loadFromXML
-49 -1: (Ljava/util/jar/JarFile;Ljava/util/Enumeration;)V
-68 -1: (IILsun/util/calendar/CalendarDate;)Lsun/util/calendar/CalendarDate;
-2 -1: (
-54 -1: (Ljava/util/TimeZone;)Lsun/util/calendar/CalendarDate;
-6 -1: rewind
-13 -1: getAndSetLong
-30 -1: java/lang/invoke/MethodHandles
-11 -1: ListPattern
-97 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractList<TE;>;Ljava/util/RandomAccess;Ljava/io/Serializable;
-25 -1: (Ljava/io/InputStream;I)V
-9 -1: setMethod
-10 -1: H_REG_NAME
-39 -1: ([Ljava/lang/Object;)Ljava/lang/Object;
-16 -1: AbstractMap.java
-68 -1: Ljava/util/Hashtable<Ljava/lang/String;Ljava/net/URLStreamHandler;>;
-58 -1: (Ljava/lang/String;[Ljava/lang/String;)Ljava/lang/Process;
-23 -1: getFileSystemAttributes
-12 -1: toSurrogates
-2 -1: !/
-5 -1: empty
-24 -1: isUnicodeIdentifierStart
-35 -1: sun/nio/cs/StandardCharsets$Classes
-27 -1: [Ljava/security/Permission;
-13 -1: getDefinition
-11 -1: permission=
-42 -1: (ILjava/lang/String;)Ljava/nio/ByteBuffer;
-69 -1: (Ljava/util/List<Ljava/lang/Class<*>;>;)Ljava/lang/invoke/MethodType;
-3 1: zzz
-17 -1: hasLongPrimitives
-2 -1: !=
-13 -1: getInterfaces
-2 -1: "
-11 -1: noInflation
-14 -1: aliases_UTF_16
-2 -1: ")
-17 -1: ()Ljava/util/Map;
-55 -1: ()Ljava/util/Map<Ljava/lang/String;Ljava/lang/String;>;
-6 -1: charAt
-12 -1: getStringAt0
-10 -1: superClone
-28 -1: Ljava/util/AbstractSet<TK;>;
-40 -1: java/lang/ref/Reference$ReferenceHandler
-22 -1: NaturalOrderComparator
-9 -1: markValue
-9 -1: getRegion
-26 -1: null permissions parameter
-17 -1: Ljava/util/Stack;
-14 -1: codebase=<URL>
-36 -1: (Ljava/util/List;)Ljava/lang/Object;
-17 -1: setJavaLangAccess
-16 -1: hasQueuedThreads
-5 -1: (CC)I
-8 -1: toString
-5 -1: (CC)J
-11 -1: permissions
-10 -1: getHeaders
-27 -1: java/io/BufferedInputStream
-21 -1: unicodelittleunmarked
-51 -1: (Ljava/net/URLClassLoader;Ljava/util/Enumeration;)V
-14 -1: generateMethod
-11 -1: skipForward
-55 -1: java/util/concurrent/ConcurrentHashMap$ForEachEntryTask
-5 -1: (CC)Z
-15 -1: getURLClassPath
-84 -1: Ljava/lang/invoke/MethodType$ConcurrentWeakInternSet<Ljava/lang/invoke/MethodType;>;
-23 -1: primitiveParameterCount
-8 -1: security
-14 -1: aliases_UTF_32
-22 -1: ()Ljava/util/Set<TK;>;
-9 -1: listFiles
-15 -1: insertElementAt
-42 -1: Ljava/util/Comparator<Ljava/lang/String;>;
-11 -1: getUserInfo
-46 -1: ([JIILjava/util/function/LongBinaryOperator;)V
-23 -1: (Ljava/util/Iterator;)V
-46 -1: ([Ljava/lang/Object;II)Ljava/util/Spliterator;
-67 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Object;)Ljava/lang/Object;
-14 -1: normalizeMonth
-13 -1: getStackTrace
-51 -1: java/lang/invoke/MethodType$ConcurrentWeakInternSet
-8 -1: makeChar
-2 -1: %%
-9 -1: getTarget
-21 -1: packageDefinitionLock
-52 -1: java/util/concurrent/ConcurrentHashMap$ValueIterator
-12 -1: OTHER_NUMBER
-22 -1: java/util/jar/JarEntry
-11 -1: access$1000
-16 -1: NON_SPACING_MARK
-13 -1: last-modified
-68 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction<Ljava/lang/Void;>;
-16 -1: Australia/Darwin
-55 -1: (Ljava/lang/management/ThreadInfo;[Ljava/lang/Object;)V
-29 -1: Ljava/lang/ref/WeakReference;
-19 -1: expungeStaleEntries
-41 -1: Ljava/security/PrivilegedActionException;
-6 -1: update
-23 -1: (Ljava/lang/Object;JB)V
-10 -1: newUpdater
-39 -1: (Ljava/net/URL;)Ljava/util/jar/JarFile;
-25 -1: Ljava/net/ContentHandler;
-21 -1: ARRAY_INT_INDEX_SCALE
-13 -1: hasSurrogates
-27 -1: (Ljava/lang/ThreadGroup;Z)Z
-20 -1: createGCNotification
-21 -1: negative day of week
-11 -1: getInIfOpen
-22 -1: java/util/RandomAccess
-24 -1: available locales =
-21 -1: AccessController.java
-44 -1: can not access a protected member of class
-4 -1: LONG
-15 -1: objectOnlyTypes
-75 -1: (Ljava/io/InputStream;Ljava/lang/Object;Ljava/nio/charset/CharsetDecoder;)V
-14 -1: getFindClasses
-10 -1: storeFence
-16 -1: asNormalOriginal
-45 -1: (Ljava/lang/String;)Ljava/lang/StringBuilder;
-6 -1: millis
-16 -1: America/St_Johns
-38 -1: ()Ljava/lang/IllegalArgumentException;
-37 -1: DIRECTIONALITY_POP_DIRECTIONAL_FORMAT
-15 -1: implReplaceWith
-29 -1: ([C)Ljava/lang/StringBuilder;
-15 -1: Appendable.java
-41 -1: (Ljava/lang/String;)Ljava/io/InputStream;
-26 -1: Illegal Initial Capacity:
-9 -1: checkBase
-7 -1: setYear
-15 -1: DISPLAY_VARIANT
-7 -1: getType
-31 -1: Ljava/lang/ref/Reference<+TT;>;
-15 -1: isFieldOrMethod
-35 -1: appendToClassPathForInstrumentation
-16 -1: LocaleNameGetter
-7 -1: compact
-55 -1: ()Ljava/util/Map<Ljava/lang/String;Ljava/lang/Object;>;
-10 -1: dummyQueue
-3 -1: ROC
-2 -1: ("
-15 -1: checkPermission
-38 -1: java/util/zip/ZipFile$ZipEntryIterator
-8 -1: hexDigit
-8 -1: pairs:
-2 -1: ()
-2 -1: )\n
-43 -1: handler for url different from this handler
-15 -1: isAutoDetecting
-37 -1: (Ljava/util/LinkedList$Node<TE;>;)TE;
-11 -1: Unsafe.java
-12 -1: windows-1250
-39 -1: java/util/Collections$CheckedCollection
-12 -1: windows-1251
-15 -1: codePointAtImpl
-12 -1: windows-1252
-12 -1: windows-1253
-12 -1: windows-1254
-58 -1: (Ljava/lang/String;Ljava/lang/Integer;)Ljava/lang/Integer;
-5 -1: deref
-12 -1: windows-1255
-12 -1: windows-1256
-12 -1: windows-1257
-12 -1: windows-1258
-14 -1: FT_CHECKED_REF
-47 -1: (Ljava/util/Hashtable;Ljava/util/Hashtable$1;)V
-37 -1: (J)Lsun/util/calendar/Gregorian$Date;
-19 -1: checkPropertyAccess
-4 -1: file
-17 -1: emptyListIterator
-26 -1: sun/util/calendar/ZoneInfo
-14 -1: file.separator
-4 -1: fill
-62 -1: (Ljava/util/Spliterator$OfLong;Z)Ljava/util/stream/LongStream;
-18 -1: java/util/Iterator
-20 -1: reduceValuesToDouble
-12 -1: LF_CS_LINKER
-26 -1: java/util/Arrays$ArrayList
-45 -1: Ljava/util/concurrent/ConcurrentHashMap$Node;
-6 -1: skipLF
-2 -1: )=
-39 -1: (I[Ljava/lang/invoke/LambdaForm$Name;)I
-90 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;)V
-18 -1: parameterModifiers
-31 -1: (Ljava/util/Collection<+TK;>;)Z
-21 -1: proxy can not be null
-22 -1: java/io/FileDescriptor
-6 -1: Loader
-21 -1: numberOfTrailingZeros
-10 -1: addMapping
-39 -1: (I[Ljava/lang/invoke/LambdaForm$Name;)Z
-30 -1: java/util/Locale$LanguageRange
-20 -1: getReflectionFactory
-16 -1: shouldMeterInput
-56 -1: ([Ljava/lang/reflect/Method;)[Ljava/lang/reflect/Method;
-23 -1: sun/net/ProgressMonitor
-510 -1: \xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\x01\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\x01\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80
-28 -1: java/util/Spliterator$OfLong
-24 -1: SynchronizedNavigableMap
-4 -1: find
-6 -1: unsafe
-31 -1: java/nio/ByteBufferAsIntBufferB
-2 -1: ,\n
-6 -1: [ call
-14 -1: registerFilter
-10 -1: ValuesView
-9 -1: untreeify
-59 -1: ([Ljava/lang/Object;IILjava/util/function/BinaryOperator;)V
-13 -1: getSimpleName
-41 -1: (Ljava/util/Vector;Ljava/util/Vector$1;)V
-31 -1: java/nio/ByteBufferAsIntBufferL
-45 -1: (Ljava/lang/reflect/Field;)Ljava/lang/Object;
-13 -1: getDefaultRef
-18 -1: mapAlternativeName
-30 -1: setDefaultAllowUserInteraction
-13 -1: cannotCastMsg
-4 -1: )=>{
-7 -1: println
-2 -1: ,
-70 -1: (Ljava/nio/Buffer;IILjava/nio/Buffer;II)Ljava/nio/charset/CoderResult;
-32 -1: (ILjava/util/Collection<+TE;>;)Z
-9 -1: interpret
-104 -1: <E:Ljava/lang/Object;>(Ljava/util/NavigableSet<TE;>;Ljava/lang/Class<TE;>;)Ljava/util/NavigableSet<TE;>;
-7 -1: advance
-86 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction<Ljava/lang/reflect/Field;>;
-11 -1: Stack trace
-6 -1: raise0
-68 -1: ()Ljava/util/Collections$UnmodifiableNavigableMap$EmptyNavigableMap;
-32 -1: sun/util/calendar/Gregorian$Date
-33 -1: java/lang/ref/ReferenceQueue$Lock
-19 -1: constructorAccessor
-6 -1: IBM367
-18 -1: CharacterData.java
-8 -1: parseURL
-32 -1: java/io/FilePermissionCollection
-7 -1: ([JI)[J
-9 -1: JIS_X0201
-2 -1: -1
-8 -1: encoding
-63 -1: ([Ljava/util/WeakHashMap$Entry;[Ljava/util/WeakHashMap$Entry;)V
-9 -1: localhost
-66 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;Ljava/lang/ThreadLocal$1;)V
-54 -1: (II[Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
-67 -1: (Ljava/lang/Class;Ljava/lang/Class;)Ljava/lang/invoke/MethodHandle;
-14 -1: containsAllPDs
-23 -1: setAllowUserInteraction
-30 -1: Ljava/security/DomainCombiner;
-26 -1: Ljava/security/Permission;
-30 -1: serializePropertiesToByteArray
-112 -1: (Ljava/util/Iterator<Ljava/nio/charset/Charset;>;Ljava/util/Map<Ljava/lang/String;Ljava/nio/charset/Charset;>;)V
-2 -1: ..
-6 -1: LOCEXT
-2 -1: ./
-26 -1: (Ljava/nio/ByteBuffer;II)V
-18 -1: (Ljava/io/File;J)Z
-45 -1: (Ljava/lang/StringBuffer;Ljava/lang/String;)V
-17 -1: asCollectorChecks
-7 -1: actions
-5 -1: ([I)I
-20 -1: asChange_otherthread
-20 -1: forInputStreamReader
-69 -1: java/util/concurrent/locks/AbstractQueuedSynchronizer$ConditionObject
-5 -1: FINAL
-17 -1: staticPermissions
-44 -1: (Ljava/lang/Object;)Ljava/lang/StringBuffer;
-5 -1: ([I)V
-4 -1: swap
-10 -1: readOffset
-2 -1: /*
-112 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<-TK;+TU;>;Ljava/util/function/BiFunction<-TU;-TU;+TU;>;)TU;
-12 -1: isAsciiDigit
-2 -1: /-
-2 -1: /.
-2 -1: //
-5 -1: zones
-37 -1: (ILjava/lang/Object;)Ljava/util/List;
-17 -1: SHUFFLE_THRESHOLD
-32 -1: java/lang/CharacterDataUndefined
-23 -1: sun.reflect.noInflation
-11 -1: Can not set
-36 -1: (Ljava/util/Properties$LineReader;)V
-9 -1: debugName
-78 -1: (Ljava/util/HashMap$Node;Ljava/util/HashMap$Node;)Ljava/util/HashMap$TreeNode;
-6 -1: (III)J
-58 -1: (Ljava/util/List;Ljava/util/Collection;)Ljava/lang/String;
-19 -1: BufferedWriter.java
-148 -1: <T:Ljava/lang/Object;>(Ljava/lang/Class<TT;>;[Ljava/lang/Class<*>;[Ljava/lang/Class<*>;IILjava/lang/String;[B[B)Ljava/lang/reflect/Constructor<TT;>;
-6 -1: printf
-7 -1: signers
-2 -1: 0.
-4 -1: Date
-15 -1: findReplacement
-6 -1: (III)V
-32 -1: java/nio/ReadOnlyBufferException
-92 -1: ([Ljava/lang/String;)Ljava/util/Map<Ljava/lang/String;Ljava/util/List<Ljava/lang/String;>;>;
-6 -1: (III)Z
-43 -1: (Ljava/lang/ClassValue;Ljava/lang/Object;)V
-32 -1: java/nio/ByteBufferAsLongBufferB
-16 -1: Constructor.java
-10 -1: removeLast
-9 -1: ([CII[B)I
-40 -1: ()Ljava/util/List<Ljava/lang/Class<*>;>;
-2 -1: 1.
-7 -1: VARARGS
-32 -1: java/nio/ByteBufferAsLongBufferL
-18 -1: java/lang/Shutdown
-40 -1: not supported, using ISO-8859-1 instead
-40 -1: Ljava/util/Collections$EmptyEnumeration;
-146 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/SortedMap<TK;TV;>;Ljava/lang/Class<TK;>;Ljava/lang/Class<TV;>;)Ljava/util/SortedMap<TK;TV;>;
-20 -1: aliases_UTF_32LE_BOM
-23 -1: getEnclosingConstructor
-2 -1: 0X
-11 -1: NO_TIMEZONE
-37 -1: ()Lsun/misc/JavaNioAccess$BufferPool;
-18 -1: printXUsageMessage
-9 -1: isPrivate
-63 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/invoke/MethodHandle;)V
-17 -1: maxSkipBufferSize
-76 -1: (Ljava/io/OutputStream;Ljava/lang/Object;Ljava/nio/charset/CharsetEncoder;)V
-40 -1: (Ljava/lang/String;II)Ljava/lang/String;
-17 -1: selectAlternative
-53 -1: [Ljava/util/concurrent/ConcurrentHashMap$CounterCell;
-87 -1: <S:Ljava/lang/Object;>(Ljava/util/function/Supplier<+TS;>;)Ljava/lang/ThreadLocal<TS;>;
-40 -1: Ljava/util/concurrent/ConcurrentHashMap;
-41 -1: (Ljava/lang/Character;)Ljava/lang/String;
-19 -1: getMemberRefInfoAt0
-14 -1: reduceToDouble
-18 -1: SUPPRESSED_CAPTION
-6 -1: CANADA
-64 -1: (IZ[Ljava/lang/Class<*>;[Ljava/lang/Class<*>;)Ljava/lang/String;
-12 -1: UnicodeBlock
-2 -1: 0x
-44 -1: (Ljava/lang/CharSequence;II)Ljava/io/Writer;
-23 -1: getPermissionCollection
-19 -1: threadLocalHashCode
-9 -1: createMap
-25 -1: checkForSpecialAttributes
-12 -1: Mark invalid
-36 -1: java/lang/CharSequence$1CharIterator
-11 -1: local time
-16 -1: Enumeration.java
-27 -1: (Ljava/util/zip/ZipEntry;)V
-11 -1: MATH_SYMBOL
-8 -1: filename
-24 -1: (Ljava/util/List<*>;II)V
-9 -1: bindCache
-18 -1: java/io/FileFilter
-12 -1: checkInvoker
-18 -1: OSEnvironment.java
-8 -1: EmptyMap
-11 -1: getIterator
-35 -1: java/util/function/IntUnaryOperator
-35 -1: java/util/WeakHashMap$EntryIterator
-90 -1: <E:Ljava/lang/Object;>(Ljava/util/Queue<TE;>;Ljava/lang/Class<TE;>;)Ljava/util/Queue<TE;>;
-8 -1: batchFor
-16 -1: isValidCodePoint
-27 -1: ([Lsun/util/calendar/Era;)V
-16 -1: ThreadGroup.java
-33 2: sun/net/www/protocol/file/Handler
-7 -1: isField
-22 -1: sun/misc/OSEnvironment
-38 -1: Ljava/lang/Class<Ljava/lang/Boolean;>;
-12 -1: ADDRESS_SIZE
-8 -1: forDigit
-49 -1: (Ljava/lang/Object;)Ljava/util/WeakHashMap$Entry;
-13 -1: getCodeSource
-41 -1: ([Ljava/lang/Class<*>;)Ljava/lang/String;
-39 -1: (Ljava/util/function/Predicate<-TE;>;)Z
-13 -1: asFloatBuffer
-34 -1: ()Lsun/reflect/generics/tree/Tree;
-3 -1: ftp
-18 -1: maybeReBoxElements
-82 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/Class;)[[Ljava/lang/annotation/Annotation;
-48 -1: ()Ljava/util/Set<Ljava/util/Map$Entry<TK;TV;>;>;
-27 -1: (Ljava/util/NavigableMap;)V
-18 -1: parameterSlotCount
-20 -1: NF_getCallSiteTarget
-16 -1: aliases_US_ASCII
-13 -1: NF_staticBase
-31 -1: sun/reflect/ConstructorAccessor
-26 -1: guessContentTypeFromStream
-10 -1: Deprecated
-35 -1: System initialization has completed
-11 -1: initialized
-7 -1: compare
-15 -1: maxDirectMemory
-19 -1: setLastModifiedTime
-7 -1: (J[BZ)J
-12 -1: readEpochSec
-66 -1: (Ljava/lang/String;Ljava/lang/String;)Lsun/util/locale/BaseLocale;
-69 -1: ()Lsun/misc/JavaSecurityProtectionDomainAccess$ProtectionDomainCache;
-9 -1: Constants
-11 -1: valueOffset
-62 -1: (Ljava/util/Hashtable<Ljava/lang/String;Ljava/lang/Object;>;)V
-33 -1: java/lang/CharacterDataPrivateUse
-21 -1: Exception in thread "
-40 -1: ()Ljava/util/Set<Ljava/lang/Character;>;
-12 -1: Asia/Yerevan
-40 -1: (Ljava/lang/Throwable;)Ljava/lang/Error;
-25 -1: (IS)Ljava/nio/ByteBuffer;
-7 -1: (I[CI)I
-45 -1: java/nio/charset/UnmappableCharacterException
-23 -1: java/util/WeakHashMap$1
-21 -1: setFXLaunchParameters
-1250 -1: ADANDAEAREAFAFGAGATGAIAIAALALBAMARMANANTAOAGOAQATAARARGASASMATAUTAUAUSAWABWAXALAAZAZEBABIHBBBRBBDBGDBEBELBFBFABGBGRBHBHRBIBDIBJBENBLBLMBMBMUBNBRNBOBOLBQBESBRBRABSBHSBTBTNBVBVTBWBWABYBLRBZBLZCACANCCCCKCDCODCFCAFCGCOGCHCHECICIVCKCOKCLCHLCMCMRCNCHNCOCOLCRCRICUCUBCVCPVCWCUWCXCXRCYCYPCZCZEDEDEUDJDJIDKDNKDMDMADODOMDZDZAECECUEEESTEGEGYEHESHERERIESESPETETHFIFINFJFJIFKFLKFMFSMFOFROFRFRAGAGABGBGBRGDGRDGEGEOGFGUFGGGGYGHGHAGIGIBGLGRLGMGMBGNGINGPGLPGQGNQGRGRCGSSGSGTGTMGUGUMGWGNBGYGUYHKHKGHMHMDHNHNDHRHRVHTHTIHUHUNIDIDNIEIRLILISRIMIMNININDIOIOTIQIRQIRIRNISISLITITAJEJEYJMJAMJOJORJPJPNKEKENKGKGZKHKHMKIKIRKMCOMKNKNAKPPRKKRKORKWKWTKYCYMKZKAZLALAOLBLBNLCLCALILIELKLKALRLBRLSLSOLTLTULULUXLVLVALYLBYMAMARMCMCOMDMDAMEMNEMFMAFMGMDGMHMHLMKMKDMLMLIMMMMRMNMNGMOMACMPMNPMQMTQMRMRTMSMSRMTMLTMUMUSMVMDVMWMWIMXMEXMYMYSMZMOZNANAMNCNCLNENERNFNFKNGNGANINICNLNLDNONORNPNPLNRNRUNUNIUNZNZLOMOMNPAPANPEPERPFPYFPGPNGPHPHLPKPAKPLPOLPMSPMPNPCNPRPRIPSPSEPTPRTPWPLWPYPRYQAQATREREUROROURSSRBRURUSRWRWASASAUSBSLBSCSYCSDSDNSESWESGSGPSHSHNSISVNSJSJMSKSVKSLSLESMSMRSNSENSOSOMSRSURSSSSDSTSTPSVSLVSXSXMSYSYRSZSWZTCTCATDTCDTFATFTGTGOTHTHATJTJKTKTKLTLTLSTMTKMTNTUNTOTONTRTURTTTTOTVTUVTWTWNTZTZAUAUKRUGUGAUMUMIUSUSAUYURYUZUZBVAVATVCVCTVEVENVGVGBVIVIRVNVNMVUVUTWFWLFWSWSMYEYEMYTMYTZAZAFZMZMBZWZWE
-60 -1: Ljava/util/Set<Ljava/lang/Class<+Ljava/lang/ClassLoader;>;>;
-24 -1: ()Ljava/security/Policy;
-7 -1: initted
-44 -1: java/util/Collections$UnmodifiableCollection
-12 -1: Pacific/Apia
-23 -1: checkProxyPackageAccess
-7 -1: (I[CI)V
-64 -1: ([Ljava/lang/Object;IILjava/lang/Object;Ljava/util/Comparator;)I
-16 -1: getJavaNioAccess
-7 -1: reverse
-7 -1: nocerts
-16 -1: activeGroupCount
-34 -1: java/util/jar/JarFile$JarFileEntry
-7 -1: loaders
-9 -1: toRadians
-24 -1: java/util/HashMap$KeySet
-37 -1: (Ljava/lang/Class;)Ljava/lang/Object;
-6 -1: getRef
-6 -1: H_DASH
-17 -1: LinkageError.java
-66 -1: (Ljava/lang/invoke/MethodTypeForm;)Ljava/lang/invoke/MethodHandle;
-41 -1: (Ljava/nio/ByteBuffer;)Ljava/util/BitSet;
-10 -1: addMinutes
-58 -1: <T:Ljava/lang/Object;>([TT;II)Ljava/util/Spliterator<TT;>;
-9 -1: parseJars
-13 -1: getUnsignedCS
-28 -1: (Ljava/util/AbstractList;I)V
-22 -1: threadLocalRandomProbe
-19 -1: newDirectByteBuffer
-27 -1: Filter already registered:
-8 -1: unescape
-31 -1: sun/misc/URLClassPath$JarLoader
-6 -1: TAIWAN
-53 -1: <T:Ljava/lang/Object;>()Ljava/util/ListIterator<TT;>;
-17 -1: REVERSE_THRESHOLD
-31 -1: Java(TM) SE Runtime Environment
-7 -1: SECONDS
-70 -1: (Ljava/util/function/ToLongFunction<-TT;>;)Ljava/util/Comparator<TT;>;
-7 -1: BLOCKED
-6 -1: Caches
-63 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MethodHandle;)V
-2 -1: :
-210 -1: (Ljava/util/Map<Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;Ljava/lang/annotation/Annotation;>;Ljava/util/Map<Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;Ljava/lang/annotation/Annotation;>;I)V
-153 -1: (JLjava/util/function/BiFunction<Ljava/util/Map$Entry<TK;TV;>;Ljava/util/Map$Entry<TK;TV;>;+Ljava/util/Map$Entry<TK;TV;>;>;)Ljava/util/Map$Entry<TK;TV;>;
-22 -1: ()Ljava/lang/Class<*>;
-28 -1: Ljava/lang/OutOfMemoryError;
-19 -1: writeFileDescriptor
-39 -1: Ljava/util/LinkedHashMap$Entry<TK;TV;>;
-26 -1: (ILjava/util/Collection;)Z
-18 -1: getEncodedInternal
-16 -1: ForEachValueTask
-23 -1: (Ljava/util/List<*>;I)V
-19 -1: SharedArchiveLoader
-20 -1: probeBackupLocations
-24 -1: java/lang/StringCoding$1
-28 -1: lookupContentHandlerClassFor
-36 -1: ()Lsun/misc/Launcher$ExtClassLoader;
-27 -1: reflectionFactoryAccessPerm
-14 -1: ACCESSOR_FORMS
-35 -1: ([JII)Ljava/util/stream/LongStream;
-34 -1: ISO-8859-1 charset not available:
-8 -1: cscesu-8
-2 -1: ;/
-17 -1: typeToPackageName
-34 -1: (Ljava/net/URL;)Ljava/lang/String;
-5 -1: (IZ)V
-25 -1: Prohibited package name:
-51 -1: (Ljava/lang/Object;Ljava/lang/ref/ReferenceQueue;)V
-108 -1: (JLjava/util/function/ToIntFunction<Ljava/util/Map$Entry<TK;TV;>;>;ILjava/util/function/IntBinaryOperator;)I
-12 -1: soleInstance
-27 -1: (Ljava/io/BufferedReader;)V
-71 -1: (Ljava/nio/charset/CodingErrorAction;)Ljava/nio/charset/CharsetDecoder;
-17 -1: Ljava/lang/Class;
-38 -1: (Ljava/lang/String;)Ljava/lang/Double;
-10 -1: viewAsType
-22 -1: (Ljava/io/DataInput;)I
-22 -1: (Ljava/io/DataInput;)J
-105 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/WrongMethodTypeException;
-16 -1: setJavaNetAccess
-73 -1: (ILjava/lang/Object;Ljava/lang/Object;ZZ)Ljava/util/HashMap$Node<TK;TV;>;
-22 -1: (Ljava/io/DataInput;)V
-14 -1: getHostAddress
-37 -1: sun/reflect/annotation/TypeAnnotation
-14 -1: ENCLOSING_MARK
-5 -1: FALSE
-14 -1: preDefineClass
-9 -1: newKeySet
-18 -1: getWaitQueueLength
-32 -1: ()Lsun/misc/URLClassPath$Loader;
-54 -1: (Ljava/nio/CharBuffer;I)Ljava/nio/charset/CoderResult;
-3 -1: SEP
-45 -1: (ITK;TV;Ljava/util/Hashtable$Entry<TK;TV;>;)V
-17 -1: getDeclaredFields
-7 -1: getDate
-10 -1: getClasses
-240 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceEntriesToIntTask;Ljava/util/function/ToIntFunction;ILjava/util/function/IntBinaryOperator;)V
-12 -1: WeakClassKey
-14 -1: LF_GEN_INVOKER
-25 -1: Ljava/lang/StringBuilder;
-2 -1: >
-9 -1: getJarMap
-4 -1: asin
-37 -1: (Ljava/net/URLStreamHandlerFactory;)V
-30 -1: not a constructor type or name
-4 -1: main
-22 -1: java/io/FilenameFilter
-22 -1: sun.java.launcher.diag
-30 -1: ()Ljava/util/Spliterator<TE;>;
-57 -1: <T::Ljava/lang/Comparable<-TT;>;>(Ljava/util/List<TT;>;)V
-86 -1: <T:Ljava/lang/Object;>(Ljava/lang/ThreadLocal<Ljava/lang/ref/SoftReference<TT;>;>;)TT;
-18 -1: canBeCalledVirtual
-9 -1: Shift_JIS
-24 -1: ()Ljava/util/ArrayDeque;
-32 -1: (Ljava/lang/Class$MethodArray;)V
-22 -1: java/lang/StringCoding
-33 -1: sun/util/locale/LocaleObjectCache
-20 -1: Sorry, deque too big
-38 -1: java/lang/Throwable$WrappedPrintWriter
-25 -1: (Ljava/io/InputStream;J)J
-44 -1: (Ljava/security/Permission;)Ljava/util/List;
-5 -1: thunk
-5 -1: props
-15 -1: getLastModified
-120 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/util/HashMap<Ljava/lang/String;Ljava/util/LinkedList<Ljava/lang/String;>;>;)V
-146 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MemberName;Ljava/lang/Class;Ljava/lang/invoke/MethodHandleImpl$1;)V
-27 -1: parseExtensionsDependencies
-10 -1: getRawType
-39 -1: (Ljava/nio/charset/CodingErrorAction;)V
-22 -1: ObjectStreamField.java
-6 -1: handle
-11 -1: hasPrevious
-18 -1: instanceof Float:
-52 -1: (ZLjava/io/OutputStream;Ljava/nio/charset/Charset;)V
-4 -1: make
-13 -1: isIdeographic
-26 -1: java/util/HashMap$EntrySet
-51 -1: (Ljava/util/Hashtable;)[Ljava/util/Hashtable$Entry;
-91 -1: (Ljava/lang/CharSequence;Ljava/lang/Iterable<+Ljava/lang/CharSequence;>;)Ljava/lang/String;
-13 -1: makeAllocator
-10 -1: , headless
-20 -1: expungeStaleElements
-58 -1: sun/reflect/annotation/TypeAnnotation$TypeAnnotationTarget
-41 -1: ([Ljava/lang/Object;Ljava/lang/Class$1;)V
-50 -1: <T:Ljava/lang/Object;>(I)Ljava/util/Iterator<TT;>;
-7 -1: TreeBin
-21 -1: Ljava/io/IOException;
-56 -1: (I[Ljava/lang/Class;)[Ljava/lang/invoke/LambdaForm$Name;
-6 -1: LOCFLG
-6 -1: DIRECT
-3 -1: SIG
-37 -1: java/security/NoSuchProviderException
-39 -1: " with illegal data type conversion to
-16 -1: getCodeSourceURL
-51 -1: java/util/concurrent/ConcurrentHashMap$EntrySetView
-47 -1: (Ljava/util/ArrayList;Ljava/util/ArrayList$1;)V
-6 -1: delete
-38 -1: sun/reflect/UnsafeFieldAccessorFactory
-11 -1: isDestroyed
-140 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;ILjava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$Node;)Z
-9 -1: unaligned
-36 -1: ()Lsun/misc/Launcher$AppClassLoader;
-57 -1: (Ljava/lang/String;Ljava/util/Locale;)[Ljava/lang/String;
-37 -1: sun/reflect/annotation/AnnotationType
-49 -1: <T:Ljava/lang/Object;>([TT;)Ljava/util/List<TT;>;
-24 -1: (S)Ljava/nio/ByteBuffer;
-6 -1: ([DD)I
-9 -1: setTarget
-29 -1: (IF)Ljava/lang/StringBuilder;
-12 -1: forBasicType
-10 -1: (IIII[BI)V
-8 -1: ([DIID)I
-9 -1: BASE_YEAR
-19 -1: ()Ljava/lang/Error;
-42 -1: (Ljava/util/Map<TE;Ljava/lang/Boolean;>;)V
-6 -1: ([DD)V
-14 -1: Illegal size:
-8 -1: ([DIID)V
-7 -1: (II[I)I
-17 -1: java_profile_name
-28 -1: java/util/AbstractCollection
-43 -1: (Ljava/net/URL;)[Ljava/security/CodeSource;
-62 -1: (Lsun/misc/URLClassPath$JarLoader;)Ljava/net/URLStreamHandler;
-33 -1: [Ljava/util/HashMap$Node<TK;TV;>;
-15 -1: (Native Method)
-11 -1: fileNameMap
-26 -1: ()Ljava/util/ListIterator;
-25 -1: java/util/LinkedList$Node
-18 -1: SELECT_ALTERNATIVE
-35 -1: (Ljava/lang/Object;)Ljava/util/Set;
-19 -1: java/io/IOException
-16 -1: : already loaded
-9 -1: image/gif
-6 -1: (TE;)I
-25 -1: (Ljava/util/Properties;)V
-40 -1: (Ljava/lang/String;)Ljava/nio/file/Path;
-19 -1: checkedNavigableMap
-9 -1: checkInt(
-17 -1: getContentTypeFor
-26 -1: ()Ljava/io/FileDescriptor;
-69 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/ref/ReferenceQueue;)V
-6 -1: (TE;)V
-25 -1: WARNING: Default charset
-14 -1: ZipFile closed
-2 -1: CA
-6 -1: (TE;)Z
-64 -1: java/util/concurrent/ConcurrentHashMap$MapReduceValuesToLongTask
-15 -1: FileSystem.java
-75 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)V
-10 -1: FileLoader
-44 -1: (Lsun/util/PreHashedMap;)[Ljava/lang/Object;
-19 -1: availableProcessors
-2 -1: CN
-36 -1: ([JII)Ljava/util/Spliterator$OfLong;
-11 -1: access$1100
-18 -1: getFieldAtIfLoaded
-30 -1: PrivilegedActionException.java
-6 -1: EUC-JP
-20 -1: (F)Ljava/lang/Float;
-22 -1: unable to instantiate
-31 -1: java/lang/reflect/ReflectAccess
-23 -1: (Ljava/lang/Object;JC)V
-3 -1: get
-59 -1: <T:Ljava/lang/Object;>([TT;IILjava/util/Comparator<-TT;>;)V
-2 -1: DE
-13 -1: GMT_ID_LENGTH
-7 -1: execute
-12 -1: MethodHandle
-18 -1: AllPermission.java
-54 -1: (Ljava/util/Locale;)Lsun/util/locale/LocaleExtensions;
-23 -1: MapReduceKeysToLongTask
-12 -1: varargsArray
-23 -1: java/util/jar/JarFile$1
-23 -1: java/util/jar/JarFile$2
-23 -1: java/util/jar/JarFile$3
-12 -1: getAndUpdate
-13 -1: reserveMemory
-17 -1: expungeStaleEntry
-6 -1: EUC-KR
-120 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/lang/ref/WeakReference<Ljava/lang/Object;>;Ljava/util/Map$Entry<TK;TV;>;
-69 -1: (Ljava/lang/StringBuffer;Ljava/lang/String;)Ljava/util/regex/Matcher;
-26 -1: ()Ljava/util/NavigableMap;
-7 -1: L_PCHAR
-23 -1: (Ljava/lang/String$1;)V
-4 -1: KEYS
-37 -1: (Ljava/util/List;Ljava/lang/Object;)I
-31 -1: Ljava/lang/ArithmeticException;
-15 -1: [Ljava/net/URL;
-37 -1: (Ljava/util/List;Ljava/lang/Object;)V
-18 -1: MAX_HIGH_SURROGATE
-6 -1: (JCZ)V
-4 -1: mark
-17 -1: setMethodAccessor
-21 -1: java/io/ExpiringCache
-21 -1: PrivilegedAction.java
-21 -1: MappedByteBuffer.java
-2 -1: FR
-10 -1: copyMemory
-8 -1: L_SERVER
-13 -1: assertionLock
-12 -1: searchValues
-46 -1: (Ljava/util/Collection<*>;Ljava/lang/Object;)I
-21 -1: ProtectionDomainCache
-32 -1: USE_PREDEFINED_INTERPRET_METHODS
-2 -1: GB
-16 -1: getFinalRefCount
-23 -1: Ljava/lang/ClassLoader;
-4 -1: mask
-94 -1: <T:Ljava/lang/Object;>(Ljava/util/function/ToDoubleFunction<-TT;>;)Ljava/util/Comparator<TT;>;
-4 -1: bind
-41 -1: (Ljava/lang/Class<*>;I)Ljava/lang/Object;
-9 -1: COUNT_GWT
-16 -1: DASH_PUNCTUATION
-24 -1: UNICODE_LOCALE_EXTENSION
-15 -1: checkInvariants
-10 -1: stringSize
-12 -1: deepHashCode
-30 -1: java/security/cert/Certificate
-19 -1: America/Los_Angeles
-19 -1: unmappableForLength
-6 -1: UTF-16
-10 -1: methodType
-21 -1: sun/misc/URLClassPath
-19 -1: META-INF/INDEX.LIST
-10 -1: jniVersion
-6 -1: IBM437
-29 -1: sun/reflect/FieldAccessorImpl
-21 -1: ()Ljava/lang/Package;
-32 -1: java/security/SecurityPermission
-57 -1: (Lsun/util/calendar/Era;)Lsun/util/calendar/CalendarDate;
-34 -1: [Ljava/util/concurrent/locks/Lock;
-11 -1: replacement
-20 -1: ()Ljava/lang/String;
-6 -1: resize
-12 -1: UTF_32BE_BOM
-26 -1: (Ljava/util/jar/JarFile;)V
-24 -1: DEFAULT_INITIAL_CAPACITY
-87 -1: (ILjava/lang/Object;Ljava/lang/Class;)Ljava/util/concurrent/ConcurrentHashMap$TreeNode;
-74 -1: (Ljava/util/jar/JarFile;)Ljava/util/Enumeration<Ljava/util/jar/JarEntry;>;
-18 -1: parameterSlotDepth
-26 -1: (Ljava/util/jar/JarFile;)Z
-18 -1: makePlatformString
-24 -1: doPrivilegedWithCombiner
-48 -1: (Ljava/lang/String;)Lsun/util/calendar/ZoneInfo;
-27 -1: ()Ljava/lang/ref/Reference;
-40 -1: java/util/ArrayList$ArrayListSpliterator
-67 -1: ([Ljava/lang/Object;IILjava/util/Comparator;[Ljava/lang/Object;II)V
-2 -1: ID
-19 -1: stringPropertyNames
-28 -1: (Ljava/util/Collections$1;)V
-12 -1: STATE_YELLOW
-12 -1: isNormalized
-10 -1: fromIndex(
-16 -1: getFloatVolatile
-37 -1: Lsun/util/calendar/BaseCalendar$Date;
-10 -1: properties
-17 -1: peakFinalRefCount
-102 -1: (Ljava/util/HashMap$Node<TK;TV;>;Ljava/util/HashMap$Node<TK;TV;>;)Ljava/util/HashMap$TreeNode<TK;TV;>;
-68 -1: (Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/DirectMethodHandle;
-2 -1: IT
-9 -1: ([BI[BI)V
-51 -1: scl permissions SecureClassLoader assigns
-36 -1: (Ljava/util/Set;Ljava/lang/Object;)V
-11 -1: ([SII[SII)V
-21 -1: sun.io.useCanonCaches
-18 -1: Illegal capacity:
-22 -1: (Ljava/lang/Integer;)I
-83 -1: ([Ljava/lang/Object;Ljava/lang/StringBuilder;Ljava/util/Set<[Ljava/lang/Object;>;)V
-65 -1: (Ljava/util/HashMap<TK;TV;>;[Ljava/util/HashMap$Node<TK;TV;>;II)V
-17 -1: java/util/Objects
-48 -1: (ILjava/util/List;)Ljava/lang/invoke/LambdaForm;
-31 -1: java/util/Properties$XmlSupport
-10 -1: L_LOWALPHA
-13 -1: long overflow
-25 -1: NullPointerException.java
-32 -1: (I)Ljava/lang/StackTraceElement;
-34 -1: ()[Ljava/lang/reflect/Constructor;
-2 -1: JP
-3 -1: SST
-12 -1: ShortCountry
-48 -1: (Ljava/util/stream/Collector;)Ljava/lang/Object;
-29 -1: Lsun/reflect/CallerSensitive;
-10 -1: addElement
-12 -1: lastReturned
-6 -1: putInt
-34 -1: sun.misc.JarIndex.metaInfFilenames
-13 -1: getBaseLocale
-20 -1: StringTokenizer.java
-8 -1: entrySet
-11 -1: getTypeName
-17 -1: America/Sao_Paulo
-5 -1: \t...
-35 -1: (Lsun/util/calendar/CalendarDate;)I
-28 -1: java/lang/StackOverflowError
-35 -1: (Lsun/util/calendar/CalendarDate;)J
-10 -1: logicalAnd
-18 -1: csISOLatinCyrillic
-43 -1: (Ljava/lang/String;II)Ljava/nio/CharBuffer;
-73 -1: (Ljava/lang/Class<*>;[Ljava/lang/Class<*>;Z)Ljava/lang/invoke/MethodType;
-14 -1: aliases_MS1250
-14 -1: aliases_MS1251
-17 -1: getImplMethodKind
-17 -1: getLastAccessTime
-14 -1: aliases_MS1252
-14 -1: aliases_MS1253
-35 -1: (Lsun/util/calendar/CalendarDate;)V
-2 -1: KR
-14 -1: aliases_MS1254
-14 -1: getGenericInfo
-8 -1: utf_32be
-14 -1: aliases_MS1257
-35 -1: (Lsun/util/calendar/CalendarDate;)Z
-13 -1: StringEncoder
-7 -1: LDT2037
-7 -1: generic
-2 -1: L9
-45 -1: ([DLjava/util/function/IntToDoubleFunction;)V
-17 -1: isOtherAlphabetic
-9 -1: implWrite
-24 -1: PC-Multilingual-850+euro
-12 -1: valueMatches
-78 -1: (Ljava/lang/String;Lsun/util/locale/ParseStatus;)Lsun/util/locale/LanguageTag;
-3 -1: gmt
-19 -1: (Ljava/io/Reader;)V
-25 -1: (JJ)Ljava/nio/ByteBuffer;
-7 -1: val$url
-26 -1: (Ljava/nio/ByteBuffer;IJ)V
-10 -1: isImplicit
-19 -1: getDeclaredClasses0
-4 -1: (I)B
-4 -1: (I)C
-4 -1: (I)D
-9 -1: byteValue
-4 -1: (I)F
-5 -1: ([J)I
-6 -1: isLive
-5 -1: sleep
-4 -1: (I)I
-4 -1: (I)J
-6 -1: outBuf
-77 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractCollection<TE;>;Ljava/util/Set<TE;>;
-4 -1: (I)S
-5 -1: ([J)V
-4 -1: (I)V
-30 -1: (I[C)Ljava/lang/StringBuilder;
-14 -1: intBitsToFloat
-4 -1: (I)Z
-15 -1: MethodType.java
-14 -1: resolveSibling
-9 -1: Enum.java
-111 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;[Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;)V
-14 -1: IS_CONSTRUCTOR
-4 -1: bits
-34 -1: java/security/PermissionCollection
-9 -1: autoFlush
-21 -1: java/util/Collections
-12 -1: bindReceiver
-20 -1: DMH.invokeStaticInit
-11 -1: charsetName
-14 -1: x-utf-32be-bom
-5 -1: cause
-7 -1: handle0
-43 -1: ([I[C[Ljava/lang/invoke/LambdaForm$Name;I)Z
-30 -1: getDefaultAllowUserInteraction
-18 -1: ConcurrentMap.java
-35 -1: (Ljava/lang/String;Z)Ljava/net/URL;
-33 -1: Ljava/nio/charset/CharsetDecoder;
-36 -1: java/lang/invoke/MethodHandleStatics
-34 -1: java/util/concurrent/ConcurrentMap
-16 -1: collectArguments
-22 -1: packageAssertionStatus
-79 -1: (JLjava/util/function/ToLongFunction;JLjava/util/function/LongBinaryOperator;)J
-39 -1: Cannot reflectively create enum objects
-62 -1: attempt to add a Permission to a readonly PermissionCollection
-22 -1: FieldAccessorImpl.java
-9 -1: ByteCache
-4 -1: TRUE
-85 -1: Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/Comparable<Ljava/lang/Character;>;
-17 -1: java.library.path
-7 -1: encoder
-21 -1: default locale =
-11 -1: secondOfDay
-37 -1: (Lsun/util/calendar/ZoneInfoFile$1;)V
-35 -1: sun/reflect/UnsafeFieldAccessorImpl
-24 -1: (Ljava/lang/Object;JJJ)V
-16 -1: countStackFrames
-24 -1: (Ljava/lang/Object;JJJ)Z
-17 -1: nonfairTryAcquire
-20 -1: ArrayListSpliterator
-5 -1: /DMH=
-68 -1: (Ljava/lang/CharSequence;Ljava/lang/CharSequence;)Ljava/lang/String;
-2 -1: PI
-8 -1: cspcp852
-112 -1: (Ljava/util/List<Ljava/util/Locale$LanguageRange;>;Ljava/util/Collection<Ljava/util/Locale;>;)Ljava/util/Locale;
-8 -1: cspcp855
-58 -1: (Ljava/lang/Object;JLjava/lang/Object;Ljava/lang/Object;)Z
-33 -1: sun/misc/PerfCounter$CoreCounters
-6 -1: CESU_8
-7 -1: vmslots
-4 -1: Init
-7 -1: handler
-11 -1: getProperty
-10 -1: isVolatile
-8 -1: ([J[IJ)I
-25 -1: ()Ljava/lang/ClassLoader;
-8 -1: asChange
-81 -1: (Ljava/net/URLClassLoader;Ljava/lang/String;Lsun/misc/Resource;)Ljava/lang/Class;
-12 -1: naturalOrder
-8 -1: getState
-40 -1: (Ljava/lang/Object;I)[Ljava/lang/String;
-36 -1: java/security/AccessControlException
-10 -1: linkBefore
-48 -1: (Ljava/util/HashMap;[Ljava/util/HashMap$Node;Z)V
-26 -1: (Ljava/util/WeakHashMap;)V
-23 -1: bad method type alias:
-7 -1: putChar
-18 -1: basicTypeSignature
-33 -1: sun/misc/InvalidJarIndexException
-13 -1: getPrivateuse
-14 -1: isConstantZero
-24 -1: java/io/FilePermission$1
-9 -1: Long.java
-19 -1: getLocaleExtensions
-10 -1: discovered
-17 -1: Invalid file path
-12 -1: MAX_MH_ARITY
-20 -1: observesDaylightTime
-31 -1: Ljava/lang/invoke/MethodHandle;
-6 -1: , end
-24 -1: java/io/FileDescriptor$1
-12 -1: loadLibrary.
-11 -1: Method.java
-12 -1: loadLibrary0
-23 -1: java/util/stream/Stream
-37 -1: sun.lang.ClassLoader.allowArraySyntax
-8 -1: appClass
-15 -1: FileReader.java
-5 -1: (IF)I
-29 -1: [Ljava/lang/ClassValue$Entry;
-12 -1: (principals
-30 -1: jar jar verification
-22 -1: ARRAY_CHAR_BASE_OFFSET
-18 -1: newDirectoryStream
-4 -1: atan
-5 -1: (IF)V
-24 -1: (Ljava/lang/Character;)I
-2 -1: TH
-10 -1: startsWith
-9 -1: baseCount
-13 -1: canonicalize0
-47 -1: (Ljava/lang/ClassLoader;[Ljava/lang/Class<*>;)V
-22 -1: Ljava/io/OutputStream;
-2 -1: TW
-10 -1: H_RESERVED
-19 -1: URLClassLoader.java
-16 -1: isAccessibleFrom
-59 -1: Ljava/util/Hashtable<Ljava/lang/Object;Ljava/lang/Object;>;
-33 -1: java/lang/invoke/ConstantCallSite
-14 -1: Ljava/net/URL;
-12 -1: deleteOnExit
-20 -1: MAX_SKIP_BUFFER_SIZE
-30 -1: [Ljava/lang/ref/WeakReference;
-15 -1: contentPathProp
-9 -1: initCause
-53 -1: (Ljava/util/Queue;Ljava/lang/Class;)Ljava/util/Queue;
-20 -1: java/util/TimeZone$1
-2 -1: UK
-86 -1: (BLjava/lang/Class;Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/DirectMethodHandle;
-51 -1: (II[Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
-18 -1: Lsun/misc/Cleaner;
-31 -1: RuntimeInvisibleTypeAnnotations
-2 -1: US
-7 -1: makeInt
-40 -1: sun/reflect/annotation/AnnotationSupport
-28 -1: sun/reflect/misc/ReflectUtil
-8 -1: utf_32le
-40 -1: (Ljava/lang/Object;JLjava/lang/Object;)V
-24 -1: java/nio/file/WatchEvent
-66 -1: (Ljava/lang/Class;Ljava/lang/Object;)Ljava/lang/invoke/MethodType;
-91 -1: (Ljava/lang/String;[BIILjava/security/ProtectionDomain;Ljava/lang/String;)Ljava/lang/Class;
-114 -1: (Ljava/lang/ThreadLocal;ILjava/lang/ThreadLocal$ThreadLocalMap$Entry;)Ljava/lang/ThreadLocal$ThreadLocalMap$Entry;
-20 -1: internalWriteEntries
-79 -1: <T:Ljava/lang/Object;>(TT;Ljava/util/function/Supplier<Ljava/lang/String;>;)TT;
-14 -1: bitIndex < 0:
-88 -1: (Ljava/security/PrivilegedAction;Ljava/security/AccessControlContext;)Ljava/lang/Object;
-6 -1: , len
-28 -1: java/io/BufferedOutputStream
-11 -1: System.java
-11 -1: csISOLatin1
-11 -1: csISOLatin2
-28 -1: Ljava/io/OutputStreamWriter;
-27 -1: IllegalAccessException.java
-11 -1: csISOLatin4
-14 -1: isDaylightTime
-11 -1: csISOLatin5
-21 -1: getYearLengthInMonths
-13 -1: canonicalizes
-93 -1: "'s signer information does not match signer information of other classes in the same package
-32 -1: ()Lsun/management/GcInfoBuilder;
-37 -1: (IILjava/nio/charset/CoderResult$1;)V
-10 -1: stateNames
-46 -1: (Ljava/lang/String;)Ljava/nio/charset/Charset;
-21 -1: acquireMethodAccessor
-2 -1: X-
-32 -1: java/security/ProtectionDomain$1
-5 -1: atan2
-32 -1: java/security/ProtectionDomain$2
-32 -1: java/security/ProtectionDomain$3
-41 -1: malformed input: partial character at end
-18 -1: dropParameterTypes
-44 -1: (Ljava/lang/String;)Ljava/lang/StringBuffer;
-18 -1: CalendarUtils.java
-5 -1: month
-84 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction<Ljava/lang/ClassLoader;>;
-33 -1: sun/misc/JavaNioAccess$BufferPool
-18 -1: SearchMappingsTask
-38 -1: DelegatingConstructorAccessorImpl.java
-80 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Class<*>;)Ljava/lang/invoke/MemberName;
-8 -1: instance
-54 -1: Parameter annotations don't match number of parameters
-14 -1: createConstant
-35 -1: java/lang/invoke/MemberName$Factory
-4 -1: scrt
-34 -1: Ljava/lang/InstantiationException;
-20 -1: allowUserInteraction
-15 -1: java/util/Deque
-16 -1: forEachRemaining
-35 -1: (J)Lsun/util/calendar/CalendarDate;
-13 -1: no such field
-25 -1: java/nio/file/FileSystems
-16 -1: expectedModCount
-44 -1: (Ljava/io/File;ILjava/nio/charset/Charset;)V
-12 -1: createString
-15 -1: useDaylightTime
-31 -1: java/util/Properties$LineReader
-111 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/String;ILjava/lang/Class<*>;I[Ljava/lang/invoke/MemberName;)I
-16 -1: java/util/Locale
-26 -1: URLClassPath.getResource("
-58 -1: (Ljava/util/SortedMap;Ljava/lang/Class;Ljava/lang/Class;)V
-10 -1: appendTail
-7 -1: cleaner
-78 -1: (Lsun/nio/cs/FastCharsetProvider;Ljava/lang/String;)Ljava/nio/charset/Charset;
-18 -1: convertOldISOCodes
-4 -1: year
-38 -1: java/lang/ReflectiveOperationException
-28 -1: (Ljava/lang/StringBuffer;B)V
-27 -1: (D)Ljava/lang/StringBuffer;
-17 -1: emptyNavigableSet
-7 -1: indices
-10 -1: is sealed
-21 -1: SPECIFICATION_VERSION
-3 -1: TE;
-8 -1: addMonth
-24 -1: java/util/HashMap$Values
-17 -1: SEARCH_ALL_SUPERS
-18 -1: uncaught exception
-14 -1: declaredFields
-2 -1: [B
-2 -1: [C
-8 -1: ABSTRACT
-2 -1: [D
-2 -1: [F
-2 -1: [I
-2 -1: [J
-5 -1: false
-36 -1: (Ljava/net/URL;Ljava/lang/String;J)V
-12 -1: equalContext
-11 -1: VOID_RESULT
-2 -1: [S
-24 -1: (JLjava/lang/Object;JJ)V
-36 -1: Ljava/security/PermissionCollection;
-2 -1: [Z
-17 -1: floatToRawIntBits
-2 -1: []
-21 -1: ()[Ljava/lang/Thread;
-20 -1: [Ljava/lang/Integer;
-42 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Z)V
-19 -1: checkPrintJobAccess
-40 -1: (Ljava/lang/Object;)Ljava/lang/Class<*>;
-31 -1: (Lsun/reflect/FieldAccessor;Z)V
-10 -1: reallyPoll
-52 -1: (Ljava/lang/ref/Reference;)Ljava/lang/ref/Reference;
-100 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<-TV;+TU;>;Ljava/util/function/Consumer<-TU;>;)V
-19 -1: CheckedNavigableMap
-48 -1: (Ljava/lang/String;)Ljava/lang/RuntimeException;
-35 -1: java/util/Hashtable$ValueCollection
-89 -1: (JLjava/util/function/ToDoubleFunction<-TK;>;DLjava/util/function/DoubleBinaryOperator;)D
-10 -1: Stack.java
-57 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Object;I)V
-12 -1: getTimeOfDay
-12 -1: reduceValues
-22 -1: warnUnsupportedCharset
-34 -1: (Ljava/lang/ref/Reference<+TS;>;)Z
-31 -1: EEE, dd MMM yyyy HH:mm:ss 'GMT'
-19 -1: setCachedLambdaForm
-21 -1: (I)Ljava/lang/Object;
-85 -1: (Lsun/util/locale/BaseLocale;Lsun/util/locale/LocaleExtensions;Ljava/util/Locale$1;)V
-36 -1: java/security/AccessControlContext$1
-27 -1: Lsun/net/www/MessageHeader;
-23 -1: ()[Ljava/lang/Class<*>;
-14 -1: refKindIsValid
-41 -1: sun/reflect/NativeConstructorAccessorImpl
-6 -1: binary
-23 -1: ()Ljava/nio/CharBuffer;
-8 -1: getSpace
-45 -1: bootstrap method failed to produce a CallSite
-15 -1: getISO3Language
-17 -1: TRANSITION_NSHIFT
-163 -1: ([Ljava/lang/String;Ljava/util/Map<Ljava/lang/String;Ljava/util/List<Ljava/lang/String;>;>;)Ljava/util/Map<Ljava/lang/String;Ljava/util/List<Ljava/lang/String;>;>;
-7 -1: os.name
-38 -1: java/util/function/IntToDoubleFunction
-8 -1: checkInt
-21 -1: java/lang/VerifyError
-42 -1: sunpkcs11 SunPKCS11 provider debugging
-19 -1: URI is not absolute
-23 -1: java/io/DataInputStream
-53 -1: (Ljava/lang/Object;)Ljava/nio/charset/CharsetEncoder;
-2 -1: _#
-41 -1: (Ljava/io/FilenameFilter;)[Ljava/io/File;
-26 -1: Ljava/util/jar/Attributes;
-7 -1: collect
-17 -1: Lsun/misc/Unsafe;
-97 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodHandle;
-78 -1: <T:Ljava/lang/Object;>(Ljava/util/Enumeration<TT;>;)Ljava/util/ArrayList<TT;>;
-28 -1: (II)Ljava/lang/StringBuffer;
-54 -1: (Ljava/lang/reflect/Constructor<*>;)Ljava/lang/String;
-28 -1: ()Ljava/util/ResourceBundle;
-48 -1: java/util/ArraysParallelSortHelpers$FJInt$Sorter
-9 -1: no access
-57 -1: <S:Ljava/lang/Object;>Ljava/lang/ref/ReferenceQueue<TS;>;
-7 -1: getPerf
-11 -1: getClassAt0
-11 -1: rtypeOffset
-20 -1: thread can't be null
-12 -1: addArguments
-12 -1: utf_32le_bom
-21 -1: allowThreadSuspension
-25 -1: defaultExpectedLineLength
-11 -1: removeFirst
-13 -1: reduceEntries
-20 -1: Read-ahead limit < 0
-57 -1: <T:Ljava/lang/Object;>(Ljava/util/Collection<-TT;>;[TT;)Z
-39 -1: ()Ljava/lang/invoke/MemberName$Factory;
-13 -1: ZipCoder.java
-16 -1: java/lang/Thread
-27 -1: java/lang/NoSuchMethodError
-66 -1: (Ljava/util/jar/JarFile;Ljava/net/URL;)[Ljava/security/CodeSource;
-22 -1: java/lang/StringBuffer
-3 -1: TK;
-34 -1: (I)Ljava/lang/invoke/MethodHandle;
-30 -1: (Ljava/lang/reflect/Method;Z)V
-13 -1: file.encoding
-14 -1: removeTreeNode
-27 -1: sun/misc/JavaSecurityAccess
-58 -1: ([Ljava/lang/Object;ILjava/lang/Class;)[Ljava/lang/Object;
-19 -1: equalLimitedContext
-22 -1: appendVmSynonymMessage
-10 -1: applyAsInt
-23 -1: privateGetPublicMethods
-11 -1: dumpThreads
-25 -1: RuntimeVisibleAnnotations
-37 -1: (IF)Ljava/lang/AbstractStringBuilder;
-18 -1: getBooleanVolatile
-27 -1: (Ljava/util/zip/ZipFile;J)V
-25 -1: INITIAL_QUOTE_PUNCTUATION
-51 -1: (Ljava/util/Map;)[Ljava/lang/annotation/Annotation;
-54 -1: (ILjava/lang/Object;)Ljava/lang/AbstractStringBuilder;
-20 -1: reflectionDataOffset
-2 1: aa
-51 -1: (Ljava/util/jar/Attributes$Name;)Ljava/lang/String;
-13 -1: transferLinks
-18 -1: java/util/Vector$1
-10 -1: ensureOpen
-22 -1: getDeclaredConstructor
-2 -1: am
-19 -1: NF_allocateInstance
-66 -1: (Ljava/util/Spliterator$OfDouble;Z)Ljava/util/stream/DoubleStream;
-6 -1: ([SS)I
-17 -1: newReflectionData
-19 -1: subclassAuditsQueue
-11 -1: access$1200
-16 -1: ValueSpliterator
-18 -1: preparedLambdaForm
-38 -1: (Ljava/net/URL;)Ljava/net/InetAddress;
-14 -1: getMaxPriority
-32 -1: ()[Ljava/lang/StackTraceElement;
-67 -1: java/util/concurrent/ConcurrentHashMap$MapReduceEntriesToDoubleTask
-62 -1: (Ljava/util/Hashtable<Ljava/lang/String;Ljava/lang/String;>;)V
-6 -1: EXTHDR
-14 -1: java/util/Date
-2 -1: az
-6 -1: ([SS)V
-15 -1: arrayBaseOffset
-9 -1: isTrusted
-23 -1: (Ljava/lang/Object;JD)V
-2 -1: bb
-10 -1: ([BII[BI)V
-7 -1: toLower
-14 -1: invoke_LLLLL_L
-7 -1: jarfile
-42 -1: (Ljava/lang/String;)Lsun/misc/PerfCounter;
-28 -1: java/lang/ref/Reference$Lock
-16 -1: java/util/BitSet
-22 -1: jarfile parsing error!
-18 -1: jdk_update_version
-14 -1: invoke_LLLLL_V
-20 -1: java/util/LinkedList
-22 -1: erasedInvokerWithDrops
-25 -1: timeout value is negative
-21 -1: getCalendarProperties
-25 -1: not a method descriptor:
-2 -1: cb
-31 -1: (Lsun/misc/JavaUtilJarAccess;)V
-2 -1: cd
-43 -1: Lsun/util/PreHashedMap<Ljava/lang/String;>;
-12 -1: getEntrySize
-2 -1: ce
-24 -1: guessContentTypeFromName
-2 -1: ch
-14 -1: JulianCalendar
-22 -1: [Ljava/lang/Cloneable;
-122 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractCollection<TE;>;Ljava/util/Deque<TE;>;Ljava/lang/Cloneable;Ljava/io/Serializable;
-34 -1: Lsun/util/locale/BaseLocale$Cache;
-14 -1: LinkedEntrySet
-72 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractSet<TE;>;Ljava/io/Serializable;
-39 -1: ()Ljava/io/ObjectOutputStream$PutField;
-2 -1: cs
-8 -1: indexFor
-25 -1: (Ljava/util/List<+TE;>;)V
-7 -1: subpath
-11 -1: invokeExact
-14 -1: setFileNameMap
-22 -1: LangReflectAccess.java
-8 -1: referent
-34 -1: java/util/MissingResourceException
-77 -1: (Ljava/lang/String;Ljava/util/jar/Manifest;Ljava/net/URL;)Ljava/lang/Package;
-11 -1: ([FII[FII)V
-17 -1: getParameterCount
-18 -1: isMemberAccessible
-10 -1: getExtDirs
-69 -1: <T:Ljava/lang/Object;>(Ljava/util/List<-TT;>;Ljava/util/List<+TT;>;)V
-9 -1: getNextPC
-13 -1: setProperties
-2 -1: de
-16 -1: generateCertPath
-6 -1: decode
-16 -1: getDefaultParent
-50 -1: (Ljava/net/URL;[Ljava/security/cert/Certificate;)V
-24 -1: Certificate factory for
-35 -1: ()Ljava/lang/reflect/AnnotatedType;
-2 -1: ee
-12 -1: asLongBuffer
-7 -1: PRIVATE
-16 -1: aliases_UTF_32BE
-2 -1: en
-2 -1: eq
-7 -1: indexOf
-136 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class<+Ljava/lang/Throwable;>;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle;
-24 -1: (Ljava/lang/Class<*>;I)V
-72 -1: (Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/IllegalAccessException;
-35 -1: java/util/jar/JavaUtilJarAccessImpl
-24 -1: (Ljava/lang/Class<*>;I)Z
-2 -1: ex
-24 -1: getProtectionDomainCache
-101 -1: (Ljava/lang/ThreadGroup;Ljava/lang/Runnable;Ljava/lang/String;JLjava/security/AccessControlContext;)V
-3 -1: hit
-8 -1: UTF_16BE
-2 -1: fd
-16 -1: EmptyEnumeration
-4 -1: attr
-16 -1: fromIndex < -1:
-7 -1: getIntB
-22 -1: java/io/FilePermission
-2 -1: fr
-2 -1: fs
-7 -1: lazySet
-7 -1: getIntL
-37 -1: configfile JAAS ConfigFile loading
-24 -1: sun/nio/cs/StreamEncoder
-40 -1: (Ljava/time/ZoneId;)Ljava/util/TimeZone;
-132 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/BiConsumer;)V
-2 -1: gc
-18 -1: Ljava/lang/Thread;
-10 -1: cacheArray
-48 -1: (Ljava/util/jar/JarFile;)Ljava/util/jar/JarFile;
-61 -1: (Ljava/util/NavigableMap;Ljava/lang/Class;Ljava/lang/Class;)V
-8 -1: readByte
-7 -1: ([S[S)Z
-24 -1: findBootstrapClassOrNull
-2 -1: hb
-7 -1: REPLACE
-45 -1: ()Ljava/util/Enumeration<Ljava/lang/String;>;
-10 -1: isOverflow
-2 -1: he
-13 -1: getCachedJan1
-12 -1: getClassPath
-8 -1: leapYear
-31 -1: java/lang/invoke/MethodTypeForm
-10 -1: ANNOTATION
-20 -1: getGregorianCalendar
-11 -1: ISO_8859_13
-11 -1: ISO_8859_15
-6 -1: invoke
-2 -1: ht
-7 -1: ListItr
-15 -1: synchronizedMap
-7 -1: cleanup
-94 -1: (Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;)Lsun/reflect/annotation/AnnotationType;
-3 -1: TT;
-69 -1: (JLsun/util/calendar/CalendarDate;)Lsun/util/calendar/Gregorian$Date;
-81 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/HashMap$TreeNode<TK;TV;>;)Z
-20 -1: Min. Heap Size:
-33 -1: (IZ)Ljava/lang/invoke/MethodType;
-2 -1: id
-7 -1: ([DI)[D
-37 -1: (Ljava/lang/reflect/Constructor<*>;)I
-42 -1: <T::Ljava/lang/Comparable<-TT;>;>([TT;II)V
-13 -1: addSuppressed
-28 -1: internalMemberNameEnsureInit
-2 -1: in
-17 -1: getCompressedSize
-34 -1: sun/misc/Launcher$AppClassLoader$1
-88 -1: (Ljava/security/DomainCombiner;Ljava/lang/Class<*>;)Ljava/security/AccessControlContext;
-37 -1: (Ljava/lang/reflect/Constructor<*>;)V
-2 -1: is
-2 -1: it
-6 -1: ENDOFF
-4 -1: void
-2 -1: iw
-14 -1: emptySortedSet
-2 -1: ix
-17 -1: unicode-1-1-utf-8
-64 -1: (Ljava/lang/Class;Ljava/util/List;)Ljava/lang/invoke/MethodType;
-46 -1: (Lsun/misc/URLClassPath$Loader;)Ljava/net/URL;
-2 -1: ja
-13 -1: synchronized
-76 -1: ([DLjava/util/function/IntToDoubleFunction;)Ljava/util/function/IntConsumer;
-11 -1: wrapperType
-51 -1: <T:Ljava/lang/Object;>()Ljava/util/Comparator<TT;>;
-106 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;)Ljava/lang/Object;
-17 -1: removeAllElements
-2 -1: ji
-24 -1: java/util/Vector$ListItr
-14 -1: getNestedTypes
-6 -1: L_MARK
-27 -1: Source does not fit in dest
-2 -1: l1
-2 -1: jp
-2 -1: l2
-4 -1: (J)B
-57 -1: (Ljava/lang/String;Ljava/util/Locale;I)Ljava/lang/String;
-4 -1: (J)C
-27 -1: ForEachTransformedValueTask
-2 -1: l4
-26 -1: java/util/Hashtable$KeySet
-4 -1: (J)D
-2 -1: l5
-39 -1: java/security/BasicPermissionCollection
-4 -1: (J)F
-2 -1: jv
-29 -1: MapReduceMappingsToDoubleTask
-18 -1: copyFromShortArray
-2 -1: l9
-3 -1: TV;
-4 -1: (J)I
-4 -1: (J)J
-23 -1: Lsun/util/calendar/Era;
-8 -1: x-EUC-TW
-15 -1: checkSetFactory
-7 -1: Special
-4 -1: (J)S
-4 -1: (J)V
-7 -1: invoke_
-25 -1: (IC)Ljava/nio/ByteBuffer;
-68 -1: (JLjava/util/concurrent/TimeUnit;)Ljava/nio/file/attribute/FileTime;
-36 -1: ()Ljava/net/URLStreamHandlerFactory;
-4 -1: (J)Z
-181 -1: <T:Ljava/lang/Object;>(Ljava/lang/Class<*>;Ljava/lang/ref/SoftReference<Ljava/lang/Class$ReflectionData<TT;>;>;Ljava/lang/ref/SoftReference<Ljava/lang/Class$ReflectionData<TT;>;>;)Z
-9 -1: getOffset
-46 -1: (ILjava/lang/String;)Ljava/lang/StringBuilder;
-7 -1: element
-15 -1: createByteArray
-17 -1: uncaughtException
-2 -1: ko
-29 -1: java/nio/file/DirectoryStream
-15 -1: getISOCountries
-246 -1: <NoSuchMemberException:Ljava/lang/ReflectiveOperationException;>(BLjava/lang/invoke/MemberName;Ljava/lang/Class<*>;Ljava/lang/Class<TNoSuchMemberException;>;)Ljava/lang/invoke/MemberName;^Ljava/lang/IllegalAccessException;^TNoSuchMemberException;
-7 -1: invoker
-17 -1: langReflectAccess
-10 -1: bindSingle
-23 -1: java/lang/reflect/Proxy
-2 -1: lb
-2 -1: lc
-29 -1: CREATE_CLASSLOADER_PERMISSION
-5 -1: isSet
-18 -1: ([Ljava/io/File;)V
-15 -1: urlNoFragString
-21 -1: DirectByteBuffer.java
-15 -1: java.class.path
-15 -1: createDirectory
-4 -1: GMT
-37 -1: sun/reflect/annotation/ExceptionProxy
-28 -1: (Ljava/util/Map<+TK;+TV;>;)V
-17 -1: getContentHandler
-26 -1: GenericDeclRepository.java
-56 -1: (Ljava/lang/String;)Ljava/lang/IllegalArgumentException;
-15 -1: getJavaIOAccess
-39 -1: java/util/Collections$EmptyListIterator
-34 -1: java/lang/ConditionalSpecialCasing
-82 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/lang/management/GarbageCollectorMBean;
-58 -1: (Ljava/util/function/ToIntFunction;)Ljava/util/Comparator;
-21 -1: ()Lsun/misc/Launcher;
-2 -1: lt
-92 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;IIILjava/util/concurrent/ConcurrentHashMap;)V
-8 -1: disjoint
-62 -1: (Ljava/net/URL;Ljava/lang/String;Ljava/net/URLStreamHandler;)V
-24 -1: ([Ljava/lang/Object;)TT;
-4 -1: lmap
-8 -1: SATURDAY
-12 -1: toStringUTF8
-91 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/util/function/BinaryOperator;)Ljava/lang/Object;
-46 -1: pkcs11 PKCS11 session manager debugging
-27 -1: (Z)Ljava/lang/StringBuffer;
-7 -1: forEach
-17 -1: (Ljava/io/File;)I
-17 -1: (Ljava/io/File;)J
-5 -1: RESET
-6 -1: isFile
-14 -1: Exception.java
-8 -1: isPublic
-27 -1: computeInitialPreparedForms
-50 -1: (BZLjava/lang/Class;)Ljava/lang/invoke/LambdaForm;
-19 -1: getAvailableLocales
-17 -1: (Ljava/io/File;)V
-28 -1: ()Ljava/nio/charset/Charset;
-10 -1: appendNull
-17 -1: (Ljava/io/File;)Z
-23 -1: java/lang/InternalError
-2 -1: ne
-6 -1: radix
-8 -1: checksum
-66 -1: (Lsun/net/www/MessageHeader;Ljava/lang/String;Ljava/lang/Object;)V
-45 -1: (Ljava/io/FilenameFilter;)[Ljava/lang/String;
-8 -1: checkJar
-28 -1: default format locale =
-13 -1: normalizeTime
-26 -1: java/util/AbstractList$Itr
-30 -1: java/util/function/IntFunction
-7 -1: TIS-620
-12 -1: reverseBytes
-2 -1: of
-26 -1: java/lang/ClassFormatError
-109 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle;
-10 -1: delimiters
-20 -1: indexOfSupplementary
-16 -1: aliases_UTF_32LE
-134 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/Map<TK;TV;>;Ljava/lang/Class<TK;>;Ljava/lang/Class<TV;>;)Ljava/util/Map<TK;TV;>;
-17 -1: [Ljava/lang/Long;
-2 -1: or
-12 -1: getClassName
-31 -1: (Ljava/nio/charset/Charset;FF)V
-6 -1: ([FF)I
-39 -1: (Ljava/util/Locale;)[Ljava/lang/String;
-33 -1: java/util/WeakHashMap$KeyIterator
-8 -1: UTF_16LE
-12 -1: isISOControl
-75 -1: (Ljava/nio/CharBuffer;Ljava/nio/ByteBuffer;Z)Ljava/nio/charset/CoderResult;
-7 -1: ([I[I)Z
-28 -1: Self-causation not permitted
-6 -1: ([FF)V
-14 -1: defaultCharset
-12 -1: isJavaLetter
-2 -1: pm
-39 -1: cannot reflectively invoke MethodHandle
-20 -1: getSystemClassLoader
-42 -1: ([Ljava/lang/Object;IILjava/lang/Object;)I
-56 -1: (Ljava/lang/Object;Ljava/lang/String;)Ljava/lang/Object;
-42 -1: ([Ljava/lang/Object;IILjava/lang/Object;)V
-12 -1: ZipFile.java
-43 -1: (Ljava/util/zip/ZipFile;)Ljava/lang/String;
-22 -1: Ljava/net/InetAddress;
-15 -1: getCharVolatile
-32 -1: ()[Ljava/lang/reflect/Parameter;
-13 -1: delimsChanged
-13 -1: getFileSystem
-13 -1: METHOD_RETURN
-20 -1: sun/misc/PerfCounter
-61 -1: (Ljava/util/HashMap<TK;TV;>;)Ljava/util/HashMap$Node<TK;TV;>;
-8 -1: newIndex
-18 -1: getDisplayLanguage
-36 -1: (C)Ljava/lang/AbstractStringBuilder;
-36 -1: java/lang/StringCoding$StringEncoder
-12 -1: forEachEntry
-23 -1: [Ljava/io/Serializable;
-13 -1: totalCapacity
-26 -1: java/io/FileOutputStream$1
-14 -1: signatureArity
-90 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;[Ljava/security/cert/Certificate;)V
-17 -1: reflectionFactory
-6 -1: ibm737
-17 -1: fillInStackTrace0
-16 -1: allocateInstance
-52 -1: (Lsun/util/locale/BaseLocale$Key;)Ljava/lang/String;
-9 -1: addExtURL
-16 -1: copyFromIntArray
-65 -1: (Ljava/security/Permission;Z)Ljava/security/PermissionCollection;
-57 -1: java/util/concurrent/ConcurrentHashMap$SearchMappingsTask
-10 -1: toEpochDay
-4 -1: gate
-24 -1: sun/nio/cs/UTF_8$Decoder
-8 -1: entries2
-18 -1: isCharsetSupported
-10 -1: toCustomID
-2 -1: rw
-33 -1: java/nio/ByteBufferAsFloatBufferB
-25 -1: (ID)Ljava/nio/ByteBuffer;
-12 -1: addTimeOfDay
-61 -1: (Ljava/security/ProtectionDomain;Ljava/security/Permission;)Z
-2 -1: sd
-25 -1: (Ljava/net/InetAddress;)V
-33 -1: java/nio/ByteBufferAsFloatBufferL
-2 -1: se
-15 -1: hasQueuedThread
-24 -1: assertMemberIsConsistent
-37 -1: java/util/Collections$UnmodifiableMap
-2 -1: sp
-20 -1: setJavaUtilJarAccess
-96 -1: (Ljava/lang/String;[BIILjava/lang/ClassLoader;Ljava/security/ProtectionDomain;)Ljava/lang/Class;
-8 -1: language
-76 -1: <T:Ljava/lang/Object;>(Ljava/util/SortedSet<TT;>;)Ljava/util/SortedSet<TT;>;
-11 -1: findLibrary
-61 -1: (Ljava/lang/Class<*>;)Lsun/reflect/annotation/AnnotationType;
-6 -1: ([BZ)V
-24 -1: DEFAULT_BYTE_BUFFER_SIZE
-25 -1: (Ljava/util/ArrayList;I)V
-2 -1: th
-47 -1: (Ljava/util/Collection;)Ljava/util/Enumeration;
-49 -1: (Lsun/misc/URLClassPath$JarLoader;)Ljava/net/URL;
-7 -1: ([D[D)Z
-2 -1: to
-22 -1: java/util/Locale$Cache
-8 -1: iterator
-30 -1: (Ljava/lang/StringBuilder;IZ)V
-17 -1: ()Ljava/util/Set;
-2 -1: tr
-27 -1: (Ljava/nio/ByteBuffer;ISZ)V
-6 -1: method
-13 -1: allPermission
-9 -1: ruleArray
-8 -1: UTC_TIME
-10 -1: LF_COUNTER
-26 -1: Lsun/nio/cs/StreamDecoder;
-25 -1: ()Lsun/util/calendar/Era;
-6 -1: LOCHDR
-21 -1: sun/net/www/MimeTable
-12 -1: Cannot cast
-2 -1: us
-2 -1: ut
-52 -1: Ljava/lang/invoke/MethodHandle$PolymorphicSignature;
-6 -1: encode
-15 -1: CharBuffer.java
-24 -1: (C)Ljava/nio/ByteBuffer;
-56 -1: (Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;)V
-18 -1: getEnclosingMethod
-56 -1: (Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;)Z
-6 -1: ibm775
-9 -1: (IIIIII)I
-44 -1: ([JLjava/util/function/IntToLongFunction;I)V
-9 -1: (IIIIII)J
-64 -1: (Ljava/util/Locale$LocaleKey;)Lsun/util/locale/LocaleExtensions;
-2 -1: x-
-2 -1: vm
-5 -1: clock
-9 -1: (IIIIII)V
-10 -1: XmlSupport
-19 -1: sun/nio/cs/US_ASCII
-10 -1: toRealPath
-5 -1: cp367
-6 -1: ST_END
-58 -1: [Lsun/util/calendar/ZoneInfoFile$ZoneOffsetTransitionRule;
-12 -1: hasSameRules
-108 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)Lsun/util/locale/LocaleExtensions;
-22 -1: java/lang/Class$Atomic
-4 -1: sync
-6 -1: listen
-12 -1: firstElement
-142 -1: (Ljava/lang/Class;Ljava/lang/String;[Ljava/lang/Class;Ljava/lang/Class;[Ljava/lang/Class;IILjava/lang/String;[B[B[B)Ljava/lang/reflect/Method;
-18 -1: internalProperties
-28 -1: (Ljava/lang/StringBuffer;C)V
-7 -1: factory
-18 -1: ()Ljava/util/List;
-50 -1: (Ljava/util/concurrent/CountedCompleter;[D[DIIII)V
-44 -1: (Ljava/lang/Class;)Lsun/invoke/util/Wrapper;
-83 -1: (JLjava/util/function/ToDoubleFunction;DLjava/util/function/DoubleBinaryOperator;)D
-12 -1: erasedType:
-53 -1: (Ljava/util/AbstractList;Ljava/util/AbstractList$1;)V
-20 -1: Cannot find package
-27 -1: java/util/ArrayList$ListItr
-10 -1: copyMethod
-23 -1: java/lang/ThreadLocal$1
-16 -1: iso_646.irv:1983
-42 -1: (Ljava/lang/Thread;Ljava/lang/Throwable;)V
-19 -1: DEFAULT_LOAD_FACTOR
-40 -1: ([Ljava/lang/Object;)[Ljava/lang/Object;
-10 -1: (JJJ[BII)I
-12 -1: singletonMap
-8 -1: RESERVED
-9 -1: zipAccess
-21 -1: SynchronizedSortedMap
-4 -1: flag
-15 -1: UnmodifiableSet
-18 -1: WrappedPrintWriter
-7 -1: resume0
-2 -1: yi
-10 -1: erasedType
-31 -1: CHECK_AWT_EVENTQUEUE_PERMISSION
-8 -1: <clinit>
-59 -1: (Ljava/lang/String;)Ljava/security/cert/CertificateFactory;
-40 -1: java/lang/management/MemoryManagerMXBean
-33 -1: newGetIntIllegalArgumentException
-16 -1: iso_646.irv:1991
-58 -1: (Ljava/lang/ClassValue$Entry;)Ljava/lang/ClassValue$Entry;
-2 -1: zc
-26 -1: (Ljava/util/AbstractMap;)V
-6 -1: THROWS
-11 -1: toCharArray
-64 -1: (Ljava/lang/reflect/Constructor;)Ljava/lang/reflect/Constructor;
-2 -1: zh
-68 -1: Ljava/lang/ref/SoftReference<Ljava/lang/Class$ReflectionData<TT;>;>;
-25 -1: (Ljava/util/Collection;)V
-20 -1: getJdkSpecialVersion
-17 -1: getTypeParameters
-32 -1: [Ljava/lang/ClassValue$Entry<*>;
-25 -1: (Ljava/util/Collection;)Z
-26 -1: Lsun/nio/ch/Interruptible;
-5 -1: 0.0p0
-5 -1: CACHE
-7 -1: namesOK
-21 -1: Ljava/lang/Exception;
-51 -1: (Ljava/net/URL;Lsun/net/www/protocol/jar/Handler;)V
-19 -1: jdk_special_version
-66 -1: <T:Ljava/lang/Object;>(Ljava/util/List<TT;>;)Ljava/util/List<TT;>;
-75 -1: (Ljava/util/Comparator;Ljava/util/function/Function;)Ljava/util/Comparator;
-11 -1: Arrays.java
-19 -1: (Ljava/lang/Byte;)I
-17 -1: java/lang/Class$1
-17 -1: java/lang/Class$2
-17 -1: java/lang/Class$3
-47 -1: java/lang/invoke/MethodHandleImpl$WrappedMember
-17 -1: java/lang/Class$4
-44 -1: (Ljava/lang/Throwable;)Ljava/lang/Throwable;
-9 -1: charCount
-24 -1: ()Ljava/net/FileNameMap;
-44 -1: sun/util/locale/provider/TimeZoneNameUtility
-17 -1: not an array type
-2 -1: {}
-24 -1: (Lsun/misc/Launcher$1;)V
-12 -1: directMemory
-10 -1: parameters
-5 -1: java.
-14 -1: allocateDirect
-51 -1: (Ljava/lang/StringBuffer;)Ljava/lang/StringBuilder;
-23 -1: java/nio/file/Watchable
-37 -1: createDiagnosticFrameworkNotification
-54 -1: (Ljava/lang/Class<*>;Z)Ljava/lang/invoke/MethodHandle;
-35 -1: sun/nio/cs/StandardCharsets$Aliases
-9 -1: retDelims
-11 -1: MAX_ENTRIES
-12 -1: CumulateTask
-64 -1: java/util/concurrent/ConcurrentHashMap$ForEachTransformedKeyTask
-3 -1: iae
-12 -1: AF_PUTSTATIC
-21 -1: java/lang/Throwable$1
-45 -1: (Ljava/util/HashMap;)Ljava/util/HashMap$Node;
-77 -1: (JLjava/util/function/ToIntFunction;ILjava/util/function/IntBinaryOperator;)I
-5 -1: after
-29 -1: (Ljava/security/CodeSource;)Z
-248 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceValuesToDoubleTask;Ljava/util/function/ToDoubleFunction;DLjava/util/function/DoubleBinaryOperator;)V
-6 -1: H_URIC
-7 -1: L_DIGIT
-7 -1: toNanos
-24 -1: (D)Ljava/nio/ByteBuffer;
-25 -1: getDiagnosticCommandMBean
-6 2: [LFoo;
-14 -1: path.separator
-16 -1: toUnsignedString
-40 -1: DIRECTIONALITY_EUROPEAN_NUMBER_SEPARATOR
-87 -1: (Ljava/security/Permission;[Ljava/security/cert/Certificate;)Ljava/security/Permission;
-16 -1: inheritedChannel
-11 -1: audio/basic
-27 -1: sun.classloader.findClasses
-10 -1: queryCount
-20 -1: NF_ensureInitialized
-12 -1: getBufIfOpen
-23 -1: sun/nio/cs/UTF_16LE_BOM
-134 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;[Ljava/lang/Object;)Ljava/lang/invoke/CallSite;
-17 -1: getImplMethodName
-14 -1: linkMethod =>
-25 -1: Ljava/lang/invoke/Stable;
-32 -1: Ljava/lang/annotation/Retention;
-7 -1: doInput
-9 -1: -_.!~*'()
-62 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Class<*>;B)V
-18 -1: separateWithCommas
-43 -1: com/sun/crypto/provider/CipherBlockChaining
-14 -1: createTempFile
-9 -1: implFlush
-20 -1: getOffsetsByStandard
-21 -1: OutOfMemoryError.java
-7 -1: jce.jar
-46 -1: java/util/Collections$UnmodifiableNavigableMap
-30 -1: (Ljava/io/File;)Ljava/io/File;
-15 -1: LinkedList.java
-15 -1: iso_8859-9:1989
-50 -1: sun/reflect/generics/factory/CoreReflectionFactory
-10 -1: : JVM has
-19 -1: HeapByteBuffer.java
-6 -1: getURL
-37 -1: java/security/cert/CertificateFactory
-23 -1: getAllowUserInteraction
-12 -1: otherParents
-25 -1: ARRAY_BOOLEAN_BASE_OFFSET
-9 -1: L_UPALPHA
-41 -1: ([Ljava/util/Hashtable$Entry<**>;TK;TV;)V
-6 -1: LOCHOW
-11 -1: access$1300
-30 -1: sun/reflect/MethodAccessorImpl
-130 -1: (Ljava/util/List<Ljava/util/Locale$LanguageRange;>;Ljava/util/Collection<Ljava/util/Locale;>;)Ljava/util/List<Ljava/util/Locale;>;
-9 -1: MALFORMED
-38 -1: (Ljava/lang/String;I)Ljava/lang/Short;
-26 -1: File format not recognised
-12 -1: setTimeOfDay
-19 -1: java/lang/Exception
-15 -1: getOutputStream
-74 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
-41 -1: (Ljava/lang/String;Z)Ljava/util/TimeZone;
-49 -1: Lsun/reflect/generics/repository/ClassRepository;
-8 -1: getCerts
-90 -1: (Ljava/lang/Class<*>;ZLjava/lang/Class<*>;)Ljava/util/List<Ljava/lang/invoke/MemberName;>;
-5 -1: clone
-32 -1: ()Ljava/lang/ref/Reference$Lock;
-15 -1: caseIgnoreMatch
-23 -1: (Ljava/util/Set<TE;>;)V
-25 -1: enumerateStringProperties
-9 -1: inherited
-4 -1: flip
-8 -1: setMonth
-38 -1: (Ljava/util/function/Consumer<-TV;>;)V
-55 -1: java/util/concurrent/ConcurrentHashMap$ReduceValuesTask
-37 -1: getJavaSecurityProtectionDomainAccess
-67 -1: (Ljava/util/NavigableSet;Ljava/lang/Class;)Ljava/util/NavigableSet;
-10 -1: reduceKeys
-14 -1: MAX_CODE_POINT
-24 -1: getGenericExceptionTypes
-8 -1: fraction
-30 -1: java/lang/InterruptedException
-46 -1: (Ljava/lang/String;II[BI)Ljava/nio/ByteBuffer;
-114 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>([Ljava/util/HashMap$Node<TK;TV;>;Ljava/util/HashMap$TreeNode<TK;TV;>;)V
-66 -1: (Ljava/lang/String;Ljava/lang/Throwable;)Ljava/lang/InternalError;
-45 -1: (Ljava/lang/Object;)Ljava/lang/StringBuilder;
-8 -1: putLongB
-101 -1: (Ljava/nio/channels/ReadableByteChannel;Ljava/nio/charset/CharsetDecoder;I)Lsun/nio/cs/StreamDecoder;
-16 -1: standardProvider
-14 -1: parameterCount
-59 -1: (Ljava/lang/String;Ljava/lang/ClassLoader;)Ljava/util/List;
-8 -1: putLongL
-12 -1: (TT;TV;TV;)Z
-37 -1: Lsun/reflect/ConstructorAccessorImpl;
-11 -1: ([CII[CII)V
-14 -1: parameterArray
-15 -1: | interpretName
-62 -1: (JLjava/util/function/Function;Ljava/util/function/Consumer;)V
-30 -1: (Z)Lsun/reflect/FieldAccessor;
-19 -1: jvm_special_version
-22 -1: java/util/ArrayDeque$1
-12 -1: initVersions
-22 -1: java/lang/CharSequence
-21 -1: NF_internalMemberName
-5 -1: ()TE;
-97 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;IZ)Ljava/lang/invoke/MethodHandle;
-25 -1: java/nio/MappedByteBuffer
-6 -1: addURL
-17 -1: isConvertibleFrom
-14 -1: extendWithType
-9 -1: interrupt
-11 -1: floorDivide
-16 -1: x-ISO-2022-CN-GB
-12 -1: CheckedQueue
-7 -1: setLong
-64 -1: (Ljava/lang/ThreadGroup;Ljava/lang/Runnable;Ljava/lang/String;)V
-108 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/NavigableMap<TK;TV;>;)Ljava/util/NavigableMap<TK;TV;>;
-38 -1: java/nio/channels/spi/SelectorProvider
-17 -1: makeGuardWithTest
-20 -1: (Ljava/util/List;Z)V
-8 -1: val$path
-12 -1: Runtime.java
-7 -1: channel
-71 -1: <T:Ljava/lang/Object;>([TT;IILjava/util/function/BinaryOperator<TT;>;)V
-18 -1: initializedHeaders
-32 -1: ()[Lsun/launcher/LauncherHelper;
-13 -1: jvInitialized
-10 -1: getSeconds
-7 -1: Decoder
-20 -1: getYearFromFixedDate
-6 -1: PREFIX
-21 -1: sun.boot.library.path
-11 -1: FIXED_DATES
-33 -1: (JLjava/util/function/Consumer;)V
-27 -1: initializeJavaAssertionMaps
-13 -1: toOctalString
-9 -1: fixResult
-10 -1: typeParams
-94 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;I)Ljava/util/concurrent/ConcurrentHashMap$Node;
-4 -1: Help
-11 -1: setIfNotSet
-39 -1: java/lang/UnsupportedOperationException
-15 -1: zip file closed
-8 -1: floorDiv
-10 -1: canExecute
-10 -1: encodeLoop
-18 -1: addRequestProperty
-56 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/Object;I)V
-10 -1: superclass
-5 -1: close
-56 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/Object;I)Z
-6 -1: ignore
-32 -1: ()Ljava/lang/ref/ReferenceQueue;
-19 -1: java/util/Formatter
-27 -1: java/lang/ClassLoaderHelper
-23 -1: (Ljava/lang/Object;JZ)V
-29 -1: java/nio/file/WatchEvent$Kind
-6 -1: CENLEN
-4 -1: SIZE
-68 -1: <T:Ljava/lang/Object;>(Ljava/util/Deque<TT;>;)Ljava/util/Queue<TT;>;
-9 -1: isEscaped
-12 -1: LF_INTERPRET
-22 -1: (I)Ljava/lang/Integer;
-60 -1: (Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MemberName;
-49 -1: ([Ljava/lang/Class<*>;Ljava/lang/StringBuilder;)V
-11 -1: getZipEntry
-16 -1: metaInfFilenames
-27 -1: (Ljava/lang/StringBuffer;)V
-57 -1: (Ljava/lang/Object;)Ljava/util/WeakHashMap$Entry<TK;TV;>;
-76 -1: (Ljava/lang/String;[BIILjava/security/ProtectionDomain;)Ljava/lang/Class<*>;
-8 -1: ([CII)[B
-27 -1: (Ljava/lang/StringBuffer;)Z
-24 -1: getManifestFromReference
-8 -1: ([CII)[C
-10 -1: H_LOWALPHA
-18 -1: FileURLMapper.java
-12 -1: fxLaunchMode
-24 -1: isMethodHandleInvokeName
-17 -1: winTimeToFileTime
-19 -1: checkTopLevelWindow
-26 -1: MapReduceMappingsToIntTask
-13 -1: NORM_PRIORITY
-18 -1: lookupViaProviders
-30 -1: (I)Ljava/util/LinkedList$Node;
-3 -1: UTC
-10 -1: UNMAPPABLE
-68 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/invoke/MethodType;B)V
-9 -1: META-INF/
-13 -1: Iterable.java
-71 -1: ([Ljava/lang/reflect/Field;Ljava/lang/String;)Ljava/lang/reflect/Field;
-9 -1: setOffset
-8 -1: FJObject
-50 -1: (Ljava/lang/CharSequence;)Ljava/util/StringJoiner;
-23 -1: java/nio/HeapByteBuffer
-23 -1: sun/util/PreHashedMap$1
-23 -1: sun/util/PreHashedMap$2
-34 -1: newGetCharIllegalArgumentException
-40 -1: jca JCA engine class debugging
-39 -1: (Ljava/lang/Object;I)Ljava/lang/Object;
-42 -1: (Ljava/lang/String;)Ljava/net/InetAddress;
-25 -1: (Ljava/net/FileNameMap;)V
-44 -1: (Ljava/util/SortedMap;)Ljava/util/SortedMap;
-52 -1: (Ljava/lang/String;Ljava/lang/Long;)Ljava/lang/Long;
-27 -1: ()[Ljava/util/HashMap$Node;
-29 -1: java/util/EmptyStackException
-16 -1: not a field type
-14 -1: Ljava/io/File;
-28 -1: ()[Ljava/security/Principal;
-69 -1: (Ljava/io/OutputStream;Ljava/lang/Object;Ljava/nio/charset/Charset;)V
-5 -1: ()TK;
-10 -1: ISO8859-13
-40 -1: java/lang/invoke/DirectMethodHandle$Lazy
-30 -1: The object is not initialized.
-10 -1: ISO8859-15
-88 -1: <E:Ljava/lang/Object;>(Ljava/util/List<TE;>;Ljava/lang/Class<TE;>;)Ljava/util/List<TE;>;
-25 -1: (ZILjava/lang/String;II)Z
-9 -1: stackSize
-61 -1: (Ljava/util/Comparator;Ljava/lang/Object;Ljava/lang/Object;)I
-16 -1: synchronizedList
-90 -1: (Ljava/util/Comparator;Ljava/util/function/Function;Ljava/lang/Object;Ljava/lang/Object;)I
-9 -1: nullCheck
-174 -1: Ljava/util/concurrent/ConcurrentMap<Ljava/lang/invoke/MethodType$ConcurrentWeakInternSet$WeakEntry<TT;>;Ljava/lang/invoke/MethodType$ConcurrentWeakInternSet$WeakEntry<TT;>;>;
-14 -1: java/lang/Enum
-3 -1: int
-13 -1: detailMessage
-56 -1: java/util/concurrent/ConcurrentHashMap$SearchEntriesTask
-10 -1: ISO-8859-1
-10 -1: ISO-8859-2
-10 -1: ISO-8859-3
-10 -1: ISO-8859-4
-10 -1: ISO-8859-5
-10 -1: ISO-8859-6
-24 -1: ([Ljava/lang/Object;II)V
-10 -1: ISO-8859-7
-10 -1: ISO-8859-8
-139 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$Node;)[Ljava/util/concurrent/ConcurrentHashMap$Node;
-10 -1: ISO-8859-9
-5 -1: round
-25 -1: DIRECTIONALITY_WHITESPACE
-13 -1: NamedFunction
-10 -1: startAgent
-3 -1: ioe
-7 -1: closing
-24 -1: appendSchemeSpecificPart
-56 -1: sun/reflect/ReflectionFactory$GetReflectionFactoryAction
-83 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction<Lsun/reflect/ReflectionFactory;>;
-17 -1: isCharsetDetected
-11 -1: getJarFiles
-22 -1: getEnclosingMethodInfo
-11 -1: setReadable
-61 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;)V
-10 -1: attachment
-34 -1: (Ljava/io/File;)Ljava/lang/String;
-18 -1: ZipFileInputStream
-15 -1: CodeSource.java
-61 -1: (Ljava/util/jar/JarFile;)Ljava/util/List<Ljava/lang/Object;>;
-7 -1: cp00858
-108 -1: ([Ljava/lang/invoke/LambdaForm$Name;[Ljava/lang/invoke/LambdaForm$Name;II)Ljava/lang/invoke/LambdaForm$Name;
-38 -1: ([DII)Ljava/util/Spliterator$OfDouble;
-8 -1: val$name
-11 -1: LF_REINVOKE
-12 -1: validateTime
-17 -1: copyFromCharArray
-32 -1: throwSetIllegalArgumentException
-14 -1: fieldModifiers
-52 -1: (Ljava/lang/ClassValue;)Ljava/lang/ClassValue$Entry;
-58 -1: (Ljava/io/OutputStream;Ljava/nio/charset/CharsetEncoder;)V
-14 -1: generalInvoker
-11 -1: interrupted
-246 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceMappingsToLongTask;Ljava/util/function/ToLongBiFunction;JLjava/util/function/LongBinaryOperator;)V
-20 -1: java/util/Dictionary
-17 -1: getDoubleVolatile
-41 -1: (Ljava/lang/Class<*>;Ljava/lang/Object;)Z
-8 -1: intValue
-24 -1: (F)Ljava/nio/ByteBuffer;
-5 -1: reset
-54 -1: (ILjava/util/List;)[Ljava/lang/invoke/LambdaForm$Name;
-19 -1: [Ljava/util/Locale;
-43 -1: (Ljava/lang/String;II)Ljava/nio/ByteBuffer;
-38 -1: ()Ljava/io/ObjectInputStream$GetField;
-18 -1: [Locked by thread
-10 -1: checkedMap
-16 -1: checkedSortedMap
-14 -1: illegal symbol
-16 -1: TITLECASE_LETTER
-4 -1: root
-22 -1: (ZLjava/lang/String;)V
-27 -1: ([JII)Ljava/nio/LongBuffer;
-15 -1: printStackTrace
-30 -1: newConstructorForSerialization
-14 -1: getPermissions
-13 -1: toStringCache
-15 -1: equalParamTypes
-37 -1: throwFinalFieldIllegalAccessException
-35 -1: (Ljava/lang/String;Ljava/io/File;)V
-34 -1: java/nio/charset/CoderResult$Cache
-3 -1: .\n\n
-33 -1: Ljava/nio/charset/CharsetEncoder;
-11 -1: lambdaForms
-65 -1: <T::Ljava/lang/annotation/Annotation;>(Ljava/lang/Class<TT;>;)TT;
-39 -1: (CLjava/lang/Class;Ljava/lang/Object;)Z
-3 -1: ise
-14 -1: forLanguageTag
-45 -1: ([Ljava/lang/Class<*>;[Ljava/lang/Class<*>;)Z
-36 -1: RuntimeInvisibleParameterAnnotations
-12 -1: binarySearch
-24 -1: getAssociatedAnnotations
-10 -1: decoderFor
-6 -1: ibm813
-10 -1: logicalXor
-10 -1: setVarargs
-71 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class;Ljava/lang/Void;)V
-4 -1: cast
-6 -1: ibm819
-23 -1: getParentDelegationTime
-8 -1: ([FII)[F
-4 -1: .tmp
-6 -1: (JII)J
-27 -1: ()Ljava/lang/ref/Finalizer;
-9 -1: sunec.jar
-22 -1: java/net/URLConnection
-41 -1: (Ljava/lang/Runnable;Ljava/lang/String;)V
-20 -1: SecurityManager.java
-18 -1: getZipFileOpenTime
-7 -1: country
-13 -1: inflaterCache
-4 -1:
-17 -1: java/lang/Runtime
-125 -1: (Lsun/management/GcInfoBuilder;JJJ[Ljava/lang/management/MemoryUsage;[Ljava/lang/management/MemoryUsage;[Ljava/lang/Object;)V
-24 -1: java/util/ResourceBundle
-64 -1: Ljava/util/Hashtable<Lsun/misc/Signal;Lsun/misc/SignalHandler;>;
-79 -1: ([Ljava/util/WeakHashMap$Entry<TK;TV;>;[Ljava/util/WeakHashMap$Entry<TK;TV;>;)V
-8 -1: x-ibm737
-39 -1: (Ljava/security/AccessControlContext;)Z
-21 -1: (Ljava/lang/Class;I)V
-4 -1: -
-15 -1: calculateFields
-22 -1: Ljava/util/Properties;
-8 -1: getArray
-21 -1: (Ljava/lang/Class;I)Z
-41 -1: (Ljava/lang/ThreadGroup;)Ljava/lang/Void;
-17 -1: Ljava/io/Console;
-115 -1: (Ljava/security/PrivilegedAction;Ljava/security/AccessControlContext;[Ljava/security/Permission;)Ljava/lang/Object;
-12 -1: nextThreadID
-81 -1: (Ljava/net/URLClassLoader;Ljava/lang/SecurityManager;Ljava/security/Permission;)V
-23 -1: ARRAY_SHORT_BASE_OFFSET
-10 -1: interpret_
-144 -1: (Ljava/net/URL;Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)V
-20 -1: isIPv6LiteralAddress
-13 -1: launcher_name
-36 -1: java/util/function/IntToLongFunction
-38 -1: java/util/WeakHashMap$EntrySpliterator
-8 -1: copyInto
-3 -1: ACT
-11 -1: metafactory
-31 -1: ([BLjava/nio/charset/Charset;)V
-30 -1: java/lang/annotation/Retention
-13 -1: getYearLength
-42 -1: java/util/AbstractMap$SimpleImmutableEntry
-31 -1: ()Ljava/lang/invoke/MemberName;
-21 -1: sun/misc/JavaIOAccess
-16 -1: jdk_build_number
-8 -1: ST_RESET
-96 -1: (BLjava/lang/Class;Ljava/lang/String;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MemberName;
-13 -1: getTypeString
-15 -1: maxCharsPerByte
-8 -1: checkKey
-49 -1: (Ljava/nio/charset/Charset;Lsun/nio/cs/UTF_8$1;)V
-80 -1: (Ljava/lang/ClassValue;Ljava/lang/ClassValue$Entry;)Ljava/lang/ClassValue$Entry;
-32 -1: Ljava/security/ProtectionDomain;
-5 -1: ()TT;
-6 -1: insert
-10 -1: intersects
-38 -1: ([Ljava/lang/Class;Ljava/lang/Class;)V
-15 -1: java/lang/Class
-12 -1: getPublicKey
-37 -1: (ID)Ljava/lang/AbstractStringBuilder;
-6 -1: ibm850
-6 -1: locsig
-6 -1: ibm852
-19 -1: changeReferenceKind
-3 -1: AET
-42 -1: (Ljava/util/Collection;Ljava/lang/Class;)V
-6 -1: ibm855
-16 -1: getPolicyNoCheck
-39 -1: ([B)[[Ljava/lang/annotation/Annotation;
-6 -1: ibm857
-10 -1: Error.java
-38 -1: ()Ljava/util/List<Ljava/lang/Object;>;
-14 -1: createInstance
-5 -1: cp437
-28 -1: Lsun/util/locale/BaseLocale;
-17 -1: getStandardOffset
-29 -1: sun/nio/cs/StandardCharsets$1
-36 -1: Ljava/security/ProtectionDomain$Key;
-14 -1: ArrayList.java
-78 -1: (Ljava/lang/String;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MemberName;
-38 -1: java/lang/invoke/MethodHandleImpl$Lazy
-42 -1: (Ljava/util/LinkedHashMap$Entry<TK;TV;>;)V
-8 -1: getLongB
-7 -1: vmentry
-21 -1: lookupExtendedCharset
-32 -1: <T:Ljava/lang/Object;>([TT;)[TT;
-53 -1: Ljava/util/concurrent/ConcurrentHashMap$EntrySetView;
-6 -1: ibm862
-8 -1: getLongL
-32 -1: (Ljava/lang/invoke/MemberName;)J
-67 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction<Lsun/misc/Perf;>;
-6 -1: region
-6 -1: ibm866
-89 -1: (Ljava/lang/Class;[Ljava/lang/Class;[Ljava/lang/Class;I)Lsun/reflect/ConstructorAccessor;
-22 -1: java/util/ListIterator
-9 -1: wednesday
-16 -1: unsuspendThreads
-20 -1: Not a Proxy instance
-45 -1: Ljava/lang/reflect/InvocationTargetException;
-61 -1: (Ljava/lang/CharSequence;II)Ljava/lang/AbstractStringBuilder;
-5 -1: ()TV;
-32 -1: (Ljava/lang/invoke/MemberName;)V
-82 -1: (Ljava/util/jar/JarFile;Ljava/util/jar/JarEntry;)[Ljava/security/cert/Certificate;
-34 -1: java/lang/ClassValue$ClassValueMap
-32 -1: (Ljava/lang/invoke/MemberName;)Z
-15 -1: SPACE_SEPARATOR
-17 -1: caseIgnoreCompare
-58 -1: (Ljava/lang/Class;)Ljava/lang/invoke/MethodHandles$Lookup;
-4 -1: Code
-3 -1: AGT
-54 -1: (Ljava/lang/StringBuilder;II)Ljava/lang/StringBuilder;
-6 -1: ibm874
-15 -1: newMemberBuffer
-42 -1: (Ljava/nio/file/Path;)Ljava/nio/file/Path;
-33 -1: Ljava/lang/NumberFormatException;
-10 -1: Field.java
-67 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<-TK;+TU;>;)TU;
-4 -1: rows
-12 -1: MIN_PRIORITY
-25 -1: URI has a query component
-41 -1: provider security provider debugging
-29 -1: sun/nio/cs/ISO_8859_1$Encoder
-26 -1: (Ljava/util/zip/ZipFile;)I
-26 -1: (Ljava/util/zip/ZipFile;)J
-20 -1: Bad digit at end of
-29 -1: Ljava/lang/RuntimePermission;
-12 -1: initResolved
-9 -1: loadFence
-13 -1: fieldAccessor
-26 -1: (Ljava/util/zip/ZipFile;)V
-36 -1: java/lang/CloneNotSupportedException
-19 -1: getBasicConstraints
-16 -1: putOrderedObject
-26 -1: (Ljava/util/zip/ZipFile;)Z
-6 -1: target
-50 -1: (Ljava/util/concurrent/CountedCompleter;[I[IIIII)V
-16 -1: changeReturnType
-13 -1: CAUSE_CAPTION
-14 -1: checkExactType
-50 -1: sun/util/locale/provider/LocaleServiceProviderPool
-47 -1: java/lang/invoke/DirectMethodHandle$Constructor
-20 -1: CallerSensitive.java
-30 -1: java/security/ProtectionDomain
-26 -1: java.launcher.opt.vmselect
-4 -1: \tat
-42 -1: java/util/ArraysParallelSortHelpers$FJLong
-39 -1: (Ljava/lang/String;)[Ljava/lang/String;
-19 -1: sun.net.www.content
-34 -1: ([III)Ljava/util/stream/IntStream;
-20 -1: (Ljava/util/Deque;)V
-35 -1: (Ljava/lang/reflect/Constructor;)[B
-16 -1: WeakHashMap.java
-8 -1: ([III)[I
-46 -1: (Ljava/util/Properties;Ljava/io/InputStream;)V
-54 -1: (I)Ljava/util/concurrent/ConcurrentHashMap$KeySetView;
-65 -1: (ILjava/lang/Object;Ljava/lang/Object;ZZ)Ljava/util/HashMap$Node;
-27 -1: URI path component is empty
-3 -1: -1-
-32 -1: Ljava/io/InterruptedIOException;
-9 -1: setLocale
-7 -1: [^, ;]*
-6 -1: format
-61 -1: (Ljava/util/function/Supplier;IZ)Ljava/util/stream/IntStream;
-20 -1: getRequestProperties
-16 -1: reallocateMemory
-28 -1: java/lang/IllegalAccessError
-5 -1: query
-83 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class;II)Ljava/lang/invoke/MethodHandle;
-7 -1: threadQ
-6 -1: STATIC
-7 -1: enqueue
-21 -1: uninitializedCallSite
-3 -1: -2-
-26 -1: ()Ljava/util/NavigableSet;
-27 -1: getUncaughtExceptionHandler
-42 -1: ([Ljava/net/URL;)Ljava/net/URLClassLoader;
-30 -1: java/lang/UnsatisfiedLinkError
-39 -1: java/util/Collections$ReverseComparator
-7 -1: resolve
-4 -1: poll
-7 -1: (TE;I)V
-21 -1: : Unknown launch mode
-53 -1: (Ljava/lang/Class;)[Ljava/lang/annotation/Annotation;
-36 -1: sun.classloader.parentDelegationTime
-25 -1: java/net/URLStreamHandler
-39 -1: (Ljava/lang/Object;J)Ljava/lang/Object;
-53 -1: Ljava/util/Map<Ljava/lang/String;Ljava/lang/String;>;
-51 -1: java/util/ArraysParallelSortHelpers$FJDouble$Sorter
-26 -1: getAnnotatedParameterTypes
-18 -1: codePointCountImpl
-7 -1: threads
-12 -1: offsetBefore
-29 -1: ()Ljava/util/Collection<TV;>;
-58 -1: (Lsun/invoke/util/Wrapper;)Ljava/lang/invoke/MethodHandle;
-17 -1: DMH.invokeSpecial
-3 -1: -3-
-16 -1: decodeBufferLoop
-43 -1: java/util/concurrent/atomic/AtomicReference
-16 -1: reduceKeysToLong
-27 -1: newIllegalArgumentException
-3 -1: ALL
-5 -1: cache
-5 -1: queue
-4 -1: 8bit
-3 -1: -4-
-35 -1: Ljava/util/Set<Ljava/lang/String;>;
-9 -1: MIN_RADIX
-26 -1: ZipFileInflaterInputStream
-13 -1: MANIFEST_NAME
-18 -1: java/util/TimeZone
-175 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;Ljava/lang/invoke/MemberName;Ljava/lang/Class;Ljava/lang/invoke/DirectMethodHandle$1;)V
-16 -1: getContentLength
-11 -1: setDoOutput
-22 -1: (Ljava/io/Closeable;)V
-13 -1: TimeZone.java
-28 -1: sun/misc/ExtensionDependency
-6 -1: bindTo
-3 -1: -5-
-40 -1: ()[Ljava/util/WeakHashMap$Entry<TK;TV;>;
-20 -1: ()Lsun/misc/Cleaner;
-9 -1: compareTo
-68 -1: java/util/concurrent/ConcurrentHashMap$MapReduceMappingsToDoubleTask
-11 -1: checkedList
-14 -1: (ITK;TV;ZZ)TV;
-5 -1: greek
-3 -1: jar
-21 -1: (Ljava/lang/String;)B
-21 -1: (Ljava/lang/String;)C
-21 -1: (Ljava/lang/String;)D
-5 -1: (JS)V
-21 -1: (Ljava/lang/String;)F
-13 -1: LETTER_NUMBER
-14 -1: isAlphaNumeric
-21 -1: (Ljava/lang/String;)I
-73 -1: (Ljava/nio/charset/Charset;Ljava/lang/String;Ljava/lang/StringCoding$1;)V
-21 -1: (Ljava/lang/String;)J
-25 -1: makeExactOrGeneralInvoker
-3 -1: -6-
-25 -1: java/nio/StringCharBuffer
-21 -1: Ljava/util/Hashtable;
-8 -1: ENQUEUED
-8 -1: finalize
-22 -1: DirectLongBufferU.java
-21 -1: (Ljava/lang/String;)S
-10 -1: localhost:
-33 -1: isKnownNotToHaveSpecialAttributes
-21 -1: (Ljava/lang/String;)V
-45 -1: (Ljava/lang/Class<*>;[Ljava/lang/Class<*>;Z)V
-21 -1: (Ljava/lang/String;)Z
-22 -1: (Ljava/util/Vector;I)V
-44 -1: java/nio/charset/UnsupportedCharsetException
-23 -1: java/lang/CharacterName
-7 -1: checkIO
-33 -1: (I)Lsun/misc/URLClassPath$Loader;
-90 -1: (Ljava/lang/Class<*>;Ljava/lang/reflect/Constructor<*>;)Ljava/lang/reflect/Constructor<*>;
-18 -1: getHeaderFieldDate
-9 -1: MIN_VALUE
-95 -1: (Ljava/util/concurrent/locks/AbstractQueuedSynchronizer$ConditionObject;)Ljava/util/Collection;
-44 -1: (Ljava/lang/String;Z)Ljava/util/Enumeration;
-8 -1: NOVEMBER
-4 -1: gcal
-17 -1: getConnectTimeout
-124 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;[Ljava/lang/Object;)Ljava/lang/Object;
-24 -1: INDEXOFSUBLIST_THRESHOLD
-16 -1: isJulianLeapYear
-21 -1: reduceEntriesToDouble
-15 -1: getPrefixLength
-17 -1: is not param at
-14 -1: inDaylightTime
-39 -1: (Ljava/lang/Class;[I)Ljava/lang/Object;
-5 -1: force
-98 -1: (Ljava/lang/Class;Lsun/reflect/annotation/AnnotationType;Lsun/reflect/annotation/AnnotationType;)Z
-40 -1: (Lsun/reflect/ConstructorAccessorImpl;)V
-27 -1: RuntimeInvisibleAnnotations
-17 -1: checkTargetChange
-9 -1: skipBytes
-4 -1: port
-25 -1: sun/nio/cs/UTF_16$Encoder
-28 -1: MIN_SUPPLEMENTARY_CODE_POINT
-4 -1: node
-11 -1: not param:
-9 -1: debugInit
-6 -1: setURL
-14 -1: getMonthLength
-23 -1: ()Ljava/nio/ByteBuffer;
-17 -1: CALENDAR_JAPANESE
-11 -1: access$1400
-16 -1: ()Ljava/net/URI;
-29 -1: (IZ)Ljava/lang/StringBuilder;
-15 -1: Native Library
-30 -1: Invalid lambda deserialization
-14 -1: throwException
-18 -1: nothing to verify!
-23 -1: (Ljava/lang/Object;JF)V
-3 -1: ART
-16 -1: isExtClassLoader
-18 -1: Illegal Capacity:
-26 -1: java/util/zip/ZipException
-4 -1: /../
-34 -1: ([II)Ljava/util/Spliterator$OfInt;
-26 -1: (I)Ljava/util/Enumeration;
-60 -1: (Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodType;
-43 -1: not a field or nested class, no simple type
-12 -1: nextPutIndex
-15 -1: getConstructor0
-3 -1: AST
-11 -1: fromURIPath
-49 -1: (Ljava/util/Collections$UnmodifiableCollection;)V
-8 -1: makeImpl
-51 -1: (Ljava/util/WeakHashMap;Ljava/util/WeakHashMap$1;)V
-32 -1: (Ljava/util/function/Supplier;)V
-20 -1: namedFunctionInvoker
-37 -1: newGetBooleanIllegalArgumentException
-19 -1: (Ljava/io/File;ZI)V
-8 -1: NULL_KEY
-36 -1: Ljava/lang/reflect/Constructor<TT;>;
-21 -1: (Ljava/lang/Object;)B
-21 -1: (Ljava/lang/Object;)C
-21 -1: (Ljava/lang/Object;)D
-21 -1: (Ljava/lang/Object;)F
-30 -1: ()Lsun/util/locale/BaseLocale;
-21 -1: (Ljava/lang/Object;)I
-21 -1: (Ljava/lang/Object;)J
-10 -1: lineNumber
-95 -1: (JLjava/util/function/ToDoubleBiFunction<-TK;-TV;>;DLjava/util/function/DoubleBinaryOperator;)D
-16 -1: CoderResult.java
-44 -1: (Ljava/util/NavigableSet;Ljava/lang/Class;)V
-21 -1: (Ljava/lang/Object;)S
-13 -1: getNameString
-129 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;Ljava/lang/invoke/DirectMethodHandle$1;)V
-21 -1: (Ljava/lang/Object;)V
-21 -1: (Ljava/lang/Object;)Z
-81 -1: Ljava/util/HashMap<Ljava/lang/String;Ljava/util/LinkedList<Ljava/lang/String;>;>;
-49 -1: java/util/concurrent/locks/ReentrantLock$FairSync
-11 -1: csisolatin0
-11 -1: csisolatin1
-7 -1: isSpace
-10 -1: getDefault
-11 -1: csisolatin2
-16 -1: ()Ljava/net/URL;
-11 -1: csisolatin4
-14 -1: invokeExact_MT
-11 -1: csisolatin5
-28 -1: (Ljava/io/FileInputStream;)V
-11 -1: csisolatin9
-8 -1: isLetter
-15 -1: getConstructors
-21 -1: mainAppContextDefault
-29 -1: ()[Ljava/lang/reflect/Method;
-23 -1: Ljava/util/WeakHashMap;
-12 -1: LF_INVSTATIC
-17 -1: DirectBuffer.java
-10 -1: newEncoder
-10 -1: getVersion
-32 -1: java/lang/IllegalAccessException
-20 -1: java/util/Collection
-61 -1: (Ljava/util/concurrent/ConcurrentHashMap;Ljava/lang/Object;)V
-19 -1: $deserializeLambda$
-8 -1: removeIf
-25 -1: sun/reflect/FieldAccessor
-129 -1: <U::Ljava/lang/Comparable<-TU;>;>(Ljava/util/function/Function<-TT;+TU;>;Ljava/util/Comparator<-TU;>;)Ljava/util/Comparator<TT;>;
-17 -1: parseAbsoluteSpec
-37 -1: ([Ljava/util/HashMap$Node<TK;TV;>;I)V
-17 -1: java/util/HashSet
-13 -1: spreadInvoker
-20 -1: suppressAccessChecks
-32 -1: Ljava/lang/InterruptedException;
-11 -1: oldMappings
-9 -1: lookupTag
-16 -1: java/lang/System
-5 -1: LFI:
-6 -1: IBM737
-9 -1: SHORT_IDS
-45 -1: ([IIILjava/util/function/IntBinaryOperator;)V
-20 -1: getMetaInfEntryNames
-10 -1: isReadOnly
-50 -1: <E:Ljava/lang/Object;>()Ljava/util/SortedSet<TE;>;
-12 -1: java.vm.name
-30 -1: java/lang/Class$AnnotationData
-61 -1: (ILjava/lang/invoke/LambdaForm;)Ljava/lang/invoke/LambdaForm;
-7 -1: address
-44 -1: (Ljava/util/function/BiConsumer<-TK;-TV;>;)V
-58 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;I)V
-112 -1: (Ljava/lang/Object;TV;Ljava/lang/ref/ReferenceQueue<Ljava/lang/Object;>;ILjava/util/WeakHashMap$Entry<TK;TV;>;)V
-14 -1: aliases_KOI8_R
-3 -1: AWT
-14 -1: aliases_KOI8_U
-24 -1: ARRAY_DOUBLE_BASE_OFFSET
-23 -1: Ljava/util/jar/JarFile;
-91 -1: (Ljava/lang/Class<TT;>;[Ljava/lang/Class<*>;[Ljava/lang/Class<*>;IILjava/lang/String;[B[B)V
-14 -1: mappingAddress
-19 -1: [Ljava/lang/Object;
-17 -1: sun/misc/JarIndex
-9 -1: image/jpg
-49 -1: (Ljava/lang/String;I)Lsun/util/calendar/ZoneInfo;
-37 -1: java/lang/invoke/DirectMethodHandle$1
-34 -1: java/util/Collections$SingletonMap
-89 -1: (JLjava/util/function/ToIntBiFunction<-TK;-TV;>;ILjava/util/function/IntBinaryOperator;)I
-46 -1: (Ljava/util/Comparator;)Ljava/util/Comparator;
-11 -1: isTitleCase
-38 -1: java/lang/IllegalMonitorStateException
-33 -1: java/nio/BufferUnderflowException
-28 -1: java/lang/ClassValue$Version
-11 -1: printLocale
-13 -1: STORE_BARRIER
-42 -1: ([ILjava/util/function/IntUnaryOperator;)V
-26 -1: sun/util/locale/BaseLocale
-29 -1: java/io/ObjectStreamException
-41 -1: sun/reflect/UnsafeStaticFieldAccessorImpl
-60 -1: ([Ljava/lang/Object;Ljava/util/Iterator;)[Ljava/lang/Object;
-30 -1: (Ljava/nio/charset/Charset;)[B
-73 -1: ([Ljava/lang/String;[Ljava/lang/String;Ljava/io/File;)Ljava/lang/Process;
-3 -1: VST
-80 -1: Java(TM) SE Runtime Environment (build 1.8.0-internal-iklam_2013_11_27_21_25-b00
-85 -1: (Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/net/URLStreamHandler;)V
-20 -1: getStackTraceElement
-36 -1: java/util/LinkedHashMap$LinkedKeySet
-17 -1: getNormalizedYear
-15 -1: maxBytesPerChar
-16 -1: java/util/Random
-34 -1: (I[C)Ljava/lang/invoke/LambdaForm;
-11 -1: nbits < 0:
-7 -1: H_PCHAR
-29 -1: (Ljava/nio/charset/Charset;)I
-36 -1: (I[I[C)Ljava/lang/invoke/LambdaForm;
-23 -1: java/lang/ClassLoader$1
-23 -1: java/lang/ClassLoader$2
-23 -1: java/lang/ClassLoader$3
-9 -1: sizeTable
-36 -1: (Z)Ljava/lang/AbstractStringBuilder;
-29 -1: (Ljava/nio/charset/Charset;)V
-25 -1: ARRAY_BOOLEAN_INDEX_SCALE
-29 -1: (Ljava/nio/charset/Charset;)Z
-6 -1: keySet
-20 -1: declaredConstructors
-25 -1: oracle/jrockit/jfr/Timing
-12 -1: sizeIsSticky
-6 -1: IBM775
-17 -1: currentTimeMillis
-28 -1: java/nio/DirectDoubleBufferS
-71 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/invoke/MethodType;B)V
-28 -1: java/nio/DirectDoubleBufferU
-19 -1: cachedFixedDateJan1
-15 -1: getClassContext
-65 -1: (Ljava/security/CodeSource;Ljava/security/PermissionCollection;)V
-16 -1: unmodifiableList
-10 -1: getDoubleB
-82 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;)Ljava/lang/String;
-11 -1: getEntryCrc
-10 -1: getDoubleL
-20 -1: (C)Ljava/lang/Class;
-11 -1: Null action
-22 -1: java/io/BufferedWriter
-67 -1: (Ljava/lang/String;[Ljava/lang/Class<*>;)Ljava/lang/reflect/Method;
-22 -1: parseSelectAnnotations
-6 -1: rename
-20 -1: acquireFieldAccessor
-43 -1: (Ljava/util/Vector;[Ljava/lang/Object;III)V
-32 -1: Ljava/lang/NullPointerException;
-29 -1: (Ljava/lang/ThreadLocal<*>;)V
-18 -1: descendingIterator
-37 -1: java/util/Collections$SynchronizedSet
-24 -1: mark/reset not supported
-12 -1: ) > toIndex(
-13 -1: <<ALL FILES>>
-10 -1: fastRemove
-4 -1: load
-31 -1: sun/reflect/ReflectionFactory$1
-39 -1: (Ljava/util/List<*>;)Ljava/lang/Object;
-39 -1: Ljava/util/Map<TE;Ljava/lang/Boolean;>;
-9 -1: offerLast
-31 -1: ()Ljava/lang/invoke/MethodType;
-40 -1: <E:Ljava/lang/Object;>Ljava/lang/Object;
-17 -1: getObjectVolatile
-14 -1: suspendThreads
-55 -1: (Ljava/lang/String;ZLjava/util/Set;)Lsun/misc/Resource;
-75 -1: <T:Ljava/lang/Object;>(Ljava/util/List<+Ljava/lang/Comparable<-TT;>;>;TT;)I
-6 -1: Lookup
-20 -1: java/io/OutputStream
-41 -1: Could not create application class loader
-28 -1: Lsun/misc/JavaUtilJarAccess;
-46 -1: java/util/Collections$SynchronizedNavigableSet
-8 -1: override
-21 -1: threadLocalRandomSeed
-10 -1: TEXT_PLAIN
-22 -1: ([B)Ljava/lang/String;
-29 -1: java/nio/InvalidMarkException
-14 -1: Throwable.java
-27 -1: newWrongMethodTypeException
-6 -1: ptypes
-8 -1: bugLevel
-62 -1: (ILjava/lang/CharSequence;II)Ljava/lang/AbstractStringBuilder;
-37 -1: ()Ljava/util/Locale$LocaleNameGetter;
-14 -1: getEntryMethod
-7 -1: getByte
-12 -1: UTF-32BE-BOM
-4 -1: lock
-34 -1: java/security/AccessControlContext
-79 -1: (Ljava/lang/String;Ljava/lang/invoke/MethodType;I)Ljava/lang/invoke/MemberName;
-5 -1: DEBUG
-5 -1: unbox
-17 -1: CLASSPATH_OPTOSFT
-4 -1: cbrt
-21 -1: LocalizedObjectGetter
-21 -1: ProtectionDomain.java
-22 -1: ([J)Ljava/util/BitSet;
-17 -1: getUnresolvedName
-34 -1: (Ljava/util/Map;Ljava/util/Map;I)V
-7 -1: cskoi8r
-14 -1: getInterfaces0
-48 -1: (Lsun/net/www/MessageHeader;)[Ljava/lang/String;
-14 -1: getFileNameMap
-16 -1: preserveCombiner
-19 -1: getDefaultUseCaches
-57 -1: (Ljava/lang/Class;[B[Ljava/lang/Object;)Ljava/lang/Class;
-21 -1: (D)Ljava/lang/Double;
-15 -1: iso8859_15_fdis
-23 -1: java/util/regex/Pattern
-6 -1: ibm912
-14 -1: findBuiltinLib
-42 -1: java/lang/annotation/AnnotationFormatError
-6 -1: ibm914
-6 -1: ibm915
-44 -1: java/nio/charset/IllegalCharsetNameException
-22 -1: COMBINING_SPACING_MARK
-20 -1: ()Ljava/lang/Thread;
-8 -1: readLine
-12 -1: (unresolved
-65 -1: (Ljava/lang/String;Z)Ljava/util/Enumeration<Lsun/misc/Resource;>;
-41 -1: ([Ljava/lang/String;[Ljava/lang/String;)V
-30 -1: java/lang/Class$ReflectionData
-8 -1: requests
-52 -1: (Ljava/nio/charset/Charset;Lsun/nio/cs/US_ASCII$1;)V
-12 -1: ACCESS_WRITE
-6 -1: ibm920
-12 -1: CR_ERROR_MIN
-6 -1: jarMap
-6 -1: ibm923
-15 -1: java/lang/Error
-11 -1: VM_SETTINGS
-18 -1: name can't be null
-7 -1: PRESENT
-19 -1: setSecurityManager0
-101 -1: (Ljava/nio/channels/WritableByteChannel;Ljava/nio/charset/CharsetEncoder;I)Lsun/nio/cs/StreamEncoder;
-25 -1: ()Ljava/util/jar/JarFile;
-26 -1: java/io/ObjectOutputStream
-13 -1: no !/ in spec
-5 -1: (II)C
-12 -1: setPriority0
-30 -1: (Z)[Ljava/lang/reflect/Method;
-28 -1: sun/nio/cs/ThreadLocalCoders
-5 -1: (II)I
-22 -1: java/io/BufferedReader
-26 -1: ()Lsun/misc/JavaNetAccess;
-10 -1: Asia/Dhaka
-14 -1: parallelStream
-5 -1: (II)V
-5 -1: (II)Z
-31 -1: Ljava/lang/reflect/Constructor;
-21 -1: ()Ljava/time/Instant;
-31 -1: (Ljava/lang/String;III[J[I[IZ)V
-8 -1: Volatile
-23 -1: isUnicodeIdentifierPart
-27 -1: longPrimitiveParameterCount
-16 -1: Map is non-empty
-24 -1: getLocalizedOutputStream
-14 -1: java/lang/Byte
-10 -1: staticBase
-11 -1: lastElement
-17 -1: replaceStaleEntry
-17 -1: MAX_LOW_SURROGATE
-28 -1: java.launcher.X.macosx.usage
-20 -1: registerShutdownHook
-16 -1: SECOND_IN_MILLIS
-8 -1: Embedded
-16 -1: BootstrapMethods
-14 -1: numInvocations
-79 -1: <T:Ljava/lang/Object;>(Ljava/util/Collection<TT;>;)Ljava/util/Enumeration<TT;>;
-10 -1: rotateLeft
-46 -1: ([Ljava/lang/Object;)Ljava/util/stream/Stream;
-6 -1: verify
-17 -1: OTHER_PUNCTUATION
-26 -1: acquireConstructorAccessor
-38 -1: (Ljava/lang/String;I)Ljava/lang/Class;
-30 -1: java/net/UnknownContentHandler
-20 -1: PREFIX_LENGTH_OFFSET
-12 -1: nextGetIndex
-14 -1: standardOffset
-10 -1: entryNames
-15 -1: application/xml
-3 -1: BET
-39 -1: ([DIII)Ljava/util/Spliterator$OfDouble;
-83 -1: (JLjava/util/function/BiFunction;Ljava/util/function/BiFunction;)Ljava/lang/Object;
-10 -1: initMethod
-47 -1: (Ljava/util/LinkedList$Node;)Ljava/lang/Object;
-8 -1: isSealed
-12 -1: isAccessible
-11 -1: audio/x-wav
-46 -1: (Ljava/lang/String;)Ljava/util/jar/Attributes;
-24 -1: ()Ljava/io/OutputStream;
-15 -1: FIELD_MODIFIERS
-30 -1: sun/misc/URLClassPath$Loader$1
-20 -1: recursive invocation
-34 -1: (Ljava/lang/String;)Ljava/net/URL;
-12 -1: linkNodeLast
-34 -1: call site initialization exception
-17 -1: casAnnotationType
-8 -1: x-ibm874
-7 -1: isUpper
-58 -1: java/util/concurrent/ConcurrentHashMap$MapReduceValuesTask
-31 -1: Ill-formed Unicode locale key:
-12 -1: defineClass0
-12 -1: defineClass1
-12 -1: defineClass2
-59 -1: Can not call newInstance() on the Class for java.lang.Class
-10 -1: codePoints
-3 -1: ...
-14 -1: readAheadLimit
-14 -1: parallelSetAll
-41 -1: ([Ljava/lang/Object;I)[Ljava/lang/Object;
-148 -1: (Ljava/lang/Throwable$PrintStreamOrWriter;[Ljava/lang/StackTraceElement;Ljava/lang/String;Ljava/lang/String;Ljava/util/Set<Ljava/lang/Throwable;>;)V
-10 -1: Deque.java
-21 -1: Must be volatile type
-7 -1: setForm
-58 -1: Ljava/lang/Number;Ljava/lang/Comparable<Ljava/lang/Byte;>;
-47 -1: (Ljava/lang/String;Ljava/security/CodeSource;)V
-30 -1: java/io/InterruptedIOException
-44 -1: java/util/Collections$SynchronizedCollection
-16 -1: Invalid Jar file
-32 -1: sun/util/calendar/CalendarSystem
-67 -1: (JLsun/util/calendar/CalendarDate;)Lsun/util/calendar/CalendarDate;
-19 -1: DEFAULT_BUFFER_SIZE
-16 -1: readObjectNoData
-16 -1: setJavaNioAccess
-73 -1: (Ljava/lang/invoke/LambdaForm$Name;[Ljava/lang/Object;)Ljava/lang/Object;
-14 -1: copyToIntArray
-10 -1: hasWaiters
-20 -1: (I)Ljava/lang/Class;
-35 -1: all turn on all debugging
-14 -1: Invalid host:
-26 -1: Lsun/nio/cs/StreamEncoder;
-43 -1: sun/misc/JavaSecurityProtectionDomainAccess
-11 -1: getNamedCon
-8 -1: H_SERVER
-27 -1: java/util/function/Consumer
-12 -1: isLocalClass
-81 -1: (Ljava/util/LinkedHashMap$Entry<TK;TV;>;Ljava/util/LinkedHashMap$Entry<TK;TV;>;)V
-83 -1: Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/Comparable<Ljava/lang/Boolean;>;
-4 -1: exec
-43 -1: java/lang/reflect/InvocationTargetException
-35 -1: (Ljava/io/File;Ljava/lang/String;)V
-9 -1: modifiers
-35 -1: (Ljava/io/File;Ljava/lang/String;)Z
-9 -1: Byte.java
-12 -1: unknown mode
-18 -1: initializeVerifier
-24 -1: (Ljava/nio/ByteBuffer;)I
-22 -1: ([Ljava/lang/Object;)I
-11 -1: correctType
-6 -1: escape
-52 -1: (Ljava/security/ProtectionDomain;)Ljava/lang/String;
-11 -1: annotations
-121 -1: (Ljava/lang/Class;ILjava/lang/Class;Ljava/lang/String;Ljava/lang/Object;[Ljava/lang/Object;)Ljava/lang/invoke/MemberName;
-22 -1: using an instance of
-14 -1: getSpeciesData
-28 -1: ()Ljava/security/CodeSource;
-12 -1: JZENTRY_NAME
-24 -1: (Ljava/nio/ByteBuffer;)V
-4 -1: ZBSC
-22 -1: ([Ljava/lang/Object;)V
-7 -1: isParam
-165 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;Ljava/lang/String;)Ljava/lang/String;
-70 -1: (ILjava/util/List<Ljava/lang/Class<*>;>;)Ljava/lang/invoke/LambdaForm;
-24 -1: Ljava/io/FilePermission;
-22 -1: ([Ljava/lang/Object;)Z
-11 -1: mergeHeader
-11 -1: applyAsLong
-28 -1: (IJ)Ljava/lang/StringBuffer;
-10 -1: arityCheck
-52 -1: (ILjava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
-13 -1: toUpperCaseEx
-9 -1: nextIndex
-11 -1: start > end
-4 -1: long
-6 -1: Static
-27 -1: ()Ljava/lang/reflect/Field;
-10 -1: bufUpdater
-43 -1: averageBytesPerChar exceeds maxBytesPerChar
-105 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Lsun/util/locale/BaseLocale$1;)V
-23 -1: ARRAY_SHORT_INDEX_SCALE
-15 -1: getHeaderFields
-36 -1: java/util/HashMap$HashMapSpliterator
-10 -1: Guard.java
-29 -1: java/util/RandomAccessSubList
-6 -1: addAll
-7 -1: getTime
-16 -1: invokeHandleForm
-32 -1: sun/util/locale/LocaleExtensions
-16 -1: checkAndLoadMain
-19 -1: INTERFACE_MODIFIERS
-11 -1: resolveName
-20 -1: getContentLengthLong
-53 -1: (ICLjava/lang/Object;)Ljava/lang/invoke/MethodHandle;
-19 -1: name cannot be null
-23 -1: hasReceiverTypeDispatch
-12 -1: getExtension
-49 -1: Ljava/util/Set<Ljava/security/ProtectionDomain;>;
-114 -1: (Ljava/lang/String;[J[I[J[I[Lsun/util/calendar/ZoneInfoFile$ZoneOffsetTransitionRule;)Lsun/util/calendar/ZoneInfo;
-24 -1: NativeSignalHandler.java
-58 -1: (Ljava/lang/Thread;)Ljava/lang/ThreadLocal$ThreadLocalMap;
-10 -1: interface
-68 -1: (Ljava/lang/String;)Ljava/lang/invoke/BoundMethodHandle$SpeciesData;
-15 -1: addShutdownHook
-32 -1: java/security/AccessController$1
-10 -1: filterTags
-19 -1: [Ljava/lang/Number;
-92 -1: <T:Ljava/lang/Object;>(Ljava/util/function/ToLongFunction<-TT;>;)Ljava/util/Comparator<TT;>;
-43 -1: java/util/LinkedHashMap$LinkedEntryIterator
-5 -1: utf-8
-11 -1: iso-8859-13
-11 -1: iso-8859-15
-58 -1: (Lsun/misc/URLClassPath$JarLoader;)Ljava/util/jar/JarFile;
-41 -1: CertPathValidator debugging
-22 -1: ARRAY_LONG_BASE_OFFSET
-57 -1: (Ljava/lang/Object;[Ljava/lang/Object;)Ljava/lang/Object;
-13 -1: queuePrintJob
-14 -1: Watchable.java
-15 -1: jdkMajorVersion
-62 -1: (Ljava/lang/String;ZJJ)Ljava/lang/management/MemoryPoolMXBean;
-23 -1: twoToTheDoubleScaleDown
-22 -1: registerVMNotification
-30 -1: ()Lsun/misc/JavaUtilJarAccess;
-17 -1: getTargetVolatile
-4 -1: exit
-13 -1: StringDecoder
-12 -1: hasRemaining
-9 -1: bigEndian
-14 -1: checkMulticast
-13 -1: clearProperty
-18 -1: ForEachMappingTask
-15 -1: Collection.java
-55 -1: (Ljava/io/InputStream;)Ljava/security/cert/Certificate;
-5 -1: UTF-8
-11 -1: transitions
-7 -1: wrapAlt
-27 -1: ClassNotFoundException.java
-20 -1: UnresolvedPermission
-14 -1: charsetForName
-9 -1: getParent
-18 -1: [Ljava/lang/Short;
-24 -1: UnmodifiableNavigableMap
-5 -1: xflow
-10 -1: interfaces
-19 -1: doubleToRawLongBits
-73 -1: (Ljava/lang/reflect/Constructor<*>;[Ljava/lang/Object;)Ljava/lang/Object;
-10 -1: getInCheck
-21 -1: (Ljava/lang/Thread;)V
-15 -1: fromIndex < 0:
-63 -1: (ITK;TV;Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;)V
-9 -1: pollFirst
-21 -1: (Ljava/lang/Thread;)Z
-16 -1: checkProxyMethod
-39 -1: generateLambdaFormInterpreterEntryPoint
-15 -1: findLoadedClass
-6 -1: system
-5 -1: ITALY
-45 -1: combiner SubjectDomainCombiner debugging
-34 -1: NativeConstructorAccessorImpl.java
-22 -1: ([C)Ljava/lang/String;
-39 -1: (Ljava/lang/String;Ljava/lang/Class;Z)V
-18 -1: java/lang/Thread$1
-20 -1: window can't be null
-10 -1: Debug.java
-17 -1: singletonIterator
-53 -1: java/util/concurrent/ConcurrentHashMap$ForEachKeyTask
-20 -1: java/security/Policy
-13 -1: getDescriptor
-32 -1: (I)Ljava/lang/invoke/MethodType;
-15 -1: nativeLibraries
-27 -1: sun/util/locale/LanguageTag
-8 -1: priority
-12 -1: IntegerCache
-14 -1: connectTimeout
-9 -1: namePairs
-17 -1: vmAllowSuspension
-16 -1: METHOD_MODIFIERS
-51 -1: (Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
-20 -1: MIN_TREEIFY_CAPACITY
-13 -1: getEntryBytes
-33 -1: ()Lsun/reflect/ReflectionFactory;
-17 -1: getDisplayCountry
-13 -1: isWrapperType
-5 -1: utf16
-12 -1: parallelSort
-27 -1: (Ljava/nio/ByteBuffer;IIZ)V
-56 -1: (Ljava/lang/Class;Ljava/lang/Class;ILjava/lang/Class;I)Z
-9 -1: isDefined
-20 -1: sun/misc/FloatConsts
-10 -1: putDoubleB
-30 -1: java/lang/NoSuchFieldException
-27 -1: Value out of range. Value:"
-36 -1: sun/reflect/NativeMethodAccessorImpl
-7 -1: decoder
-38 -1: ([Ljava/lang/invoke/MutableCallSite;)V
-10 -1: putDoubleL
-68 -1: (Ljava/lang/reflect/Method;)Lsun/reflect/generics/scope/MethodScope;
-37 -1: java/lang/invoke/MethodHandles$Lookup
-9 -1: Void.java
-28 -1: sun/util/locale/BaseLocale$1
-10 -1: stackTrace
-7 -1: toClass
-11 -1: access$1500
-41 -1: (Ljava/lang/Object;I)Ljava/lang/Class<*>;
-148 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;Ljava/lang/Object;JLjava/lang/invoke/DirectMethodHandle$1;)V
-22 -1: ARRAY_BYTE_BASE_OFFSET
-13 -1: ZipEntry.java
-56 -1: (Ljava/util/List;Ljava/util/Collection;)Ljava/util/List;
-5 -1: utf32
-16 -1: ISO_646.irv:1991
-5 -1: p-126
-20 -1: sun.net.www.protocol
-3 -1: key
-20 -1: IMPLEMENTATION_TITLE
-93 -1: (Lsun/util/locale/BaseLocale;Lsun/util/locale/LocaleExtensions;)Lsun/util/locale/LanguageTag;
-66 -1: ([Ljava/lang/Object;[Ljava/lang/Object;IIILjava/util/Comparator;)V
-27 -1: java/nio/DirectFloatBufferS
-27 -1: java/nio/DirectFloatBufferU
-15 -1: JZENTRY_COMMENT
-8 -1: casTabAt
-10 -1: getVariant
-24 -1: Ljava/lang/Thread$State;
-35 -1: ()Ljava/lang/AbstractStringBuilder;
-114 -1: (Ljava/security/CodeSource;Ljava/security/PermissionCollection;Ljava/lang/ClassLoader;[Ljava/security/Principal;)V
-16 -1: getShortVolatile
-18 -1: SoftReference.java
-3 -1: BST
-12 -1: isCastableTo
-28 -1: sun.zip.disableMemoryMapping
-11 -1: copyOfRange
-17 -1: ()Lsun/misc/Perf;
-59 -1: (Ljava/lang/String;[Ljava/io/File;Ljava/lang/ClassLoader;)V
-27 -1: (Lsun/misc/JavaAWTAccess;)V
-8 -1: DECLARED
-18 -1: loadedLibraryNames
-6 -1: CENNAM
-7 -1: encprop
-5 -1: ABASE
-27 -1: java/util/WeakHashMap$Entry
-13 -1: wrapWithPrims
-5 -1: UTF32
-29 -1: Ljava/net/URISyntaxException;
-6 -1: groups
-65 -1: <T:Ljava/lang/Object;>(Ljava/util/Set<+TT;>;)Ljava/util/Set<TT;>;
-32 -1: lambda$comparingByKey$6d558cbf$1
-15 -1: removeElementAt
-49 -1: [Ljava/util/concurrent/ConcurrentHashMap$Segment;
-32 -1: Sign character in wrong position
-6 -1: IBM819
-39 -1: java/security/cert/CertificateException
-4 -1: join
-30 -1: Ljava/lang/invoke/ForceInline;
-14 -1: expandCapacity
-19 -1: Ljava/lang/Integer;
-11 -1: NUMBER_THAI
-10 -1: getExtURLs
-9 -1: retainAll
-21 -1: (S)Ljava/lang/String;
-8 -1: truncate
-51 -1: java/util/ArraysParallelSortHelpers$FJObject$Sorter
-28 -1: newIndexOutOfBoundsException
-26 -1: JavaUtilJarAccessImpl.java
-22 -1: (II)Ljava/util/BitSet;
-10 -1: getLongAt0
-65 -1: <A::Ljava/lang/annotation/Annotation;>(Ljava/lang/Class<TA;>;)TA;
-26 -1: (Ljava/lang/ThreadLocal;)I
-5 -1: (J)[B
-27 -1: Ljava/lang/CharacterData00;
-18 -1: sun/misc/Cleaner$1
-59 -1: (Ljava/util/List;Ljava/lang/Object;Ljava/util/Comparator;)I
-114 -1: (JLjava/util/function/ToDoubleFunction<Ljava/util/Map$Entry<TK;TV;>;>;DLjava/util/function/DoubleBinaryOperator;)D
-28 -1: java/lang/ClassCastException
-26 -1: (Ljava/lang/ThreadLocal;)V
-27 -1: ()[Ljava/lang/reflect/Type;
-13 -1: not invoker:
-56 -1: (Ljava/net/URL;Ljava/net/Proxy;)Ljava/net/URLConnection;
-6 -1: before
-37 -1: ([DII)Ljava/util/stream/DoubleStream;
-9 -1: logicalOr
-9 -1: IS_METHOD
-12 -1: SPACE_USABLE
-12 -1: lastModified
-10 -1: setSigners
-8 -1: Invokers
-7 -1: nCopies
-12 -1: utf-32le-bom
-7 -1: (IIII)J
-17 -1: jdkSpecialVersion
-26 -1: ()Ljava/lang/StringBuffer;
-17 -1: SearchEntriesTask
-14 -1: java/net/Parts
-20 -1: Ljava/lang/Runnable;
-35 -1: java/util/WeakHashMap$ValueIterator
-19 -1: FinalReference.java
-7 -1: (IIII)V
-23 -1: Ljava/lang/ThreadGroup;
-10 -1: nullsFirst
-8 -1: setCache
-55 -1: (Ljava/util/List;Ljava/lang/Object;Ljava/lang/Object;)Z
-24 -1: java/util/SimpleTimeZone
-6 -1: IBM850
-6 -1: IBM852
-25 -1: sun/net/www/MeteredStream
-4 -1: exts
-6 -1: IBM855
-16 -1: allocateElements
-6 -1: IBM857
-19 -1: setDefaultUseCaches
-6 -1: IBM858
-5 -1: slice
-9 -1: marklimit
-77 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction<Ljava/lang/Void;>;
-32 -1: java/util/Collections$CheckedSet
-12 -1: getModifiers
-8 -1: protocol
-10 -1: getInteger
-33 -1: ([J)Ljava/util/stream/LongStream;
-6 -1: IBM862
-8 -1: Map.java
-35 -1: java/lang/Class$EnclosingMethodInfo
-25 -1: (J)Ljava/math/BigInteger;
-31 -1: (Ljava/net/URL;Ljava/io/File;)V
-6 -1: IBM866
-6 -1: unload
-28 -1: sun/invoke/util/VerifyAccess
-105 -1: ()Ljava/util/Map<Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;Ljava/lang/annotation/Annotation;>;
-25 -1: Resetting to invalid mark
-20 -1: java/util/Vector$Itr
-5 -1: SHIFT
-11 -1: NonfairSync
-18 -1: getSecurityManager
-34 -1: ()[Ljava/lang/ClassValue$Entry<*>;
-28 -1: (J)Ljava/lang/StringBuilder;
-28 -1: (Ljava/security/PublicKey;)V
-12 -1: getResources
-6 -1: IBM874
-27 -1: which Java does not define
-36 -1: (Ljava/lang/invoke/MethodTypeForm;)V
-48 -1: array length is not legal for long[] or double[]
-18 -1: IS_FIELD_OR_METHOD
-7 -1: Aliases
-17 -1: checkedExceptions
-13 -1: getDayOfMonth
-51 -1: (Ljava/util/Spliterator;Z)Ljava/util/stream/Stream;
-20 -1: java/io/EOFException
-26 -1: Enclosing method not found
-17 -1: flushLeftoverChar
-122 -1: (Ljava/lang/Class<*>;[Ljava/lang/Class<*>;[Ljava/lang/Class<*>;IILjava/lang/String;[B[B)Ljava/lang/reflect/Constructor<*>;
-18 -1: buildAnnotatedType
-21 -1: setContextClassLoader
-22 -1: java/io/UnixFileSystem
-20 -1: nonSyncContentEquals
-43 -1: java/util/Collections$SynchronizedSortedMap
-15 -1: Properties.java
-35 -1: com.oracle.usagetracker.config.file
-13 -1: java/util/Map
-18 -1: setEagerValidation
-13 -1: getSetMessage
-6 -1: unlock
-14 -1: refKindIsField
-22 -1: bad field type alias:
-17 -1: casAnnotationData
-6 -1: AUGUST
-106 -1: (Ljava/util/concurrent/CountedCompleter;[Ljava/lang/Object;[Ljava/lang/Object;IIIILjava/util/Comparator;)V
-11 -1: monitorExit
-17 -1: linkMethodTracing
-69 -1: (Ljava/lang/String;Ljava/lang/String;Lsun/util/locale/BaseLocale$1;)V
-21 -1: java/lang/ClassLoader
-39 -1: PKCS11 KeyStore debugging
-10 -1: checkRtype
-25 -1: getLocalGregorianCalendar
-23 -1: GenericDeclaration.java
-12 -1: isViewableAs
-22 -1: static_oop_field_count
-72 -1: (Ljava/util/function/ToDoubleFunction<-TT;>;)Ljava/util/Comparator<TT;>;
-11 -1: languageKey
-6 -1: Class
-34 -1: java/util/HashMap$ValueSpliterator
-37 -1: (IJ)Ljava/lang/AbstractStringBuilder;
-17 -1: privilegedContext
-36 -1: java/util/LinkedHashMap$LinkedValues
-11 -1: getHostName
-10 -1: beginEntry
-7 -1: isAlpha
-61 -1: (Ljava/lang/invoke/MethodType;I)Ljava/lang/invoke/LambdaForm;
-10 -1: expandArgs
-14 -1: Finalizer.java
-14 -1: timeDefinition
-28 -1: ()Ljava/util/jar/Attributes;
-14 -1: ansi_x3.4-1968
-11 -1: setPriority
-23 -1: (C)Ljava/lang/Class<*>;
-26 -1: (Ljava/lang/Object;TV;)TV;
-70 -1: (Ljava/util/function/BiFunction;Ljava/lang/Object;Ljava/lang/Object;)V
-48 -1: ()Lsun/reflect/generics/factory/GenericsFactory;
-25 -1: java/lang/invoke/CallSite
-8 -1: tzdb.dat
-17 -1: containsAllLimits
-17 -1: fileNameMapLoaded
-6 -1: values
-17 -1: setLastAccessTime
-12 -1: expandFromVM
-50 -1: java/lang/invoke/MethodHandle$PolymorphicSignature
-3 -1: .EC
-14 -1: access denied
-22 -1: java/util/AbstractList
-47 -1: (IILjava/lang/String;)Ljava/lang/StringBuilder;
-52 -1: ()Lsun/reflect/generics/repository/MethodRepository;
-22 -1: (Ljava/lang/String;)[B
-57 -1: (Ljava/lang/Object;)Ljava/lang/invoke/DirectMethodHandle;
-18 -1: compareAndSwapLong
-4 -1: !=
-6 -1: StdArg
-29 -1: (Ljava/security/Permission;)V
-22 -1: ([D)Ljava/lang/String;
-28 -1: Lsun/reflect/MethodAccessor;
-14 -1: ansi_x3.4-1986
-20 -1: getPeakFinalRefCount
-29 -1: (Ljava/security/Permission;)Z
-5 -1: debug
-38 -1: (Ljava/lang/reflect/Constructor<*>;)[B
-27 -1: java/util/GregorianCalendar
-16 -1: Null replacement
-26 -1: ()Ljava/lang/reflect/Type;
-28 -1: DIRECTIONALITY_LEFT_TO_RIGHT
-102 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)Lsun/util/locale/BaseLocale;
-15 -1: isConvertibleTo
-24 -1: ARRAY_DOUBLE_INDEX_SCALE
-16 -1: getComponentType
-29 -1: sun/util/locale/LocaleMatcher
-11 -1: LOCALECACHE
-6 -1: UNWRAP
-16 -1: AbstractSet.java
-3 -1: CAT
-36 -1: java/lang/annotation/RetentionPolicy
-14 -1: getParameters0
-8 -1: .Handler
-33 -1: Ljava/lang/IllegalStateException;
-10 -1: RAW_RETURN
-20 -1: java/lang/ClassValue
-16 -1: getDisplayString
-152 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>([Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;I)Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
-67 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>()Ljava/util/Map<TK;TV;>;
-214 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
-33 -1: java/lang/invoke/SerializedLambda
-42 -1: ([Ljava/lang/Object;II)[Ljava/lang/Object;
-22 -1: java/util/zip/ZipUtils
-9 -1: setDaemon
-26 -1: java/net/HttpURLConnection
-6 -1: mkdirs
-20 -1: (Ljava/io/Reader;I)V
-28 -1: (IC)Ljava/lang/StringBuffer;
-45 -1: ([Ljava/lang/Class<*>;I)[Ljava/lang/Class<*>;
-29 -1: java/lang/invoke/MethodHandle
-28 -1: sun/misc/CompoundEnumeration
-6 -1: setVal
-23 -1: INTERNED_ARGUMENT_LIMIT
-4 -1: NULL
-49 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Class;)Z
-43 -1: java/util/Collections$UnmodifiableSortedMap
-39 -1: (Ljava/lang/Object;Ljava/lang/Object;)I
-6 -1: ([JJ)I
-19 -1: java/io/PrintWriter
-25 -1: ()Ljava/lang/ThreadGroup;
-5 -1: (IJ)J
-16 -1: onMalformedInput
-15 -1: decrementAndGet
-11 -1: -2147483648
-6 -1: reduce
-12 -1: asCharBuffer
-39 -1: (Ljava/lang/Object;Ljava/lang/Object;)V
-44 -1: (Ljava/util/SortedSet;)Ljava/util/SortedSet;
-9 -1: backtrace
-3 3: Bar
-47 -1: ()Lsun/misc/JavaSecurityProtectionDomainAccess;
-39 -1: (Ljava/lang/Object;Ljava/lang/Object;)Z
-5 -1: (IJ)V
-6 -1: ([JJ)V
-22 -1: ([Ljava/lang/Thread;)I
-5 -1: (IJ)Z
-7 -1: ([BII)I
-79 -1: <T:Ljava/lang/Object;>(Ljava/util/Comparator<-TT;>;)Ljava/util/Comparator<TT;>;
-12 -1: getUnchecked
-10 -1: getBaseURL
-36 -1: (Ljava/lang/Object;)Ljava/util/List;
-53 -1: (Ljava/util/function/Function;)Ljava/util/Comparator;
-10 -1: getComment
-7 -1: ([BII)V
-30 -1: privateGetDeclaredConstructors
-58 -1: (Ljava/lang/String;ZILjava/util/Locale;)Ljava/lang/String;
-18 -1: unknown era name:
-13 -1: invokeSpecial
-9 -1: checkLink
-16 -1: cspc8codepage437
-6 -1: stream
-18 -1: sun/nio/cs/UTF_8$1
-18 -1: contextClassLoader
-50 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;I)V
-30 -1: sun/util/calendar/BaseCalendar
-11 -1: enumeration
-18 -1: key can't be empty
-137 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<Ljava/util/Map$Entry<TK;TV;>;+TU;>;Ljava/util/function/BiFunction<-TU;-TU;+TU;>;)TU;
-10 -1: getBoolean
-5 -1: eetop
-49 -1: (Ljava/lang/invoke/MethodType;)Ljava/lang/String;
-43 -1: sun/reflect/generics/scope/ConstructorScope
-13 -1: CANADA_FRENCH
-39 -1: Ljava/nio/channels/ReadableByteChannel;
-15 -1: java/lang/Float
-29 -1: DIRECTIONALITY_OTHER_NEUTRALS
-52 -1: (ZLjava/nio/charset/Charset;Ljava/io/OutputStream;)V
-8 -1: appendTo
-19 -1: PARAGRAPH_SEPARATOR
-16 -1: (Unknown Source)
-4 -1: tree
-38 -1: (I[C)Ljava/lang/AbstractStringBuilder;
-14 -1: VerifierStream
-48 -1: (Ljava/util/Collection<TE;>;Ljava/lang/Object;)V
-15 -1: releaseInflater
-20 -1: getHeaderNamesInList
-17 -1: getSystemPackages
-8 -1: teardown
-6 -1: (BZI)I
-10 -1: checkWrite
-19 -1: JavaLangAccess.java
-31 -1: Ljava/lang/ClassValue$Identity;
-50 -1: (Ljava/util/concurrent/CountedCompleter;[S[SIIII)V
-24 -1: getDeclaredConstructors0
-3 -1: /..
-3 -1: /./
-16 -1: hashCodeForCache
-18 -1: Property settings:
-26 -1: Illegal initial capacity:
-10 -1: text/plain
-61 -1: (Ljava/util/function/ToDoubleFunction;)Ljava/util/Comparator;
-24 -1: createMemoryManagerMBean
-10 -1: ,lastRule=
-9 -1: GMT-00:00
-5 -1: mtime
-40 -1: (Ljava/lang/String;I)[Ljava/lang/String;
-11 -1: (TT;TV;)TV;
-154 -1: (Ljava/lang/Class<*>;Ljava/lang/String;[Ljava/lang/Class<*>;Ljava/lang/Class<*>;[Ljava/lang/Class<*>;IILjava/lang/String;[B[B[B)Ljava/lang/reflect/Method;
-41 -1: (Ljava/util/jar/JarFile;)Ljava/util/List;
-43 -1: (JILjava/lang/Object;)Ljava/nio/ByteBuffer;
-19 -1: MethodTypeForm.java
-21 -1: java/util/jar/JarFile
-30 -1: java/lang/Integer$IntegerCache
-22 -1: getDisplayVariantArray
-6 -1: setAll
-13 -1: ClassValueMap
-52 -1: (Ljava/security/PublicKey;Ljava/security/Provider;)V
-51 -1: java/util/concurrent/ConcurrentHashMap$BaseIterator
-59 -1: (Ljava/lang/Runnable;Ljava/security/AccessControlContext;)V
-100 -1: (Ljava/util/concurrent/ConcurrentMap;Ljava/util/function/BiFunction;)Ljava/util/function/BiConsumer;
-8 -1: default
-13 -1: compareAndSet
-10 -1: iso8859-13
-9 -1: putShortB
-14 -1: skipDelimiters
-28 -1: URI has a fragment component
-10 -1: iso8859-15
-42 -1: (Ljava/net/Proxy;)Ljava/net/URLConnection;
-23 -1: needsPackageAccessCheck
-9 -1: putShortL
-3 -1: //[
-69 -1: (Ljava/security/AccessControlContext;Ljava/security/DomainCombiner;)V
-18 -1: too many arguments
-35 -1: ([III)Ljava/util/Spliterator$OfInt;
-10 -1: CopiesList
-10 -1: iso-8859-1
-9 -1: ([BII[C)I
-10 -1: iso-8859-2
-11 -1: returnCount
-10 -1: iso-8859-4
-10 -1: iso-8859-5
-8 -1: utf_16be
-10 -1: iso-8859-7
-9 -1: isLimited
-9 -1: parseByte
-10 -1: iso-8859-9
-13 -1: , s.length()
-10 -1: matchCerts
-14 -1: RECURSIVE_CHAR
-11 -1: reduceToInt
-11 -1: displayName
-9 -1: calendars
-64 -1: (Ljava/lang/String;ZLjava/util/jar/JarEntry;)Lsun/misc/Resource;
-11 -1: isProtected
-78 -1: (Ljava/util/SortedMap;Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/SortedMap;
-4 -1: trim
-20 -1: java/nio/FloatBuffer
-17 -1: PreHashedMap.java
-74 -1: Ljava/util/concurrent/ConcurrentMap<Ljava/lang/String;Ljava/lang/String;>;
-22 -1: ([S)Ljava/lang/String;
-19 -1: PrintStreamOrWriter
-38 -1: java/util/Collections$EmptyEnumeration
-22 -1: java/util/LinkedList$1
-13 -1: sunpkcs11.jar
-25 -1: java/nio/DirectByteBuffer
-96 -1: (ZLjava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle;
-7 -1: isArray
-43 -1: (Ljava/lang/String;)Ljava/util/Enumeration;
-52 -1: java/lang/invoke/MethodHandleImpl$AsVarargsCollector
-59 -1: (Ljava/lang/String;Lsun/misc/Resource;)Ljava/lang/Class<*>;
-26 -1: setJavaNetHttpCookieAccess
-15 -1: wrongTargetType
-57 -1: java/util/concurrent/ConcurrentHashMap$ForEachMappingTask
-33 -1: [Ljava/lang/reflect/TypeVariable;
-5 -1: load0
-39 -1: (Ljava/lang/String;)Ljava/lang/Boolean;
-21 -1: isHeldByCurrentThread
-14 -1: outOfBoundsMsg
-30 -1: Ljava/lang/ref/Reference$Lock;
-11 -1: ISO-8859-13
-84 -1: <T:Ljava/lang/Object;>(Ljava/lang/ClassValue<TT;>;)Ljava/lang/ClassValue$Entry<TT;>;
-11 -1: ISO-8859-15
-40 -1: (Ljava/net/URL;)Ljava/net/URLConnection;
-84 -1: <T:Ljava/lang/Object;:Ljava/lang/Comparable<-TT;>;>(Ljava/util/Collection<+TT;>;)TT;
-38 -1: sun/reflect/generics/scope/MethodScope
-5 -1: mutex
-11 -1: loaderTypes
-8 -1: defaults
-22 -1: getActualTypeArguments
-41 -1: DIRECTIONALITY_EUROPEAN_NUMBER_TERMINATOR
-4 -1: keys
-71 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
-94 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;I)Ljava/lang/invoke/MethodHandle;
-113 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractSet<TE;>;Ljava/util/Set<TE;>;Ljava/lang/Cloneable;Ljava/io/Serializable;
-12 -1: checkConnect
-39 -1: (Ljava/lang/String;Ljava/util/Locale;)V
-26 -1: ([CII[C)Ljava/lang/String;
-12 -1: isDoubleWord
-37 -1: configparser JAAS ConfigFile parsing
-27 -1: sun/misc/Perf$GetPerfAction
-44 -1: (Ljava/util/Collections$UnmodifiableList;I)V
-4 -1: acos
-26 -1: java/nio/DirectLongBufferS
-7 -1: (ITE;)V
-14 -1: putIntVolatile
-24 -1: setContentHandlerFactory
-26 -1: java/nio/DirectLongBufferU
-10 -1: fieldCount
-11 -1: invokeBasic
-50 -1: (Ljava/util/zip/ZipEntry;)Ljava/util/jar/JarEntry;
-24 -1: java/util/Locale$Builder
-9 -1: setParent
-11 -1: asLifoQueue
-33 -1: lambda$comparingDouble$8dcf42ea$1
-24 -1: (Ljava/lang/Throwable;)I
-35 -1: (Lsun/misc/JavaUtilZipFileAccess;)V
-49 -1: (ILjava/lang/Object;)Ljava/util/HashMap$TreeNode;
-10 -1: CLASS_PATH
-6 -1: tclass
-11 -1: getExponent
-23 -1: getAnnotatedReturnType0
-18 -1: checkPackageAccess
-35 -1: Can not instantiate java.lang.Class
-24 -1: (Ljava/lang/Throwable;)V
-195 -1: (Ljava/lang/invoke/LambdaForm$Name;Ljava/lang/invoke/LambdaForm$Name;Ljava/lang/invoke/BoundMethodHandle$SpeciesData;Ljava/lang/invoke/BoundMethodHandle$SpeciesData;)Ljava/lang/invoke/LambdaForm;
-17 -1: Empty replacement
-3 -1: .SF
-14 -1: ByteOrder.java
-39 -1: ()Lsun/util/calendar/BaseCalendar$Date;
-35 -1: ()[Ljava/security/ProtectionDomain;
-12 -1: setElementAt
-30 -1: (Ljava/security/CodeSource;Z)Z
-45 -1: (Ljava/lang/Class<*>;)Ljava/lang/ClassLoader;
-52 -1: (Ljava/nio/charset/Charset;)Ljava/util/zip/ZipCoder;
-13 -1: foldArguments
-23 -1: java/time/LocalDateTime
-30 -1: [Lsun/launcher/LauncherHelper;
-16 -1: 0123456789abcdef
-60 -1: (Ljava/util/Spliterator$OfInt;Z)Ljava/util/stream/IntStream;
-33 -1: (ILjava/lang/String;IIIIIIIIIII)V
-20 -1: DMH.newInvokeSpecial
-28 -1: java/nio/charset/CoderResult
-33 -1: sun/nio/cs/StandardCharsets$Cache
-11 -1: saveConvert
-14 -1: ExtClassLoader
-12 -1: parentOrNull
-20 -1: insertParameterTypes
-32 -1: (II)Ljava/util/stream/IntStream;
-13 -1: setStackTrace
-20 -1: is not an enum type
-3 -1: CNT
-4 -1: host
-85 -1: ([Ljava/lang/Object;Ljava/util/function/IntFunction;)Ljava/util/function/IntConsumer;
-11 -1: batchRemove
-8 -1: newField
-16 5: sun/nio/cs/UTF_8
-104 -1: (Ljava/lang/invoke/LambdaForm$Name;Ljava/lang/invoke/LambdaForm$Name;)Ljava/lang/invoke/LambdaForm$Name;
-8 -1: saturday
-35 -1: java/util/ArraysParallelSortHelpers
-15 -1: java/util/Queue
-40 -1: (Ljava/lang/Class<*>;)Ljava/lang/String;
-7 -1: toChars
-5 -1: first
-17 -1: ArrayDecoder.java
-30 -1: ()Lsun/reflect/MethodAccessor;
-26 -1: thread group can't be null
-13 -1: IllegalName:
-32 -1: java/util/Collections$SetFromMap
-14 -1: line.separator
-17 -1: getDeclaredMethod
-10 -1: getMinutes
-35 -1: (Lsun/util/locale/BaseLocale$Key;)I
-40 -1: ([Ljava/lang/String;)Ljava/lang/Process;
-31 -1: Ljava/util/LinkedHashMap$Entry;
-13 -1: , str.length
-8 -1: getProbe
-6 -1: ([DI)I
-5 -1: (CI)I
-23 -1: saveAndRemoveProperties
-6 -1: rehash
-3 -1: lcb
-31 -1: Ljava/util/Arrays$NaturalOrder;
-55 -1: (IILjava/lang/String;)Ljava/lang/AbstractStringBuilder;
-10 -1: loadFactor
-15 -1: putLongVolatile
-34 -1: sun/misc/URLClassPath$FileLoader$1
-12 -1: Europe/Paris
-8 -1: DECEMBER
-86 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction<Lsun/misc/Launcher$AppClassLoader;>;
-22 -1: getImplMethodSignature
-38 -1: Malformed enclosing method information
-8 -1: maskNull
-3 -1: lct
-21 -1: CONSTRUCTOR_MODIFIERS
-36 -1: ()Lsun/misc/JavaNetHttpCookieAccess;
-12 -1: HashIterator
-84 -1: (Ljava/lang/Class;Ljava/lang/Class$AnnotationData;Ljava/lang/Class$AnnotationData;)Z
-33 -1: java/lang/Character$UnicodeScript
-5 -1: toHex
-27 -1: java/security/AllPermission
-17 -1: appendReplacement
-20 -1: SimpleImmutableEntry
-18 -1: getRequestProperty
-12 -1: compareCerts
-44 -1: java/util/ArrayPrefixHelpers$IntCumulateTask
-19 -1: makeSpreadArguments
-222 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceEntriesTask;Ljava/util/function/Function;Ljava/util/function/BiFunction;)V
-8 -1: addFirst
-6 -1: nextUp
-35 -1: (Ljava/net/ContentHandlerFactory;)V
-40 -1: (Ljava/lang/String;)Ljava/lang/Class<*>;
-23 -1: java/util/LocaleISOData
-14 -1: PREPARED_FORMS
-6 -1: FJByte
-20 -1: getGenericSuperclass
-6 -1: offset
-16 -1: LocaleUtils.java
-12 -1: isUnresolved
-18 -1: aliases_ISO_8859_1
-18 -1: aliases_ISO_8859_2
-15 -1: isSurrogatePair
-18 -1: aliases_ISO_8859_4
-18 -1: aliases_ISO_8859_5
-6 -1: EXTLEN
-18 -1: aliases_ISO_8859_7
-15 -1: Comparator.java
-18 -1: aliases_ISO_8859_9
-15 -1: ISO_8859-2:1987
-22 -1: Ljava/util/List<+TE;>;
-16 -1: Unknown Category
-3 -1: CST
-51 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractList<TE;>;
-6 -1: FRIDAY
-40 -1: (Ljava/lang/String;ZZ)Ljava/lang/String;
-13 -1: isInterrupted
-8 -1: utf_16le
-89 -1: (BLjava/lang/Class<*>;Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/DirectMethodHandle;
-22 -1: checkInvocationCounter
-12 -1: EPOCH_OFFSET
-35 -1: (JJILjava/nio/DirectByteBuffer$1;)V
-7 -1: canRead
-9 -1: getLoader
-18 -1: publicConstructors
-23 -1: factory already defined
-33 -1: java/lang/ref/ReferenceQueue$Null
-37 -1: (Ljava/util/List;Ljava/util/Random;)V
-25 -1: setPackageAssertionStatus
-20 -1: MapReduceEntriesTask
-11 -1: OPEN_DELETE
-35 -1: (Ljava/util/Set;Ljava/lang/Class;)V
-9 -1: rootGroup
-10 -1: updateForm
-22 -1: JavaUtilJarAccess.java
-3 -1: CTT
-57 -1: (Lsun/reflect/MethodInfo;)Ljava/lang/reflect/Constructor;
-82 -1: <T:Ljava/lang/Object;>(Ljava/util/NavigableSet<TT;>;)Ljava/util/NavigableSet<TT;>;
-13 -1: getReturnType
-34 -1: java/util/HashMap$EntrySpliterator
-14 -1: TIME_UNDEFINED
-32 -1: com/sun/crypto/provider/AESCrypt
-7 -1: H_DIGIT
-20 -1: clearAssertionStatus
-44 -1: java/lang/invoke/MethodHandleImpl$BindCaller
-8 -1: scloader
-6 -1: IBM923
-5 -1: read0
-5 -1: read1
-4 -1: true
-9 -1: BA_HIDDEN
-16 -1: jvmUpdateVersion
-36 -1: java/lang/StringCoding$StringDecoder
-37 -1: (J)Ljava/nio/file/attribute/FileTime;
-3 -1: lib
-17 -1: getParameterTypes
-15 -1: FinalizerThread
-31 -1: ()Lsun/util/calendar/Gregorian;
-50 -1: (Ljava/lang/CharSequence;)Ljava/lang/StringBuffer;
-13 -1: PROP_SETTINGS
-33 -1: java/util/function/BinaryOperator
-70 -1: (ILjava/util/List<Ljava/lang/Class<*>;>;)Ljava/lang/invoke/MethodType;
-25 -1: getDefaultRequestProperty
-27 -1: (Ljava/util/jar/JarEntry;)V
-27 -1: SPLITERATOR_CHARACTERISTICS
-18 -1: FieldAccessor.java
-10 -1: setComment
-62 -1: (Ljava/lang/String;)Ljava/lang/management/MemoryManagerMXBean;
-11 -1: array_klass
-39 -1: ()Ljava/lang/Class$EnclosingMethodInfo;
-67 -1: ([Ljava/lang/ClassValue$Entry<*>;ILjava/lang/ClassValue$Entry<*>;)I
-9 -1: (II[CII)I
-50 -1: (Ljava/util/jar/JarFile;Ljava/util/zip/ZipEntry;)V
-20 -1: SPECIFICATION_VENDOR
-72 -1: (Lsun/misc/URLClassPath$JarLoader;Ljava/net/URL;)Ljava/util/jar/JarFile;
-87 -1: <T:Ljava/lang/Object;>(Ljava/lang/ThreadLocal<Ljava/lang/ref/SoftReference<TT;>;>;TT;)V
-9 -1: isVarArgs
-10 -1: setBoolean
-12 -1: (TK;TV;TV;)Z
-16 -1: findSharedClass0
-5 -1: csize
-49 -1: Ljava/security/cert/CertificateEncodingException;
-40 -1: java/util/concurrent/locks/ReentrantLock
-86 -1: (Ljava/io/OutputStream;Ljava/lang/Object;Ljava/lang/String;)Lsun/nio/cs/StreamEncoder;
-5 -1: ready
-38 -1: Ljava/security/AccessControlException;
-28 -1: UnmodifiableRandomAccessList
-69 -1: <T:Ljava/lang/Object;>([TT;Ljava/util/function/BinaryOperator<TT;>;)V
-27 -1: Ljava/lang/invoke/Invokers;
-39 -1: java/util/LinkedList$DescendingIterator
-11 -1: writeFields
-17 -1: classLoaderDepth0
-18 -1: permutedTypesMatch
-52 -1: (Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/List;
-12 -1: linkToStatic
-10 -1: CheckedMap
-6 -1: CENOFF
-8 -1: lastRule
-15 -1: java/lang/Short
-39 -1: ()Ljava/lang/Class$ReflectionData<TT;>;
-8 -1: nextDown
-14 -1: image/x-pixmap
-39 -1: (Ljava/lang/Class;[Ljava/lang/Object;)V
-25 -1: defineClassSourceLocation
-23 -1: sun/misc/PostVMInitHook
-15 -1: could not load
-16 -1: allowArraySyntax
-90 -1: Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater<Ljava/io/BufferedInputStream;[B>;
-10 -1: putBoolean
-11 -1: has params
-14 -1: setMaxPriority
-10 -1: mayContain
-46 -1: java/lang/reflect/MalformedParametersException
-10 -1: baseLocale
-14 -1: isSubwordOrInt
-10 -1: nextDouble
-32 -1: java/lang/Character$UnicodeBlock
-85 -1: (JLjava/util/function/ToDoubleBiFunction;DLjava/util/function/DoubleBinaryOperator;)D
-20 -1: numberOfLeadingZeros
-59 -1: (I[Ljava/lang/Class<*>;)[Ljava/lang/invoke/LambdaForm$Name;
-7 -1: setSize
-29 -1: java/io/FileNotFoundException
-9 -1: getString
-24 -1: ([CII)Ljava/lang/String;
-38 -1: (Ljava/lang/String;Ljava/lang/Class;)V
-5 -1: shift
-18 -1: getConstructorSlot
-41 -1: java/lang/ThreadLocal$SuppliedThreadLocal
-16 -1: UNASSIGNED_STACK
-20 -1: Malformed class name
-12 -1: ofEpochMilli
-34 -1: sun/launcher/LauncherHelper$StdArg
-33 -1: java/nio/ByteBufferAsShortBufferB
-7 -1: convert
-21 -1: ()[Ljava/util/Locale;
-15 -1: ISO_8859-5:1988
-35 -1: av[0] not instace of MethodHandle:
-33 -1: java/nio/ByteBufferAsShortBufferL
-5 -1: hypot
-16 -1: InputStream.java
-13 -1: reinvokerForm
-39 -1: JVMTI_THREAD_STATE_WAITING_INDEFINITELY
-16 -1: sun/misc/Version
-66 -1: <T::Ljava/lang/annotation/Annotation;>(Ljava/lang/Class<TT;>;)[TT;
-11 -1: codePointAt
-30 -1: ([Ljava/lang/reflect/Method;)V
-9 -1: duplicate
-9 -1: interface
-5 -1: X.509
-24 -1: SynchronizedNavigableSet
-8 -1: us-ascii
-17 -1: getUnresolvedType
-21 -1: PRIVATE_USE_EXTENSION
-4 -1: form
-93 -1: (Ljava/util/ArrayPrefixHelpers$LongCumulateTask;Ljava/util/function/LongBinaryOperator;[JII)V
-27 -1: sealing violation: package
-34 -1: RuntimeVisibleParameterAnnotations
-17 -1: LF_INVSTATIC_INIT
-14 -1: Gregorian.java
-32 -1: java/util/function/UnaryOperator
-3 -1: log
-3 -1: low
-22 -1: sun/misc/JavaNetAccess
-9 -1: getLength
-21 -1: getRawTypeAnnotations
-36 -1: (Ljava/lang/String;)Ljava/lang/Long;
-9 -1: getNumber
-66 -1: (ILjava/lang/Object;)Ljava/util/concurrent/ConcurrentHashMap$Node;
-20 -1: (Ljava/lang/Class;)C
-89 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Map$Entry<TK;TV;>;
-6 -1: ENDSIG
-20 -1: (Ljava/lang/Class;)I
-20 -1: (Ljava/lang/Class;)J
-24 -1: [[Ljava/io/Serializable;
-22 -1: serialPersistentFields
-7 -1: console
-142 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
-27 -1: (Ljava/nio/ByteBuffer;ICZ)V
-20 -1: (Ljava/lang/Class;)V
-40 -1: java/lang/ArrayIndexOutOfBoundsException
-6 -1: this$0
-51 -1: (Ljava/lang/invoke/MemberName;[Ljava/lang/Object;)V
-18 -1: packageAccessValid
-33 -1: ([Ljava/lang/StackTraceElement;)V
-8 -1: constant
-113 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;IILjava/security/ProtectionDomain;Ljava/lang/String;)Ljava/lang/Class<*>;
-8 -1: isMethod
-20 -1: (Ljava/lang/Class;)Z
-6 -1: ENDSIZ
-8 -1: newEntry
-57 -1: (Ljava/lang/Object;)Ljava/lang/IndexOutOfBoundsException;
-25 -1: (Ljava/util/Comparator;)V
-8 -1: isBridge
-6 -1: ([BI)I
-6 -1: ([BI)J
-16 -1: getReferenceKind
-26 -1: [Ljava/security/Principal;
-71 -1: (Ljava/lang/Class;[Ljava/lang/reflect/Field;)[Ljava/lang/reflect/Field;
-32 -1: ()Ljava/lang/ClassValue$Version;
-16 -1: SearchValuesTask
-17 -1: setCompressedSize
-16 -1: DEFAULT_CAPACITY
-108 -1: <K:Ljava/lang/Object;V::Ljava/lang/Comparable<-TV;>;>()Ljava/util/Comparator<Ljava/util/Map$Entry<TK;TV;>;>;
-27 -1: java/util/ComparableTimSort
-41 -1: null StackTraceElement in serial stream.
-6 -1: ([BI)V
-44 -1: (Ljava/util/jar/JarFile;)Lsun/misc/JarIndex;
-71 -1: (Ljava/util/jar/JarFile;Ljava/util/Enumeration;)Ljava/util/Enumeration;
-52 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Class<*>;)Z
-36 -1: [Ljava/lang/reflect/TypeVariable<*>;
-17 -1: OutputStream.java
-8 -1: combiner
-15 -1: decodeArrayLoop
-19 -1: (Ljava/io/Writer;)V
-41 -1: (Ljava/util/List<*>;Ljava/util/List<*>;)I
-35 -1: ()[Ljava/security/cert/Certificate;
-33 -1: ([I)Ljava/util/Spliterator$OfInt;
-9 -1: NF_asType
-17 -1: java/io/Closeable
-11 -1: updateBytes
-12 -1: charsets.jar
-18 -1: getDeclaredFields0
-47 -1: (Ljava/lang/Object;I)Ljava/lang/reflect/Member;
-60 -1: (Ljava/lang/String;ILjava/lang/String;)Ljava/nio/ByteBuffer;
-15 -1: getTotalSeconds
-57 -1: (Ljava/util/Collection<+Ljava/util/Map$Entry<TK;TV;>;>;)Z
-4 -1: JULY
-10 -1: Exceptions
-41 -1: ()Ljava/util/List<Ljava/io/IOException;>;
-14 -1: ParseUtil.java
-13 -1: getJarFileURL
-29 -1: setJavaIOFileDescriptorAccess
-24 -1: ARRAY_OBJECT_BASE_OFFSET
-21 -1: onUnmappableCharacter
-53 -1: (Ljava/lang/Object;Ljava/lang/Object;)Ljava/util/Map;
-24 -1: MethodHandleNatives.java
-40 -1: java/nio/charset/MalformedInputException
-37 -1: [Ljava/lang/reflect/AnnotatedElement;
-15 -1: CLASSPATH_CHARS
-18 -1: [Ljava/lang/Class;
-7 -1: FJFloat
-47 -1: <T:Ljava/lang/Object;>(Ljava/util/List<TT;>;I)V
-19 -1: Ljava/lang/Runtime;
-23 -1: java/lang/CharacterData
-42 -1: (Ljava/lang/Void;Ljava/lang/ClassLoader;)V
-76 -1: (Ljava/nio/channels/ReadableByteChannel;Ljava/nio/charset/CharsetDecoder;I)V
-56 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class;B)V
-19 -1: java/util/zip/CRC32
-33 -1: <T:Ljava/lang/Object;>([TT;I)[TT;
-22 -1: ([F)Ljava/lang/String;
-5 -1: UTF_8
-20 -1: aliases_UTF_32BE_BOM
-11 -1: Buffer.java
-78 -1: <T:Ljava/lang/Object;>(Ljava/util/Comparator<TT;>;)Ljava/util/Comparator<TT;>;
-44 -1: (Ljava/lang/String;)Ljava/util/zip/ZipEntry;
-9 -1: malformed
-4 -1: JUNE
-51 -1: (Ljava/util/jar/JarFile;Ljava/util/jar/JarFile$1;)V
-6 -1: locale
-34 -1: (Ljava/util/function/BiFunction;)V
-10 -1: setMinutes
-40 -1: (Ljava/lang/reflect/AccessibleObject;Z)V
-12 -1: maybeCompile
-46 -1: (Ljava/lang/Class;Ljava/lang/reflect/Method;)V
-7 -1: getEras
-55 -1: <T:Ljava/lang/Object;>([TT;Ljava/util/Iterator<*>;)[TT;
-17 -1: toUnsignedString0
-32 -1: (Ljava/lang/invoke/MethodType;)V
-32 -1: (Ljava/lang/invoke/MethodType;)Z
-10 -1: Class.java
-27 -1: ()Ljava/util/Iterator<TK;>;
-29 -1: WINDOWS_EPOCH_IN_MICROSECONDS
-41 -1: (Ljava/io/InputStream;)Ljava/lang/String;
-4 -1: prev
-24 -1: ()Ljava/util/Properties;
-11 -1: awaitBooted
-19 -1: generateConstructor
-22 -1: sun/misc/SharedSecrets
-19 -1: getDateTimeInstance
-43 -1: (IIILsun/util/calendar/BaseCalendar$Date;)J
-5 -1: setID
-11 -1: Locale.java
-12 -1: getRootGroup
-15 -1: setLastModified
-7 -1: trouble
-28 -1: (Z)Ljava/lang/StringBuilder;
-5 -1: setIO
-17 -1: loadClassInternal
-23 -1: java/lang/ref/Finalizer
-8 -1: EmptySet
-16 -1: aliases_UTF_16BE
-50 -1: (Ljava/util/NavigableMap;)Ljava/util/NavigableMap;
-15 -1: unmodifiableMap
-48 -1: (Ljava/lang/Class<*>;)Lsun/reflect/ConstantPool;
-15 -1: arrayContentsEq
-7 -1: EXT_TAG
-31 -1: (Ljava/util/HashMap$TreeNode;)Z
-5 -1: cp737
-22 -1: java/util/zip/Checksum
-5 -1: names
-22 -1: ConcurrentHashMap.java
-7 -1: ([J[J)Z
-7 -1: WAITING
-31 -1: sun.launcher.resources.launcher
-14 -1: getThreadGroup
-8 -1: PutField
-12 -1: hugeCapacity
-9 -1: isPackage
-72 -1: (Ljava/lang/ThreadLocal<*>;)Ljava/lang/ThreadLocal$ThreadLocalMap$Entry;
-23 7: sun/nio/ch/DirectBuffer
-13 -1: Checksum.java
-25 -1: (Ljava/nio/ByteBuffer;I)C
-51 -1: (Ljava/lang/invoke/MethodHandle;)Ljava/lang/Object;
-25 -1: (Ljava/nio/ByteBuffer;I)D
-7 -1: treeify
-25 -1: (Ljava/nio/ByteBuffer;I)F
-5 -1: setIn
-25 -1: (Ljava/nio/ByteBuffer;I)I
-20 -1: TRACE_METHOD_LINKAGE
-25 -1: (Ljava/nio/ByteBuffer;I)J
-7 -1: putIntB
-22 -1: createGarbageCollector
-50 -1: <T:Ljava/lang/Object;>(Ljava/lang/Class<TT;>;)[TT;
-25 -1: (Ljava/nio/ByteBuffer;I)S
-7 -1: putIntL
-19 -1: (B)Ljava/lang/Byte;
-14 -1: Hashtable.java
-29 -1: java/lang/ArrayStoreException
-11 -1: all_allowed
-16 -1: getLastRawOffset
-7 -1: inReady
-36 -1: java/lang/ThreadLocal$ThreadLocalMap
-40 -1: (ILjava/lang/String;Ljava/lang/String;)V
-23 -1: Ljava/lang/ThreadLocal;
-16 -1: classValueOrNull
-62 -1: (Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/MethodHandle;
-23 -1: preparedFieldLambdaForm
-22 -1: (Z)Ljava/lang/Boolean;
-14 -1: ThreadLocalMap
-27 -1: java/lang/StackTraceElement
-13 -1: getEntryCSize
-19 -1: java.security.debug
-53 -1: (Ljava/util/Collection<*>;Ljava/util/Collection<*>;)Z
-6 -1: LOCLEN
-40 -1: Ljava/lang/Class<Ljava/lang/Character;>;
-6 -1: (JJB)V
-66 -1: Ljava/util/Hashtable<Ljava/lang/String;Ljava/net/ContentHandler;>;
-31 -1: [[Ljava/lang/StackTraceElement;
-9 -1: putStatic
-16 -1: Asia/Ho_Chi_Minh
-15 -1: getDisplayNames
-13 -1: convertToAbbr
-23 -1: Method not implemented.
-15 -1: isCCLOverridden
-14 -1: doubleCapacity
-137 -1: (Ljava/lang/Class<*>;ZLjava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Class<*>;)Ljava/util/List<Ljava/lang/invoke/MemberName;>;
-219 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceKeysTask;Ljava/util/function/Function;Ljava/util/function/BiFunction;)V
-7 -1: native
-29 -1: (Ljava/lang/reflect/Field;Z)V
-18 -1: Ljava/util/Locale;
-31 -1: Ljava/util/concurrent/TimeUnit;
-16 -1: threadsSuspended
-7 -1: ([III)V
-20 -1: setMaxDelimCodePoint
-18 -1: contentClassPrefix
-13 -1: mappingOffset
-10 -1: toIndex =
-47 -1: (Ljava/lang/CharSequence;)Ljava/io/PrintStream;
-12 -1: booleanValue
-13 -1: putMapEntries
-17 -1: defaultBundleName
-50 -1: (Ljava/util/concurrent/CountedCompleter;[B[BIIII)V
-10 -1: executable
-20 -1: java/time/ZoneOffset
-28 -1: java/lang/ref/FinalReference
-11 -1: newTreeNode
-7 -1: lookup2
-10 -1: TableStack
-59 -1: Ljava/util/concurrent/ConcurrentHashMap$ValuesView<TK;TV;>;
-11 -1: getAccessor
-9 -1: available
-18 -1: java/io/FileReader
-34 -1: java/security/ProtectionDomain$3$1
-16 -1: integer overflow
-11 -1: internTable
-28 -1: Ljava/util/HashMap$TreeNode;
-19 -1: | invocationCounter
-12 -1: findResource
-9 -1: isLoaded0
-5 -1: cp775
-24 -1: DIRECTIONALITY_UNDEFINED
-9 -1: isInvalid
-7 -1: lookupN
-35 -1: (Lsun/reflect/MethodAccessorImpl;)V
-6 -1: ENDSUB
-4 -1: to
-59 -1: ([Ljava/lang/Object;IILjava/lang/Class;)[Ljava/lang/Object;
-10 -1: meta-index
-6 -1: INDENT
-9 -1: WEDNESDAY
-40 -1: ()Ljava/lang/annotation/RetentionPolicy;
-14 -1: getUsableSpace
-7 -1: TUESDAY
-51 -1: (Ljava/lang/Class;I)Ljava/lang/invoke/MethodHandle;
-12 -1: getSubjectDN
-21 -1: Ljava/io/InputStream;
-25 -1: (IC)Ljava/nio/CharBuffer;
-52 -1: (Ljava/nio/CharBuffer;)Ljava/util/function/Supplier;
-17 -1: ()[Ljava/net/URL;
-6 -1: search
-10 -1: Main-Class
-8 -1: ([CIIC)I
-16 -1: Certificate.java
-14 -1: spreadInvokers
-22 -1: sun/nio/cs/ISO_8859_15
-6 -1: accept
-18 -1: ReflectAccess.java
-13 -1: java/nio/Bits
-14 -1: linkToCallSite
-46 -1: Ljava/nio/charset/UnsupportedCharsetException;
-8 -1: ([CIIC)V
-9 -1: (TT;TV;)V
-26 -1: java/lang/OutOfMemoryError
-34 -1: policy loading and granting
-76 -1: (Ljava/nio/CharBuffer;ILjava/nio/ByteBuffer;I)Ljava/nio/charset/CoderResult;
-13 -1: x-windows-949
-21 -1: Ljava/io/PrintStream;
-9 -1: initNames
-12 -1: testAnyFlags
-65 -1: (Ljava/lang/reflect/Method;)Ljava/lang/invoke/DirectMethodHandle;
-34 -1: (Ljava/util/List;)Ljava/util/List;
-10 -1: CacheEntry
-10 -1: hasAllPerm
-26 -1: java/nio/charset/Charset$1
-26 -1: java/nio/charset/Charset$2
-19 -1: ()Ljava/util/Stack;
-26 -1: java/nio/charset/Charset$3
-62 -1: (Ljava/lang/String;)Lsun/util/calendar/LocalGregorianCalendar;
-23 -1: ARRAY_FLOAT_INDEX_SCALE
-23 -1: (Ljava/lang/Object;IS)V
-13 -1: x-windows-950
-31 -1: Ljava/util/Hashtable$Entry<**>;
-87 -1: Ljava/util/WeakHashMap<Ljava/lang/ClassValue$Identity;Ljava/lang/ClassValue$Entry<*>;>;
-9 -1: permClass
-37 -1: (Ljava/security/ProtectionDomain$3;)V
-99 -1: <S::Lsun/reflect/generics/tree/Signature;>Lsun/reflect/generics/repository/AbstractRepository<TS;>;
-37 -1: ()Ljava/util/function/BinaryOperator;
-64 -1: java/util/Collections$UnmodifiableNavigableMap$EmptyNavigableMap
-91 -1: (Ljava/util/ArrayPrefixHelpers$IntCumulateTask;Ljava/util/function/IntBinaryOperator;[III)V
-6 -1: getCrc
-25 -1: ByteArrayInputStream.java
-9 -1: SYNTHETIC
-52 -1: Ljava/lang/ref/PhantomReference<Ljava/lang/Object;>;
-246 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceKeysToDoubleTask;Ljava/util/function/ToDoubleFunction;DLjava/util/function/DoubleBinaryOperator;)V
-38 -1: java/lang/Throwable$WrappedPrintStream
-21 -1: Illegal load factor:
-43 -1: Ljava/util/Deque<Ljava/util/zip/Inflater;>;
-3 -1: map
-6 -1: expand
-6 -1: access
-3 -1: max
-33 -1: impliesCreateAccessControlContext
-3 -1: may
-53 -1: java/util/concurrent/ConcurrentHashMap$ReduceKeysTask
-91 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction<Lsun/misc/URLClassPath$Loader;>;
-60 -1: attempt to add a Permission to a readonly Permissions object
-21 -1: canonicalizeExtension
-11 -1: copyValueOf
-25 -1: (IJ)Ljava/nio/LongBuffer;
-112 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<-TV;+TU;>;Ljava/util/function/BiFunction<-TU;-TU;+TU;>;)TU;
-11 -1: DeqIterator
-11 -1: SpeciesData
-8 -1: getCause
-16 -1: aliases_UTF_16LE
-51 -1: (TT;TV;Ljava/util/function/BinaryOperator<TV;>;)TV;
-25 -1: (JF)Ljava/nio/ByteBuffer;
-16 -1: sun/misc/IOUtils
-32 -1: Ljava/util/Locale$FilteringMode;
-6 -1: .class
-13 -1: getPermission
-13 -1: startsWithLOC
-8 -1: Identity
-23 -1: ([BII)Ljava/lang/Class;
-15 -1: putByteVolatile
-36 -1: (Ljava/util/Deque;)Ljava/util/Queue;
-22 -1: (Ljava/lang/Object;S)V
-47 -1: java/util/concurrent/ConcurrentHashMap$BulkTask
-4 -1: n =
-9 -1: (ITE;)TE;
-5 -1: zeroD
-18 -1: formatUnsignedLong
-29 -1: default display locale =
-23 -1: java/io/File$PathStatus
-5 -1: zeroF
-20 -1: Ljava/util/Set<TK;>;
-20 -1: (Ljava/util/List;I)V
-5 -1: zeroI
-5 -1: zeroJ
-7 -1: context
-39 -1: Ljava/nio/channels/WritableByteChannel;
-5 -1: zeroL
-34 -1: Lsun/util/calendar/CalendarSystem;
-24 -1: JVMTI_THREAD_STATE_ALIVE
-18 -1: (Ljava/util/Set;)V
-18 -1: (Ljava/util/Set;)Z
-42 -1: (TT;Ljava/lang/ref/ReferenceQueue<-TT;>;)V
-7 -1: entries
-30 -1: (Ljava/util/WeakHashMap;IIII)V
-15 -1: csisolatingreek
-38 -1: ([Ljava/lang/Class;)Ljava/lang/Object;
-12 -1: isMalformed3
-12 -1: isMalformed4
-5 -1: FJInt
-23 -1: java/util/LinkedHashMap
-20 -1: malformedInputAction
-12 -1: Charset.java
-5 -1: LLL_L
-42 -1: (Ljava/util/Collection;)Ljava/lang/Object;
-22 -1: makeMethodHandleInvoke
-3 -1: mdt
-7 -1: unicode
-12 -1: newInstance0
-10 -1: checkCerts
-34 -1: java/util/WeakHashMap$HashIterator
-23 -1: (Ljava/lang/Object;JI)I
-9 -1: hexDigits
-13 -1: javaToDosTime
-24 -1: (I)Ljava/nio/LongBuffer;
-6 -1: A_DATA
-12 -1: deepToString
-23 -1: (Ljava/lang/Object;JI)V
-91 -1: (JLjava/util/function/ToLongBiFunction<-TK;-TV;>;JLjava/util/function/LongBinaryOperator;)J
-23 -1: bad spread array length
-11 -1: readTimeout
-14 -1: toAbsolutePath
-8 -1: isFinite
-19 -1: currentLoadedClass0
-3 -1: \xef\xbf\xbd
-23 -1: (Ljava/nio/file/Path;)I
-8 -1: handlers
-21 -1: (Ljava/util/List;II)V
-89 -1: (Lsun/misc/URLClassPath$Loader;Ljava/lang/String;Ljava/net/URL;Ljava/net/URLConnection;)V
-8 -1: OVERFLOW
-8 -1: newTable
-8 -1: THURSDAY
-6 -1: notify
-12 -1: initialValue
-35 -1: (I)Ljava/util/LinkedList$Node<TE;>;
-18 -1: AsVarargsCollector
-26 -1: (Lsun/misc/JavaIOAccess;)V
-18 -1: ()Ljava/lang/Void;
-23 -1: (Ljava/nio/file/Path;)Z
-16 -1: MINUTE_IN_MILLIS
-67 -1: (Ljava/lang/Class;[Ljava/lang/Class;Z)Ljava/lang/invoke/MethodType;
-18 -1: Ljava/util/Vector;
-70 -1: (Ljava/lang/reflect/Constructor;[Ljava/lang/Object;)Ljava/lang/Object;
-40 -1: (Ljava/lang/Object;ILjava/lang/Object;)V
-25 -1: UnresolvedPermission.java
-14 -1: ReduceKeysTask
-21 -1: ()[Ljava/lang/Object;
-129 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;E:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Collection<TE;>;Ljava/io/Serializable;
-16 -1: ClassLoader.java
-46 -1: Ljava/util/Comparators$NaturalOrderComparator;
-17 -1: compareAndSwapInt
-22 -1: packageDefinitionValid
-41 -1: ([Ljava/lang/Object;[Ljava/lang/Object;)Z
-162 -1: (Ljava/util/List<Ljava/util/Locale$LanguageRange;>;Ljava/util/Collection<Ljava/lang/String;>;Ljava/util/Locale$FilteringMode;)Ljava/util/List<Ljava/lang/String;>;
-16 -1: sun.zip.zipFiles
-17 -1: java_runtime_name
-31 -1: (Ljava/lang/ClassValue$Entry;)V
-31 -1: (Ljava/lang/ClassValue$Entry;)Z
-30 -1: <T:Ljava/lang/Object;>(TT;)TT;
-39 -1: JavaSecurityProtectionDomainAccess.java
-24 -1: (I)Ljava/lang/Throwable;
-7 -1: FJShort
-9 -1: putFloatB
-19 -1: checkedNavigableSet
-25 -1: java/lang/invoke/Invokers
-18 -1: setIfModifiedSince
-14 -1: parameterTypes
-41 -1: (Ljava/lang/Object;Ljava/lang/Runnable;)V
-9 -1: putFloatL
-11 -1: getTypeCode
-5 -1: (ZZ)I
-24 -1: java/lang/ProcessBuilder
-9 -1: UNDERFLOW
-21 -1: VolatileCallSite.java
-24 -1: (C)Ljava/nio/CharBuffer;
-55 -1: java/util/concurrent/ConcurrentHashMap$ForEachValueTask
-26 -1: (Ljava/lang/String;[CII)[B
-18 -1: reduceKeysToDouble
-5 -1: (ZZ)Z
-23 -1: setCallSiteTargetNormal
-3 -1: min
-4 -1: ceil
-62 -1: (Ljava/lang/String;)Ljava/util/LinkedList<Ljava/lang/String;>;
-29 -1: (Ljava/util/AbstractList;II)V
-32 -1: Ljava/lang/Class$AnnotationData;
-21 -1: createFileExclusively
-64 -1: (Ljava/lang/ref/SoftReference;I)Ljava/lang/Class$ReflectionData;
-26 -1: java/lang/Short$ShortCache
-54 -1: (Ljava/net/URL;Ljava/io/File;)Ljava/net/URLConnection;
-29 -1: Lsun/nio/cs/Surrogate$Parser;
-58 -1: (Ljava/lang/Class;)Lsun/reflect/annotation/AnnotationType;
-8 -1: findForm
-53 -1: Ljava/lang/invoke/MethodType$ConcurrentWeakInternSet;
-39 -1: (Lsun/misc/Perf;Ljava/nio/ByteBuffer;)V
-16 -1: mergePermissions
-11 -1: totalMemory
-53 -1: java/lang/invoke/DirectMethodHandle$EnsureInitialized
-139 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/AbstractMap<TK;TV;>;Ljava/util/concurrent/ConcurrentMap<TK;TV;>;Ljava/io/Serializable;
-29 -1: java/util/HashMap$KeyIterator
-20 -1: STACK_TRACE_SENTINEL
-5 -1: order
-18 -1: java/lang/Runnable
-8 -1: GetField
-13 -1: Empty command
-7 -1: CONTROL
-9 -1: blockedOn
-12 -1: testAllFlags
-11 -1: getInflater
-16 -1: threadTerminated
-44 -1: (Ljava/lang/ThreadGroup;Ljava/lang/String;)V
-20 -1: java.runtime.version
-8 -1: peekLast
-23 -1: java/util/ArrayList$Itr
-21 -1: (Ljava/util/Locale;)V
-13 -1: isOptimizable
-8 -1: FairSync
-7 -1: CHINESE
-15 -1: initHelpMessage
-30 -1: ()Ljava/util/HashMap$TreeNode;
-29 -1: Ljava/lang/SecurityException;
-7 -1: charset
-35 -1: sun/security/util/SecurityConstants
-19 -1: sun.nio.cs.bugLevel
-8 2: Foo.java
-49 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;)V
-12 -1: EntrySetView
-37 -1: (Lsun/misc/JavaNetHttpCookieAccess;)V
-35 -1: Ljava/util/Hashtable$Entry<TK;TV;>;
-20 -1: NF_constructorMethod
-8 -1: getMonth
-38 -1: (Ljava/util/Iterator;Ljava/util/Map;)V
-14 -1: getIntVolatile
-6 -1: [name=
-8 -1: oop_size
-20 -1: Can't load library:
-30 -1: ()Ljava/util/Spliterator<TV;>;
-33 -1: Lsun/reflect/ConstructorAccessor;
-61 -1: Ljava/lang/Number;Ljava/lang/Comparable<Ljava/lang/Integer;>;
-15 -1: printVmSettings
-33 -1: stack include stack trace
-45 -1: ([Ljava/lang/Object;I)Ljava/util/Spliterator;
-37 -1: sun/reflect/generics/scope/ClassScope
-36 -1: java/io/UnsupportedEncodingException
-24 -1: (J)Ljava/nio/LongBuffer;
-11 -1: addressSize
-15 -1: ByteBuffer.java
-62 -1: (Ljava/lang/String;)Lsun/reflect/generics/tree/ClassSignature;
-9 -1: (TT;TT;)I
-25 -1: java/io/DefaultFileSystem
-15 -1: BaseLocale.java
-14 -1: BitSetIterator
-17 -1: AbstractList.java
-57 -1: Ljava/lang/ref/WeakReference<Ljava/lang/ThreadLocal<*>;>;
-178 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
-9 -1: arguments
-26 -1: java/util/Locale$LocaleKey
-9 -1: setLength
-29 -1: sun/nio/cs/ISO_8859_1$Decoder
-9 -1: zipfs.jar
-24 -1: Ljava/util/zip/ZipCoder;
-14 -1: , new state =
-93 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;IIIJLjava/util/concurrent/ConcurrentHashMap;)V
-39 -1: java/security/PrivilegedExceptionAction
-9 -1: dnsns.jar
-20 -1: iteratorBinarySearch
-14 -1: initializePath
-22 -1: DefaultFileSystem.java
-17 -1: Ljava/util/Deque;
-8 -1: DEFLATED
-11 -1: Can't load
-9 -1: ArrayList
-21 -1: negativeZeroFloatBits
-41 -1: (Ljava/lang/String;ILjava/util/Locale;)[C
-14 -1: ANSI_X3.4-1968
-39 -1: sun/reflect/annotation/AnnotationType$1
-3 -1: mod
-62 -1: Ljava/nio/Buffer;Ljava/lang/Comparable<Ljava/nio/ByteBuffer;>;
-29 -1: interpretWithArgumentsTracing
-6 -1: getDay
-47 -1: sun/reflect/generics/repository/ClassRepository
-19 -1: refKindDoesDispatch
-20 -1: getAnnotationsByType
-14 -1: needsExpansion
-18 -1: lastIndexOfSubList
-26 -1: JavaUtilZipFileAccess.java
-59 -1: (Ljava/lang/CharSequence;)Ljava/lang/AbstractStringBuilder;
-12 -1: ptypesOffset
-8 -1: hashcode
-18 -1: ([Ljava/net/URL;)V
-8 -1: iso-ir-6
-7 -1: jzentry
-52 -1: only dump output if specified codebase
-31 -1: lambda$comparingLong$6043328a$1
-5 -1: MARCH
-14 -1: ANSI_X3.4-1986
-14 -1: isMalformed3_2
-7 -1: IS_TYPE
-68 -1: Ljava/lang/Object;Ljava/lang/Comparable<Ljava/nio/charset/Charset;>;
-30 -1: protocol doesn't support input
-17 -1: getExtClassLoader
-14 -1: setProxiedHost
-73 -1: ()Ljava/util/Map<Ljava/lang/String;Ljava/util/List<Ljava/lang/String;>;>;
-16 -1: traceInterpreter
-17 -1: (Ljava/net/URL;)I
-5 -1: expm1
-18 -1: createInheritedMap
-66 -1: java/util/concurrent/ConcurrentHashMap$ForEachTransformedEntryTask
-17 -1: getTimeOfDayValue
-15 -1: zeroLengthArray
-20 -1: invalid permission:
-6 -1: REPORT
-15 -1: isNumericString
-78 -1: (Ljava/util/Locale;Ljava/lang/String;[Ljava/lang/Object;)Ljava/util/Formatter;
-6 -1: (TV;)Z
-25 -1: Lsun/misc/JavaLangAccess;
-29 -1: (I)Ljava/lang/reflect/Method;
-17 -1: (Ljava/net/URL;)V
-34 -1: ()Ljava/lang/Class$ReflectionData;
-50 -1: java.lang.invoke.MethodHandle.TRACE_METHOD_LINKAGE
-10 -1: copyWith:
-17 -1: (Ljava/net/URL;)Z
-32 -1: ()Ljava/util/stream/Stream<TE;>;
-22 -1: quickCheckMemberAccess
-29 -1: ()Lsun/net/www/MessageHeader;
-19 -1: getAssignedCombiner
-8 -1: ([JIIJ)I
-17 -1: formatUnsignedInt
-68 -1: <V:Ljava/lang/Object;>Ljava/util/AbstractMap<Ljava/lang/String;TV;>;
-34 -1: java/nio/ByteBufferAsDoubleBufferB
-32 -1: ([I)Ljava/util/stream/IntStream;
-9 -1: init_lock
-18 -1: must be resolved:
-42 -1: ()Ljava/nio/channels/spi/SelectorProvider;
-8 -1: ([JIIJ)V
-33 -1: IncompatibleClassChangeError.java
-34 -1: java/nio/ByteBufferAsDoubleBufferL
-31 -1: ()Ljava/util/function/Function;
-43 -1: Ljava/lang/Enum<Ljava/io/File$PathStatus;>;
-17 -1: availableCharsets
-49 -1: java/util/ArraysParallelSortHelpers$FJChar$Sorter
-22 -1: permission=<classname>
-22 -1: getAnnotatedSuperclass
-20 -1: isObjectPublicMethod
-15 -1: Attempt to get
-10 -1: createLong
-14 -1: HASH_INCREMENT
-32 -1: sun/management/ManagementFactory
-13 -1: separatorChar
-15 -1: bad field type
-8 -1: november
-27 -1: (F)Ljava/lang/StringBuffer;
-3 -1: EAT
-3 -1: mst
-54 -1: (Ljava/lang/reflect/Method;)Ljava/lang/reflect/Method;
-18 -1: Ljava/lang/Object;
-7 -1: ;:&=+$,
-12 -1: Handler.java
-7 -1: isDirty
-127 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedAction<TT;>;Ljava/security/AccessControlContext;[Ljava/security/Permission;)TT;
-14 -1: asTypeUncached
-5 -1: split
-200 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/reflect/AnnotatedElement;Ljava/lang/Class;Ljava/lang/reflect/Type;Lsun/reflect/annotation/TypeAnnotation$TypeAnnotationTarget;)Ljava/lang/reflect/AnnotatedType;
-47 -1: java.lang.invoke.MethodHandle.TRACE_INTERPRETER
-22 -1: sun/invoke/empty/Empty
-66 -1: (Ljava/util/Map;Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/Map;
-18 -1: jvm_update_version
-32 -1: (Ljava/util/Map;)Ljava/util/Map;
-14 -1: cacheLoadLimit
-8 -1: javaHome
-52 -1: (Ljava/lang/reflect/Field;)Ljava/lang/reflect/Field;
-20 -1: [[Ljava/lang/Object;
-19 -1: isJavaLetterOrDigit
-11 -1: loadLibrary
-32 -1: java/io/StreamCorruptedException
-14 -1: setAccessible0
-27 -1: sun/nio/cs/UTF_16LE$Encoder
-60 -1: (Ljava/lang/String;[Ljava/lang/Object;)Ljava/io/PrintStream;
-8 -1: segments
-10 -1: UTF_8.java
-3 -1: ECT
-5 -1: cp813
-5 -1: cp819
-61 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/util/Comparator;)I
-5 -1: Cache
-4 -1: sinh
-32 -1: java/util/function/ToIntFunction
-10 -1: setFactory
-24 -1: Illegal mappings count:
-16 -1: fileToEncodedURL
-38 -1: Ljava/lang/annotation/RetentionPolicy;
-27 -1: Ljava/net/SocketPermission;
-46 -1: (Ljava/lang/CharSequence;I)[Ljava/lang/String;
-11 -1: cardinality
-13 -1: getMonthValue
-64 -1: (Ljava/lang/invoke/MethodType;II)Ljava/lang/invoke/MethodHandle;
-6 -1: ENDTOT
-12 -1: getBytesUTF8
-9 -1: cacheLoad
-13 -1: packageAccess
-14 -1: sharedToString
-5 -1: merge
-29 -1: parameter type cannot be void
-27 -1: makePreparedFieldLambdaForm
-40 -1: Couldn't find 3-letter country code for
-166 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/net/URL;Ljava/lang/ClassLoader;)V
-19 -1: (Ljava/util/Map;Z)V
-13 -1: setExecutable
-17 -1: objectFieldOffset
-57 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)V
-128 -1: (Ljava/lang/Class<*>;ZLjava/lang/String;Ljava/lang/Class<*>;Ljava/lang/Class<*>;)Ljava/util/List<Ljava/lang/invoke/MemberName;>;
-61 -1: java/util/concurrent/ConcurrentHashMap$MapReduceKeysToIntTask
-6 -1: asType
-25 -1: java/io/ObjectStreamField
-15 -1: jvmMajorVersion
-124 -1: (Ljava/security/PrivilegedExceptionAction;Ljava/security/AccessControlContext;[Ljava/security/Permission;)Ljava/lang/Object;
-23 -1: (Ljava/lang/Class<*>;)C
-6 -1: andNot
-15 -1: getResponseCode
-59 -1: (Ljava/lang/StringBuffer;)Ljava/lang/AbstractStringBuilder;
-23 -1: (Ljava/lang/Class<*>;)I
-7 -1: seeAllp
-44 -1: (Ljava/lang/ClassLoader;[Ljava/lang/Class;)V
-13 -1: loadFromCache
-35 -1: sun/nio/cs/HistoricallyNamedCharset
-38 -1: (Ljava/lang/Class;[Ljava/lang/Class;)V
-19 -1: INVOKER_METHOD_TYPE
-16 -1: putShortVolatile
-12 -1: Asia/Karachi
-8 -1: cyrillic
-12 -1: getISO2Table
-23 -1: (Ljava/lang/Class<*>;)V
-3 -1: 1.4
-15 -1: LongBuffer.java
-6 -1: (IFZ)V
-23 -1: (Ljava/lang/Class<*>;)Z
-10 -1: initOutput
-9 -1: CELLSBUSY
-39 -1: java/security/PrivilegedActionException
-31 -1: sun/util/calendar/CalendarUtils
-202 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/reflect/AnnotatedElement;Ljava/lang/Class;[Ljava/lang/reflect/Type;Lsun/reflect/annotation/TypeAnnotation$TypeAnnotationTarget;)[Ljava/lang/reflect/AnnotatedType;
-20 -1: Ljava/lang/Class<*>;
-5 -1: cp850
-25 -1: (JI)Ljava/nio/ByteBuffer;
-5 -1: cp852
-24 -1: Invalid parameter name "
-39 -1: ([CII)Ljava/lang/AbstractStringBuilder;
-5 -1: cp855
-11 -1: Deallocator
-5 -1: cp857
-5 -1: cp858
-7 -1: ([SI)[S
-37 -1: ([C)Ljava/lang/AbstractStringBuilder;
-27 -1: java/lang/SecurityException
-82 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class;Ljava/lang/invoke/MethodHandle;)V
-38 -1: (Ljava/lang/String;)Ljava/lang/String;
-7 -1: connect
-7 -1: isEmpty
-11 -1: replaceNode
-19 -1: SuppliedThreadLocal
-12 -1: asFixedArity
-12 -1: fromIndex =
-19 -1: createMemoryManager
-9 -1: List.java
-8 -1: FEBRUARY
-21 -1: UnicodeLittleUnmarked
-6 -1: a null
-30 -1: ()Ljava/util/Spliterator<TT;>;
-5 -1: cp862
-17 -1: ZoneInfoFile.java
-5 -1: cp866
-8 -1: BulkTask
-53 -1: java/util/concurrent/locks/AbstractQueuedSynchronizer
-20 -1: FileInputStream.java
-12 -1: java.vm.info
-10 -1: newDecoder
-5 -1: (JB)V
-8 -1: filePath
-17 -1: spreadArrayChecks
-44 -1: ([Ljava/lang/Object;Ljava/util/Comparator;)V
-33 -1: java/util/Collections$AsLIFOQueue
-32 -1: Ljava/util/LinkedList$Node<TE;>;
-5 -1: cp874
-78 -1: (Ljava/util/Locale;Ljava/lang/String;[Ljava/lang/Object;)Ljava/io/PrintStream;
-39 -1: (JLjava/util/function/Consumer<-TK;>;)V
-15 -1: appendCodePoint
-20 -1: primitiveReturnCount
-54 -1: only dump output if specified permission
-20 -1: getGenericInterfaces
-41 -1: ([Ljava/lang/reflect/AccessibleObject;Z)V
-17 -1: nUnstartedThreads
-33 -1: (Ljava/lang/invoke/MemberName;Z)V
-24 -1: ARRAY_OBJECT_INDEX_SCALE
-40 -1: (Ljava/lang/String;ILjava/util/Locale;)I
-17 -1: java/io/Flushable
-22 -1: newConstructorAccessor
-26 -1: sun/misc/JavaUtilJarAccess
-6 -1: booted
-10 -1: setDoInput
-36 -1: (Ljava/lang/Class;)[Ljava/lang/Enum;
-19 -1: java/lang/Character
-52 -1: ([Ljava/net/URL;Ljava/net/URLStreamHandlerFactory;)V
-24 -1: (Ljava/nio/LongBuffer;)I
-16 -1: start > length()
-28 -1: (I)Ljava/lang/CharacterData;
-5 -1: val$c
-61 -1: (Ljava/lang/Throwable;Ljava/lang/String;[Ljava/lang/Object;)V
-13 -1: resolveOrNull
-9 -1: L_ESCAPED
-27 -1: MapReduceValuesToDoubleTask
-15 -1: getPreparedForm
-33 -1: (I)[Ljava/util/WeakHashMap$Entry;
-54 -1: ()Ljava/util/stream/Stream<+Ljava/util/zip/ZipEntry;>;
-16 -1: bad method type
-5 -1: val$s
-17 -1: Null charset name
-36 -1: java/lang/invoke/LambdaForm$Compiled
-24 -1: (Ljava/util/SortedMap;)V
-19 -1: java/time/LocalTime
-29 -1: not invocable, no method type
-21 -1: recalculateWordsInUse
-6 -1: val$id
-39 -1: sun/security/util/ManifestEntryVerifier
-60 -1: ([Ljava/lang/Class<*>;I)Ljava/lang/reflect/Constructor<TT;>;
-45 -1: java/util/ArrayPrefixHelpers$LongCumulateTask
-5 -1: OfInt
-11 -1: environment
-60 -1: ([Ljava/lang/Class<*>;[B)[[Ljava/lang/annotation/Annotation;
-7 -1: (JJJZ)V
-10 -1: BufferPool
-6 -1: isUTF8
-12 -1: threadLocals
-35 -1: (Ljava/lang/String;)[Ljava/net/URL;
-21 -1: Ljava/nio/LongBuffer;
-15 -1: copyConstructor
-25 -1: setCallSiteTargetVolatile
-15 -1: getNumericValue
-26 -1: Ljava/security/CodeSource;
-18 -1: Null output stream
-14 -1: cloneWithIndex
-23 -1: LOCAL_LISTEN_PERMISSION
-6 -1: (TT;)I
-46 -1: (Ljava/security/PublicKey;Ljava/lang/String;)V
-6 -1: setCrc
-26 -1: java/io/FilterOutputStream
-10 -1: access$000
-10 -1: access$001
-10 -1: access$002
-6 -1: (TT;)V
-78 -1: <T:Ljava/lang/Object;U:Ljava/lang/Object;>([TU;IILjava/lang/Class<+[TT;>;)[TT;
-41 -1: java/util/concurrent/atomic/AtomicInteger
-8 -1: renameTo
-40 -1: (Ljava/lang/Class<*>;)Ljava/lang/Object;
-17 -1: getRawAnnotations
-29 -1: java/lang/VirtualMachineError
-37 -1: java/lang/management/MemoryPoolMXBean
-25 -1: (II)Ljava/util/List<TE;>;
-6 -1: utf_16
-23 -1: (Ljava/lang/String;[B)V
-19 -1: MIN_ARRAY_SORT_GRAN
-25 -1: array length is not legal
-45 -1: java/util/concurrent/locks/ReentrantLock$Sync
-36 -1: Ljava/security/AccessControlContext;
-48 -1: sun/reflect/generics/repository/MethodRepository
-24 -1: MethodHandleStatics.java
-24 -1: addThreadDumpForMonitors
-64 -1: <T:Ljava/lang/Object;>(Ljava/util/Set<TT;>;)Ljava/util/Set<TT;>;
-58 -1: (Ljava/lang/String;[Ljava/lang/Object;Ljava/lang/Object;)Z
-37 -1: (III)Lsun/util/calendar/CalendarDate;
-9 -1: createURI
-15 -1: unreserveMemory
-52 -1: (Lsun/reflect/MethodInfo;)Ljava/lang/reflect/Method;
-66 -1: (Ljava/lang/Class;[Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
-51 -1: (Ljava/lang/reflect/Constructor;)Ljava/lang/String;
-23 -1: inheritableThreadLocals
-63 -1: ()Ljava/util/Map<Ljava/lang/String;Ljava/lang/reflect/Method;>;
-16 -1: setContentLength
-16 -1: LOWERCASE_LETTER
-4 -1: size
-25 -1: java.launcher.opt.hotspot
-19 -1: buildAnnotatedTypes
-26 -1: JAVAFX_LAUNCHER_CLASS_NAME
-11 -1: getAliasMap
-19 -1: CheckedNavigableSet
-15 -1: getAbsolutePath
-11 -1: doubleValue
-6 -1: utf_32
-22 -1: IMPLEMENTATION_VERSION
-3 -1: ne1
-11 -1: contentType
-8 -1: canWrite
-11 -1: Object.java
-14 -1: America/Denver
-8 -1: fileName
-13 -1: allPermDomain
-27 -1: ()Ljava/util/Iterator<TE;>;
-31 -1: (Lsun/reflect/MethodAccessor;)V
-11 -1: asTypeCache
-13 -1: lineSeparator
-9 -1: JarLoader
-15 -1: replacementNode
-18 -1: getContentEncoding
-12 -1: invoke_LLL_L
-22 -1: ()Ljava/util/TimeZone;
-17 -1: Reference Handler
-33 -1: java/lang/invoke/MethodHandleImpl
-47 -1: ()Ljava/util/concurrent/ConcurrentHashMap$Node;
-12 -1: invoke_LLL_V
-8 -1: form <<
-23 -1: (Ljava/lang/Object;JJ)J
-15 -1: isHighSurrogate
-31 -1: (Ljava/util/Collection<+TV;>;)Z
-36 -1: ([Ljava/util/HashMap$Node<TK;TV;>;)V
-23 -1: (Ljava/lang/Object;JJ)V
-12 -1: utf_32be_bom
-40 -1: sun/util/calendar/LocalGregorianCalendar
-27 -1: [Ljava/security/CodeSigner;
-15 -1: afterNodeAccess
-13 -1: nextThreadNum
-18 -1: INTERNED_ARGUMENTS
-11 -1: getMillisOf
-18 -1: offsetByCodePoints
-11 -1: writeObject
-48 -1: (Ljava/util/Locale$Category;Ljava/util/Locale;)V
-3 -1: nfe
-41 -1: (Ljava/util/Properties;Ljava/io/Reader;)V
-50 -1: (Ljava/util/concurrent/CountedCompleter;[C[CIIII)V
-15 -1: implFlushBuffer
-33 -1: (I)[Ljava/lang/invoke/MemberName;
-12 -1: Unicode.java
-17 -1: DMH.invokeVirtual
-5 -1: setup
-51 -1: (Ljava/util/Collection;[Ljava/lang/reflect/Field;)V
-3 -1: EST
-7 -1: TREEBIN
-7 -1: getFile
-10 -1: isLeapYear
-18 -1: LinkedHashIterator
-14 -1: DISPLAY_SCRIPT
-25 -1: privateGetDeclaredMethods
-68 -1: (Ljava/util/function/Function;Ljava/lang/Object;Ljava/lang/Object;)I
-22 -1: ()Ljava/util/Iterator;
-21 -1: sun/management/Sensor
-15 -1: getAvailableIDs
-51 -1: Lsun/util/PreHashedMap<Ljava/nio/charset/Charset;>;
-8 -1: elot_928
-6 -1: LATIN0
-45 -1: ([Ljava/lang/Object;II[Ljava/lang/Object;II)V
-10 -1: [Unlocked]
-15 -1: internArguments
-6 -1: LATIN9
-33 -1: (II)Ljava/lang/invoke/MethodType;
-12 -1: Version.java
-17 -1: setConnectTimeout
-75 -1: (Ljava/util/Locale;Ljava/lang/String;[Ljava/lang/Object;)Ljava/lang/String;
-13 -1: highSurrogate
-12 -1: Africa/Cairo
-21 -1: synchronizedSortedMap
-21 -1: in java.library.path
-45 -1: sun/reflect/generics/tree/FormalTypeParameter
-24 -1: UncaughtExceptionHandler
-14 -1: previousOrSame
-24 -1: java/security/Permission
-9 -1: x-ISCII91
-5 -1: L_HEX
-35 -1: java/lang/invoke/DirectMethodHandle
-35 -1: java/util/ArrayDeque$DeqSpliterator
-14 -1: java/util/List
-11 -1: toLowerCase
-24 -1: java/nio/charset/Charset
-10 -1: MIN_NORMAL
-110 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
-13 -1: regionMatches
-17 -1: newMethodAccessor
-26 -1: (Ljava/net/InetAddress;B)V
-68 -1: (Ljava/util/zip/ZipFile;Ljava/lang/String;J)Ljava/util/zip/ZipEntry;
-22 -1: ()Ljava/io/FileSystem;
-19 -1: primitiveSimpleName
-5 -1: MOVED
-9 -1: STATE_RED
-13 -1: linkToSpecial
-19 -1: AnnotationType.java
-20 -1: (II)Ljava/util/List;
-252 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceMappingsToDoubleTask;Ljava/util/function/ToDoubleBiFunction;DLjava/util/function/DoubleBinaryOperator;)V
-12 -1: callSiteForm
-22 -1: isSiblingBindingBefore
-62 -1: <T:Ljava/lang/Object;>([TT;IITT;Ljava/util/Comparator<-TT;>;)I
-15 -1: buildEmptyNames
-11 -1: Thread.java
-30 -1: Ljava/lang/ref/Reference<TT;>;
-35 -1: sun/reflect/MethodAccessorGenerator
-152 -1: (Ljava/util/function/Function;Ljava/util/function/Function;Ljava/util/function/BinaryOperator;Ljava/util/function/Supplier;)Ljava/util/stream/Collector;
-5 -1: total
-242 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceValuesToLongTask;Ljava/util/function/ToLongFunction;JLjava/util/function/LongBinaryOperator;)V
-27 -1: javax/security/auth/Subject
-43 -1: JVMTI_THREAD_STATE_BLOCKED_ON_MONITOR_ENTER
-17 -1: getSignerCertPath
-15 -1: registerNatives
-21 -1: sun/reflect/FieldInfo
-54 -1: (Ljava/nio/charset/Charset;Lsun/nio/cs/ISO_8859_1$1;)V
-17 -1: unwrapWithNoPrims
-17 -1: instanceof Long:
-20 -1: hasRealParameterData
-23 -1: ()Ljava/time/LocalTime;
-14 -1: getAnnotations
-8 -1: optimize
-7 -1: setChar
-11 -1: OFFSET_MASK
-4 -1: TYPE
-177 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/BiFunction;Ljava/util/concurrent/atomic/AtomicReference;)V
-18 -1: removeShutdownHook
-27 -1: ()Ljava/security/Principal;
-29 -1: JAVAFX_APPLICATION_CLASS_NAME
-6 -1: digits
-37 -1: [Ljava/lang/reflect/Constructor<TT;>;
-45 -1: ()Ljava/lang/Thread$UncaughtExceptionHandler;
-7 -1: tryLock
-19 -1: java/net/Proxy$Type
-21 -1: setJavaSecurityAccess
-13 -1: tieBreakOrder
-3 -1: no
-16 -1: Australia/Sydney
-13 -1: DAY_IN_MILLIS
-19 -1: ()Ljava/nio/Buffer;
-12 -1: Integer.java
-14 -1: isBmpCodePoint
-6 -1: daemon
-23 -1: Lsun/misc/JavaIOAccess;
-106 -1: <U:Ljava/lang/Object;>(JLjava/util/function/BiFunction<-TK;-TV;+TU;>;Ljava/util/function/Consumer<-TU;>;)V
-10 -1: getFloatAt
-15 -1: content/unknown
-52 -1: ()Ljava/util/Enumeration<+Ljava/util/zip/ZipEntry;>;
-123 -1: <T:Ljava/lang/Object;>(Ljava/lang/Class<*>;Lsun/reflect/annotation/AnnotationType;Lsun/reflect/annotation/AnnotationType;)Z
-4 -1: nsme
-12 -1: prefixLength
-9 -1: flagsMods
-95 -1: (BLjava/lang/invoke/MemberName;Ljava/lang/Class;Ljava/lang/Class;)Ljava/lang/invoke/MemberName;
-62 -1: (Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/LambdaForm;
-16 -1: Illegal mode: 0x
-24 -1: java/io/FileOutputStream
-41 -1: [Pp][Ee][Rr][Mm][Ii][Ss][Ss][Ii][Oo][Nn]=
-24 -1: java/security/CodeSource
-16 -1: DUMP_CLASS_FILES
-25 -1: ([C)Ljava/nio/CharBuffer;
-12 -1: bindArgument
-50 -1: Ljava/lang/ref/FinalReference<Ljava/lang/Object;>;
-21 -1: unmodifiableSortedMap
-10 -1: jarHandler
-73 -1: (Ljava/lang/Class;[Ljava/lang/reflect/Method;)[Ljava/lang/reflect/Method;
-67 -1: ()Ljava/util/Map<Ljava/lang/Thread;[Ljava/lang/StackTraceElement;>;
-15 -1: threadSeqNumber
-18 -1: AutoCloseable.java
-9 -1: holdsLock
-25 -1: (Ljava/lang/Object;JJJJ)V
-7 -1: (IJII)I
-15 -1: copyToLongArray
-58 -1: Ljava/util/HashMap<Ljava/lang/String;Ljava/lang/Package;>;
-84 -1: (Ljava/lang/invoke/MethodHandle;I[Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle;
-32 -1: getExecutableTypeAnnotationBytes
-17 -1: streamHandlerLock
-35 -1: java/lang/IndexOutOfBoundsException
-15 -1: moveRootToFront
-28 -1: ()Ljava/nio/file/FileSystem;
-14 -1: content-length
-61 -1: (Ljava/lang/invoke/CallSite;Ljava/lang/invoke/MethodHandle;)V
-7 -1: csASCII
-18 -1: staticIsConsistent
-21 -1: sharedToGenericString
-8 -1: linkLast
-21 -1: isUnicodeExtensionKey
-7 -1: readInt
-7 -1: compile
-32 -1: ()Ljava/lang/reflect/Executable;
-4 -1: Big5
-20 -1: Ljava/util/Set<TE;>;
-18 -1: ExpiringCache.java
-44 -1: (Ljava/lang/String;[BII)Ljava/lang/Class<*>;
-18 -1: LinkedHashMap.java
-32 -1: Ljava/lang/UnsatisfiedLinkError;
-13 -1: parameterType
-28 -1: (ID)Ljava/lang/StringBuffer;
-15 -1: synchronizedSet
-9 -1: implClose
-6 -1: member
-14 -1: MH_INVOKE_MODS
-21 -1: forOutputStreamWriter
-37 -1: Lsun/misc/JavaIOFileDescriptorAccess;
-28 -1: java/lang/ProcessEnvironment
-17 -1: setNormalizedYear
-14 -1: isMalformed4_2
-14 -1: isMalformed4_3
-38 -1: (Ljava/lang/Object;)Ljava/lang/String;
-16 -1: getJavaAWTAccess
-12 -1: isPrivileged
-30 -1: java/util/Collections$EmptyMap
-17 -1: LinkedKeyIterator
-7 -1: vmcount
-27 -1: java/lang/ref/WeakReference
-5 -1: march
-13 -1: addOldMapping
-58 -1: (Ljava/lang/Object;Ljava/lang/Runnable;)Lsun/misc/Cleaner;
-56 -1: (ILjava/lang/String;)[Ljava/lang/invoke/LambdaForm$Name;
-65 -1: java/util/concurrent/ConcurrentHashMap$MapReduceEntriesToLongTask
-55 -1: (Ljava/lang/invoke/SerializedLambda;)Ljava/lang/Object;
-17 -1: getEnclosingClass
-35 -1: (I)Lsun/util/calendar/BaseCalendar;
-13 -1: binarySearch0
-25 -1: ([J)Ljava/nio/LongBuffer;
-19 -1: java/util/Map$Entry
-22 -1: java/util/HashMap$Node
-26 -1: sun/reflect/MethodAccessor
-8 -1: LASTYEAR
-7 -1: disable
-36 -1: sun/launcher/LauncherHelper$FXHelper
-6 -1: toPath
-10 -1: shortValue
-6 -1: remove
-59 -1: ([Ljava/lang/String;[Ljava/lang/String;)Ljava/lang/Process;
-55 -1: java/util/concurrent/ConcurrentHashMap$ValueSpliterator
-64 -1: (Ljava/util/Collection;Ljava/lang/Object;)Ljava/util/Collection;
-15 -1: asPrimitiveType
-16 -1: PrintStream.java
-10 -1: image/jpeg
-22 -1: specificToStringHeader
-7 -1: class "
-38 -1: java/util/Collections$CheckedSortedMap
-19 -1: SUPPRESSED_SENTINEL
-16 -1: getEnumConstants
-54 -1: (ILjava/lang/CharSequence;II)Ljava/lang/StringBuilder;
-36 -1: Ljava/lang/Class<Ljava/lang/Short;>;
-13 -1: toThreadState
-38 -1: (Ljava/lang/Class;)Ljava/lang/Package;
-24 -1: (C)Ljava/lang/Character;
-19 -1: UNTREEIFY_THRESHOLD
-4 -1: NCPU
-23 -1: ()Ljava/lang/Exception;
-42 -1: (ITK;TV;Ljava/util/HashMap$Node<TK;TV;>;)V
-15 -1: nothingToVerify
-15 -1: setInitialValue
-15 -1: getTimeInMillis
-12 -1: getDoubleAt0
-18 -1: parameterTypeCache
-86 -1: (Ljava/nio/file/WatchService;[Ljava/nio/file/WatchEvent$Kind;)Ljava/nio/file/WatchKey;
-49 -1: java/util/concurrent/ConcurrentHashMap$ValuesView
-13 -1: <all actions>
-7 -1: exitVM.
-34 -1: Ljava/lang/ClassNotFoundException;
-68 -1: (Ljava/util/Map;Ljava/lang/Class;)[Ljava/lang/annotation/Annotation;
-28 -1: getCalendarDateFromFixedDate
-28 -1: UnsafeFieldAccessorImpl.java
-27 -1: java/lang/RuntimePermission
-74 -1: Ljava/lang/Object;Ljava/lang/Comparable<Lsun/util/locale/BaseLocale$Key;>;
-62 -1: ()Ljava/util/Iterator<Ljava/nio/charset/spi/CharsetProvider;>;
-13 -1: LanguageRange
-239 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceValuesToIntTask;Ljava/util/function/ToIntFunction;ILjava/util/function/IntBinaryOperator;)V
-37 -1: DIRECTIONALITY_LEFT_TO_RIGHT_OVERRIDE
-62 -1: (Ljava/lang/invoke/MethodType;II)Ljava/lang/invoke/MethodType;
-16 -1: DMH.invokeStatic
-11 -1: (TK;TV;)TV;
-7 -1: ([FI)[F
-14 -1: newPerfCounter
-35 -1: ([JI)Ljava/util/Spliterator$OfLong;
-30 -1: java/util/AbstractList$ListItr
-5 -1: cp912
-5 -1: cp914
-45 -1: (Ljava/io/BufferedWriter;Ljava/lang/String;)V
-6 -1: LOCNAM
-8 -1: launcher
-5 -1: cp915
-14 -1: standardString
-26 -1: ()Ljava/lang/Thread$State;
-10 -1: L_ALPHANUM
-8 -1: (C[CII)I
-9 -1: SEPTEMBER
-20 -1: java/text/DateFormat
-38 -1: Ljava/lang/CloneNotSupportedException;
-5 -1: cp920
-23 -1: getConstructorSignature
-16 -1: ReferenceHandler
-19 -1: America/Puerto_Rico
-5 -1: cp923
-10 -1: typeString
-30 -1: Self-suppression not permitted
-25 -1: (Ljava/io/OutputStream;)V
-9 -1: implReset
-12 -1: fullAddCount
-34 -1: java/lang/invoke/LambdaForm$Hidden
-25 -1: ()Lsun/misc/JavaIOAccess;
-9 -1: Math.java
-9 -1: getAndSet
-7 -1: failure
-14 -1: LINE_SEPARATOR
-6 -1: parent
-30 -1: java/lang/BootstrapMethodError
-8 -1: indexMap
-9 -1: ALL_KINDS
-23 -1: desiredAssertionStatus0
-39 -1: (ILjava/lang/Object;)Ljava/lang/Object;
-22 -1: RuntimePermission.java
-21 -1: getContextClassLoader
-14 -1: VARARGS_INVOKE
-8 -1: zoneinfo
-130 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;ILjava/lang/invoke/DirectMethodHandle$1;)V
-18 -1: java/lang/Readable
-11 -1: containsAll
-11 -1: newPosition
-57 -1: sun/reflect/InstantiationExceptionConstructorAccessorImpl
-13 -1: REVERSE_ORDER
-29 -1: Required array size too large
-6 -1: sunday
-44 -1: <T:Ljava/lang/Object;>()Ljava/util/Set<TT;>;
-10 -1: toIntExact
-33 -1: ([BIILjava/nio/charset/Charset;)V
-14 -1: indexOfSubList
-15 -1: tryAcquireNanos
-31 -1: java/lang/InvalidClassException
-22 -1: SecureClassLoader.java
-12 -1: proxiedHosts
-7 -1: ([CII)I
-11 -1: toHexString
-30 -1: sun/util/calendar/ZoneInfoFile
-31 -1: Ljava/util/jar/Attributes$Name;
-10 -1: L_USERINFO
-25 -1: (IB)Ljava/nio/ByteBuffer;
-11 -1: parseDouble
-7 -1: ([CII)V
-13 -1: Asia/Shanghai
-5 -1: [...]
-57 -1: ([Ljava/lang/Class;[B)[[Ljava/lang/annotation/Annotation;
-19 -1: java/nio/LongBuffer
-15 -1: getCertificates
-9 -1: comparing
-83 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Class<*>;IILjava/lang/String;[B)V
-43 -1: Ljava/util/concurrent/atomic/AtomicInteger;
-23 -1: toFieldDescriptorString
-20 -1: Lsun/misc/MetaIndex;
-37 -1: java/util/Collections$UnmodifiableSet
-5 -1: (JC)V
-37 -1: nanosecond timeout value out of range
-26 -1: AbstractStringBuilder.java
-43 -1: java/lang/invoke/DirectMethodHandle$Special
-49 -1: ([Ljava/nio/file/LinkOption;)Ljava/nio/file/Path;
-15 -1: currentPosition
-14 -1: java/net/Proxy
-13 -1: asConstructor
-8 -1: userInfo
-14 -1: parseClassPath
-15 -1: legacyMergeSort
-34 -1: java/security/UnresolvedPermission
-97 -1: Lsun/util/locale/LocaleObjectCache<Lsun/util/locale/BaseLocale$Key;Lsun/util/locale/BaseLocale;>;
-9 -1: freeEntry
-19 -1: delimiterCodePoints
-34 -1: Should be non-empty if initialized
-23 -1: (I)Ljava/lang/Class<*>;
-11 -1: Reader.java
-26 -1: checkClassLoaderPermission
-27 -1: java/nio/DirectShortBufferS
-95 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction<Lsun/misc/Launcher$ExtClassLoader;>;
-27 -1: java/nio/DirectShortBufferU
-20 -1: ()[Ljava/lang/Class;
-56 -1: ()[Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
-19 -1: sun/nio/cs/UTF_16BE
-24 -1: java/util/AbstractList$1
-10 -1: ([CIIIII)V
-60 -1: Ljava/lang/Object;Ljava/lang/Comparable<Ljava/lang/Object;>;
-37 -1: (Ljava/lang/invoke/LambdaForm$Name;)S
-9 -1: putDouble
-52 -1: ([Ljava/security/CodeSource;)Ljava/util/Enumeration;
-37 -1: (Ljava/lang/invoke/LambdaForm$Name;)Z
-22 -1: ()[Ljava/lang/Package;
-41 -1: java/lang/CharSequence$1CodePointIterator
-13 -1: auditSubclass
-24 -1: Ljava/util/jar/JarEntry;
-20 -1: findMethodHandleType
-15 -1: MAX_BUFFER_SIZE
-19 -1: FilePermission.java
-18 -1: WrappedPrintStream
-36 -1: (D)Ljava/lang/AbstractStringBuilder;
-11 -1: unfinalized
-10 -1: getFileURL
-37 -1: (Ljava/io/FileFilter;)[Ljava/io/File;
-54 -1: (Ljava/nio/ByteBuffer;I)Ljava/nio/charset/CoderResult;
-7 -1: ([ZI)[Z
-64 -1: (Ljava/security/CodeSource;)Ljava/security/PermissionCollection;
-6 -1: PUBLIC
-83 -1: (Ljava/util/jar/JarFile;Ljava/net/URL;Ljava/lang/String;)Ljava/security/CodeSource;
-17 -1: lockInterruptibly
-67 -1: ([Ljava/util/Hashtable$Entry;Ljava/lang/Object;Ljava/lang/Object;)V
-42 -1: java/util/ArraysParallelSortHelpers$FJChar
-21 -1: defaultCharBufferSize
-14 -1: unalignedKnown
-23 -1: ()Ljava/net/Proxy$Type;
-4 -1: TZDB
-14 -1: CharacterCache
-13 -1: lengthOfMonth
-13 -1: hasExtensions
-23 -1: Prefix string too short
-15 -1: Executable.java
-10 -1: forEachKey
-6 -1: getEra
-13 -1: appendEncoded
-21 -1: java/util/AbstractMap
-10 -1: access$100
-10 -1: access$102
-30 -1: javafx.application.Application
-46 -1: (Ljava/lang/Thread$UncaughtExceptionHandler;)V
-43 -1: Ljava/lang/invoke/LambdaForm$NamedFunction;
-101 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class;IILjava/lang/String;[B)Ljava/lang/reflect/Field;
-9 -1: WILD_CHAR
-21 -1: SynchronizedSortedSet
-28 -1: (Ljava/util/Collection<*>;)Z
-29 -1: (I[C)Ljava/lang/StringBuffer;
-65 -1: (Ljava/lang/String;[Ljava/lang/Class;Z)Ljava/lang/reflect/Method;
-7 -1: putByte
-6 -1: H_MARK
-49 -1: (Ljava/lang/invoke/MemberName;)Ljava/lang/Object;
-98 -1: ([Ljava/lang/ClassValue$Entry<*>;ILjava/lang/ClassValue$Entry<*>;Z)Ljava/lang/ClassValue$Entry<*>;
-23 -1: array is not of length
-52 -1: <T:Ljava/lang/Object;>(Ljava/util/List<TT;>;TT;TT;)Z
-41 -1: Ljava/util/Collections$EmptyListIterator;
-8 -1:
-11 -1: updateCheck
-29 -1: getBootClassPathEntryForClass
-27 -1: sun/nio/cs/US_ASCII$Encoder
-10 -1: bindCaller
-18 -1: Ljava/util/BitSet;
-10 -1: checkRange
-77 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Class<*>;Ljava/lang/Void;)V
-7 -1: Classes
-6 -1: store0
-23 -1: java/lang/Thread$Caches
-25 -1: Ljava/lang/CharacterData;
-7 -1: (JI[C)V
-49 -1: (Ljava/util/LinkedList;Ljava/util/LinkedList$1;)V
-16 -1: getGcInfoBuilder
-12 -1: counterCells
-14 -1: memoryLimitSet
-7 -1: , nojit
-9 -1: sharpsMap
-7 -1: october
-13 -1: isProxiedHost
-9 -1: rawOffset
-18 -1: toJavaFormatString
-19 -1: sun.boot.class.path
-60 -1: (ILjava/lang/CharSequence;)Ljava/lang/AbstractStringBuilder;
-11 -1: spliterator
-13 -1: contentLength
-18 -1: unixTimeToFileTime
-31 -1: Lsun/reflect/LangReflectAccess;
-16 -1: while Java has
-79 -1: (JLjava/util/function/ToIntBiFunction;ILjava/util/function/IntBinaryOperator;)I
-12 -1: timeEndOfDay
-17 -1: getCustomTimeZone
-25 -1: Ljava/lang/ref/Reference;
-20 -1: ()Ljava/util/Locale;
-64 -1: (Ljava/util/HashMap<TK;TV;>;[Ljava/util/HashMap$Node<TK;TV;>;Z)V
-13 -1: MAX_JVM_ARITY
-72 -1: (Ljava/lang/String;Ljava/lang/ClassLoader;)Ljava/lang/invoke/MethodType;
-11 -1: AsLIFOQueue
-84 -1: <T:Ljava/lang/Object;>(Ljava/util/List<TT;>;Ljava/lang/Object;)Ljava/util/List<TT;>;
-12 -1: mappingCount
-29 -1: (Ljava/io/FileOutputStream;)V
-50 -1: <T:Ljava/lang/Object;>(Ljava/util/List<-TT;>;TT;)V
-23 -1: Category cannot be NULL
-10 -1: normalized
-5 -1: CLASS
-28 -1: (IZ)Ljava/lang/StringBuffer;
-18 -1: java/lang/System$1
-18 -1: java/lang/System$2
-9 -1: getResult
-44 -1: ()Ljava/util/Collection<Ljava/lang/Thread;>;
-8 -1: isNative
-59 -1: Ljava/lang/Number;Ljava/lang/Comparable<Ljava/lang/Short;>;
-24 -1: [Ljava/lang/ThreadGroup;
-24 -1: (B)Ljava/nio/ByteBuffer;
-4 -1: READ
-44 -1: (Ljava/io/FilePermission;)Ljava/lang/String;
-93 -1: <E:Ljava/lang/Object;>Ljava/util/Collections$SynchronizedCollection<TE;>;Ljava/util/Set<TE;>;
-12 -1: compileClass
-12 -1: isProxyClass
-20 -1: isSystemDomainLoader
-74 -1: <T:Ljava/lang/Object;>(Ljava/util/List<TT;>;Ljava/util/Comparator<-TT;>;)V
-7 -1: getMask
-72 -1: (Ljava/lang/ClassLoader;Ljava/lang/SecurityManager;Ljava/lang/String;I)V
-20 -1: removeLastOccurrence
-64 -1: (Ljava/lang/reflect/Field;)Ljava/lang/invoke/DirectMethodHandle;
-57 -1: ()Ljava/util/Map<Ljava/lang/String;Ljava/lang/Class<*>;>;
-11 -1: parkBlocker
-40 -1: (Lsun/misc/JarIndex;Ljava/lang/String;)V
-33 -1: [Ljava/security/ProtectionDomain;
-14 -1: setContentType
-14 -1: getEnumeration
-18 -1: ProtectionDomain
-76 -1: (Lsun/util/calendar/BaseCalendar$Date;)Lsun/util/calendar/BaseCalendar$Date;
-16 -1: setRequestMethod
-52 -1: (Ljava/util/List;Ljava/lang/Object;)Ljava/util/List;
-32 -1: Lsun/util/calendar/BaseCalendar;
-52 -1: (Ljava/net/URL;Ljava/lang/String;)Ljava/lang/String;
-5 -1: .:@[]
-7 -1: addLast
-21 -1: AnnotatedElement.java
-10 -1: defaultVal
-16 -1: getCanonicalPath
-17 -1: protection_domain
-9 -1: strictfp
-19 -1: sun/nio/cs/UTF_16LE
-9 -1: readBytes
-18 -1: removeStaleEntries
-46 -1: java/util/Collections$UnmodifiableNavigableSet
-5 -1: cpath
-14 -1: COPY_THRESHOLD
-8 -1: permsMap
-8 -1: japanese
-33 -1: java/nio/charset/StandardCharsets
-47 -1: Lsun/reflect/DelegatingConstructorAccessorImpl;
-19 -1: NF_checkGenericType
-40 -1: java/util/Collections$UnmodifiableList$1
-4 -1: TERM
-48 -1: The following can be used with stack and domain:
-27 -1: ([BII)Ljava/nio/ByteBuffer;
-40 -1: Ljava/util/Vector<Ljava/lang/Class<*>;>;
-5 -1: digit
-7 -1: isFinal
-39 -1: (Ljava/lang/String;Ljava/lang/String;)I
-26 -1: memberDeclaringClassOrNull
-10 -1: ([CI[BII)I
-38 -1: (Ljava/lang/Class;I)Ljava/lang/Object;
-15 -1: isValidProtocol
-17 -1: (this Collection)
-11 -1: getTreeNode
-16 -1: ThreadLocal.java
-23 -1: java/nio/HeapLongBuffer
-39 -1: (Ljava/lang/String;Ljava/lang/String;)V
-12 -1: getNextEntry
-39 -1: (Ljava/lang/String;Ljava/lang/String;)Z
-28 -1: (C)Lsun/invoke/util/Wrapper;
-9 -1: readFloat
-21 -1: overrideFieldAccessor
-16 -1: fillInStackTrace
-16 -1: getDeclaredField
-5 -1: deflt
-8 -1: nextChar
-10 -1: primCounts
-22 -1: getAnnotatedInterfaces
-26 -1: ()Ljava/util/zip/Inflater;
-73 -1: <U:Ljava/lang/Object;>(JLjava/util/function/BiFunction<-TK;-TV;+TU;>;)TU;
-16 -1: traceMethodCalls
-10 -1: sun.nio.cs
-7 -1: marshal
-9 -1: ftypeKind
-77 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Class;)Ljava/lang/invoke/MemberName;
-11 -1: sun/misc/VM
-14 -1: GuardWithCatch
-40 -1: (Ljava/lang/Object;)Ljava/util/Iterator;
-13 -1: subtractExact
-42 -1: (Ljava/lang/Object;ILjava/lang/Object;II)V
-10 -1: isInfinite
-18 -1: sun.util.calendar.
-14 -1: java/lang/Math
-16 -1: java/lang/String
-10 -1: encodePath
-14 -1: compactAndTrim
-11 -1: getVariants
-4 -1: from
-47 -1: (Ljava/lang/ThreadLocal<*>;Ljava/lang/Object;)V
-35 -1: serializeAgentPropertiesToByteArray
-16 -1: computeIfPresent
-9 -1: EMPTY_MAP
-28 -1: java/lang/InstantiationError
-68 -1: (Ljava/util/Comparator;Ljava/util/Comparator;)Ljava/util/Comparator;
-14 -1: getDisplayName
-14 -1: limitedContext
-23 -1: usagetracker.properties
-52 -1: java/util/concurrent/locks/ReentrantLock$NonfairSync
-7 -1: public
-17 -1: srcBegin > srcEnd
-48 -1: (ILjava/util/List;)Ljava/lang/invoke/MethodType;
-21 -1: java/lang/ThreadDeath
-9 -1: gregorian
-111 -1: (Ljava/util/HashMap;[Ljava/util/HashMap$Node;ILjava/lang/Object;Ljava/lang/Object;)Ljava/util/HashMap$TreeNode;
-52 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;III)V
-12 -1: generateFile
-20 -1: appendParameterTypes
-22 -1: sun/misc/FileURLMapper
-13 -1: defaultDomain
-25 -1: (I)Ljava/time/ZoneOffset;
-21 -1: getBooleanAttributes0
-39 -1: (Ljava/lang/String;)Lsun/misc/Resource;
-43 -1: Ljava/lang/Thread$UncaughtExceptionHandler;
-23 -1: getTypeAnnotationBytes0
-8 -1: ELOT_928
-32 -1: sun/nio/cs/FastCharsetProvider$1
-34 -1: Ljava/nio/BufferOverflowException;
-14 -1: AppClassLoader
-10 -1: protected
-12 -1: isAnnotation
-16 -1: PerfCounter.java
-51 -1: Ljava/util/Map<Ljava/io/File;Lsun/misc/MetaIndex;>;
-160 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
-11 -1: setLeapYear
-16 -1: parseContextSpec
-16 -1: setFieldAccessor
-8 -1: writeInt
-16 -1: java/lang/Number
-33 -1: java/util/AbstractMap$SimpleEntry
-9 -1: nextTable
-8 -1: getQuery
-14 -1: putOrderedLong
-93 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)V
-52 -1: (Ljava/lang/String;)Lsun/reflect/generics/tree/Tree;
-85 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/concurrent/ConcurrentHashMap$Node;)V
-9 -1: singleton
-9 -1: destroyed
-15 -1: iso_8859-2:1987
-12 -1: comparingInt
-29 -1: [Ljava/lang/OutOfMemoryError;
-39 -1: (Ljava/lang/String;Ljava/lang/Object;)V
-27 -1: ([Ljava/util/Enumeration;)V
-36 -1: Ljava/nio/charset/CodingErrorAction;
-16 -1: getCanonicalName
-41 -1: (Ljava/nio/LongBuffer;)Ljava/util/BitSet;
-15 -1: DISPLAY_COUNTRY
-32 -1: getFunctionalInterfaceMethodName
-66 -1: (Ljava/lang/String;Ljava/util/Map;Ljava/util/Map;Ljava/util/Map;)V
-24 -1: getUnresolvedPermissions
-66 -1: ([Ljava/lang/ClassValue$Entry<*>;I)Ljava/lang/ClassValue$Entry<*>;
-41 -1: ()Lsun/reflect/annotation/AnnotationType;
-7 -1: afIndex
-7 -1: csascii
-20 -1: ()Ljava/util/Vector;
-16 -1: EntrySpliterator
-53 -1: (Ljava/lang/Throwable;I)Ljava/lang/StackTraceElement;
-81 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class;)Ljava/lang/invoke/MethodHandle;
-20 -1: classAssertionStatus
-7 -1: EXECUTE
-21 -1: ()Ljava/lang/Runtime;
-6 -1: cesu-8
-7 -1: offset
-23 -1: Ljava/lang/SafeVarargs;
-34 -1: (Ljava/util/LinkedHashMap$Entry;)V
-8 -1: entryFor
-8 -1: getCache
-46 -1: (Ljava/lang/Object;I)Ljava/lang/reflect/Field;
-4 -1: skip
-8 -1: (II[CI)V
-4 -1: vart
-12 -1: InnerClasses
-68 -1: (Ljava/util/Map;Ljava/lang/Class;[Ljava/lang/String;)Ljava/util/Map;
-19 -1: currentClassLoader0
-34 -1: getDefaultUncaughtExceptionHandler
-11 -1: String.java
-117 -1: (Ljava/lang/ThreadLocal<*>;ILjava/lang/ThreadLocal$ThreadLocalMap$Entry;)Ljava/lang/ThreadLocal$ThreadLocalMap$Entry;
-7 -1: january
-31 -1: (ILjava/lang/String;IIIIIIIII)V
-24 -1: Lsun/misc/JavaAWTAccess;
-5 -1: .path
-15 -1: [Ljava/io/File;
-11 -1: Writer.java
-8 -1: , Size:
-159 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/Function;Ljava/util/function/Consumer;)V
-32 -1: java/lang/invoke/LambdaForm$Name
-51 -1: (Ljava/util/ArrayList;Ljava/util/AbstractList;III)V
-7 -1: getZone
-14 -1: JIS_X0212-1990
-21 -1: (Ljava/util/Set<*>;)Z
-149 -1: (Lsun/util/locale/provider/LocaleServiceProviderPool$LocalizedObjectGetter;Ljava/util/Locale;Ljava/lang/String;[Ljava/lang/Object;)Ljava/lang/Object;
-21 -1: Illegal Load factor:
-35 -1: ()Ljava/lang/invoke/MethodTypeForm;
-22 -1: ([Z)Ljava/lang/String;
-7 -1: setName
-48 -1: <T:Ljava/lang/Object;>(TT;Ljava/lang/String;)TT;
-9 -1: INTERFACE
-22 -1: ARRAY_CHAR_INDEX_SCALE
-19 -1: java/nio/ByteBuffer
-23 -1: Ljava/io/ExpiringCache;
-7 -1: streams
-44 -1: java/lang/invoke/DirectMethodHandle$Accessor
-36 -1: ([Ljava/security/ProtectionDomain;)V
-16 -1: afterNodeRemoval
-9 -1: prevIndex
-49 -1: java/util/concurrent/ConcurrentHashMap$KeySetView
-22 -1: getEnumConstantsShared
-17 -1: java/lang/Integer
-12 -1: getRawOffset
-36 -1: ()Ljava/nio/file/attribute/FileTime;
-7 -1: offsets
-10 -1: ] throw =>
-3 -1: [[B
-10 -1: hostsEqual
-18 -1: compareComparables
-35 -1: sun/reflect/ConstructorAccessorImpl
-8 -1: december
-36 -1: Invalid binary time-zone data: TZDB:
-24 -1: synchronizedNavigableMap
-72 -1: sun/util/locale/provider/LocaleServiceProviderPool$LocalizedObjectGetter
-19 -1: parseCustomTimeZone
-88 -1: (Ljava/lang/Class<*>;Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/DirectMethodHandle;
-9 -1: findClass
-6 -1: OBJECT
-3 -1: GBK
-110 -1: (JLjava/util/function/ToLongFunction<Ljava/util/Map$Entry<TK;TV;>;>;JLjava/util/function/LongBinaryOperator;)J
-6 -1: UTF_16
-17 -1: <all permissions>
-13 -1: lookupCharset
-28 -1: ConstructorAccessorImpl.java
-62 -1: java/util/concurrent/ConcurrentHashMap$MapReduceKeysToLongTask
-30 -1: Ljava/lang/ClassCastException;
-56 -1: ()Ljava/util/Spliterator<Ljava/util/Map$Entry<TK;TV;>;>;
-11 -1: invokerType
-23 -1: java/lang/StringBuilder
-12 -1: deleteCharAt
-11 -1: CR_OVERFLOW
-14 -1: toExternalForm
-3 -1: out
-34 -1: Ljava/net/URLStreamHandlerFactory;
-15 -1: encodeArrayLoop
-30 -1: ()Ljava/util/Enumeration<TK;>;
-27 -1: java/io/SyncFailedException
-10 -1: checkedSet
-16 -1: checkedSortedSet
-22 -1: java/util/zip/ZipEntry
-43 -1: java/util/LinkedHashMap$LinkedValueIterator
-22 -1: UnmodifiableCollection
-32 -1: java/nio/ByteBufferAsCharBufferB
-11 -1: blockerLock
-27 -1: checkExtensionsDependencies
-11 -1: fromIndex:
-32 -1: java/nio/ByteBufferAsCharBufferL
-6 -1: UTF_32
-30 -1: java/util/Hashtable$Enumerator
-92 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/Map<+TK;+TV;>;)Ljava/util/Map<TK;TV;>;
-4 -1: tail
-5 -1: (BB)C
-16 -1: isValidSignature
-9 -1: addMillis
-9 -1: peekFirst
-86 -1: <E:Ljava/lang/Object;>(Ljava/util/Set<TE;>;Ljava/lang/Class<TE;>;)Ljava/util/Set<TE;>;
-5 -1: (BB)I
-15 -1: jvmMicroVersion
-28 -1: [Ljava/util/Hashtable$Entry;
-15 -1: iso_8859-5:1988
-14 -1: HOUR_IN_MILLIS
-67 -1: (Ljava/util/PrimitiveIterator$OfInt;I)Ljava/util/Spliterator$OfInt;
-5 -1: (BB)S
-21 -1: UnmodifiableSortedMap
-79 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/util/concurrent/ConcurrentHashMap;)V
-56 -1: Ljava/util/Stack<Ljava/lang/ClassLoader$NativeLibrary;>;
-5 -1: (BB)Z
-10 -1: treeifyBin
-8 -1: isOpaque
-27 -1: java.launcher.ergo.message1
-27 -1: java.launcher.ergo.message2
-101 -1: Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/Cloneable;Ljava/lang/Comparable<Ljava/util/Date;>;
-31 -1: (Ljava/io/ObjectOutputStream;)V
-3 -1: GET
-13 -1: matchLocation
-13 -1: WrappedMember
-63 -1: NoSuchMethodException:\n could not find proper constructor for
-14 -1: gssloginconfig
-70 -1: (Ljava/util/LinkedList$Node<TE;>;TE;Ljava/util/LinkedList$Node<TE;>;)V
-57 -1: (Ljava/lang/Object;Ljava/lang/Object;Z)Ljava/lang/Object;
-11 -1: toByteArray
-49 -1: java/util/ArraysParallelSortHelpers$FJByte$Sorter
-13 -1: no protocol:
-940 -1: aaaarababkaeaveafafrakakaamamhanargararaasasmavavaayaymazazebabakbebelbgbulbhbihbibisbmbambnbenbobodbrbrebsboscacatcechechchacocoscrcrecscescuchucvchvcycymdadandedeudvdivdzdzoeeeweelellenengeoepoesspaetesteueusfafasfffulfifinfjfijfofaofrfrafyfrygaglegdglaglglggngrngugujgvglvhahauhehebhihinhohmohrhrvhthathuhunhyhyehzheriainaidindieileigiboiiiiiikipkinindioidoisislititaiuikuiwhebjajpnjiyidjvjavkakatkgkonkikikkjkuakkkazklkalkmkhmknkankokorkrkaukskaskukurkvkomkwcorkykirlalatlbltzlgluglilimlnlinlolaoltlitlulublvlavmgmlgmhmahmimrimkmkdmlmalmnmonmomolmrmarmsmsamtmltmymyananaunbnobndndenenepngndonlnldnnnnononornrnblnvnavnynyaocociojojiomormororiososspapanpipliplpolpspusptporququermrohrnrunroronrurusrwkinsasanscsrdsdsndsesmesgsagsisinskslkslslvsmsmosnsnasosomsqsqisrsrpsssswstsotsusunsvsweswswatatamteteltgtgkththatitirtktuktltgltntsntotontrturtstsotttattwtwitytahuguigukukrururduzuzbvevenvivievovolwawlnwowolxhxhoyiyidyoyorzazhazhzhozuzul
-42 -1: java/util/LinkedHashMap$LinkedHashIterator
-39 -1: java/util/ArrayDeque$DescendingIterator
-15 -1: MODIFIER_LETTER
-21 -1: (Lsun/misc/Cleaner;)Z
-12 -1: PACKAGE_NAME
-14 -1: getMappedValue
-10 -1: interrupt0
-8 -1: LF_LIMIT
-17 -1: getDeclaringClass
-42 -1: (ZILjava/lang/String;)Ljava/lang/Class<*>;
-57 -1: (Ljava/lang/management/ThreadInfo;[Ljava/lang/Object;[I)V
-15 -1: java/nio/Bits$1
-61 -1: (Ljava/lang/String;ZLjava/lang/ClassLoader;)Ljava/lang/Class;
-28 -1: java/lang/ref/ReferenceQueue
-33 -1: [Ljava/security/cert/Certificate;
-44 -1: (Ljava/util/Hashtable;I)Ljava/util/Iterator;
-24 -1: java/security/CodeSigner
-19 -1: Non-positive length
-24 -1: [Ljava/util/Enumeration;
-38 -1: ()Ljava/security/PermissionCollection;
-16 -1: checkGenericType
-56 -1: java/util/concurrent/ConcurrentHashMap$ReduceEntriesTask
-7 -1: getYear
-5 -1: atime
-19 -1: Ljava/util/HashMap;
-125 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<Ljava/util/Map$Entry<TK;TV;>;+TU;>;Ljava/util/function/Consumer<-TU;>;)V
-22 -1: STOP_THREAD_PERMISSION
-46 -1: (Ljava/util/Enumeration;)Ljava/util/ArrayList;
-16 -1: getPathSeparator
-10 -1: getMembers
-8 -1: getIntAt
-26 -1: java/io/File$TempDirectory
-48 -1: java/lang/invoke/MethodHandleImpl$GuardWithCatch
-25 -1: CaseInsensitiveComparator
-8 -1: pollLast
-21 -1: GET_POLICY_PERMISSION
-23 -1: uninitialized call site
-75 -1: (Ljava/util/function/Function;Ljava/util/Comparator;)Ljava/util/Comparator;
-9 -1: directory
-51 -1: (JLjava/util/function/BiFunction<-TV;-TV;+TV;>;)TV;
-41 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;)V
-42 -1: (Ljava/lang/Throwable;Ljava/lang/String;)V
-26 -1: (FLjava/lang/Appendable;)V
-5 -1: stop0
-9 -1: substring
-64 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/HashMap$Node;)V
-5 -1: (JD)V
-9 -1: getShortB
-10 -1: nextOrSame
-24 -1: [ interpretWithArguments
-6 -1: GB2312
-32 -1: java/nio/BufferOverflowException
-23 -1: sun/nio/cs/ArrayEncoder
-4 -1: tanh
-9 -1: getShortL
-55 -1: (JLjava/util/function/BiFunction;)Ljava/util/Map$Entry;
-10 -1: getMessage
-12 -1: findTreeNode
-38 -1: DIRECTIONALITY_COMMON_NUMBER_SEPARATOR
-23 -1: [Ljava/lang/Comparable;
-17 -1: getCallSiteTarget
-55 -1: (Ljava/nio/ByteBuffer;II)Ljava/nio/charset/CoderResult;
-19 -1: java/util/ArrayList
-17 -1: java/io/DataInput
-13 -1: getPrincipals
-52 -1: <E:Ljava/lang/Object;>(TE;)Ljava/util/Iterator<TE;>;
-44 -1: sun/reflect/generics/tree/ClassTypeSignature
-6 -1: loaded
-20 -1: ()Ljava/lang/Object;
-36 -1: Ljava/util/concurrent/ConcurrentMap;
-13 -1: classValueMap
-33 -1: java/lang/SystemClassLoaderAction
-6 -1: loader
-31 -1: java/lang/annotation/Annotation
-5 -1: colon
-11 -1: Vector.java
-24 -1: CharacterDataLatin1.java
-12 -1: setUseCaches
-22 -1: getTypeAnnotationBytes
-9 -1: readShort
-24 -1: longPrimitiveReturnCount
-5 -1: get16
-34 -1: setDefaultUncaughtExceptionHandler
-17 -1: cachedInputStream
-29 -1: java/util/LinkedHashMap$Entry
-17 -1: java/lang/Boolean
-50 -1: ()[Lsun/reflect/generics/tree/FormalTypeParameter;
-14 -1: AnnotationData
-21 -1: Ljava/net/Proxy$Type;
-13 -1: invokeVirtual
-14 -1: Parameter.java
-21 -1: getDayOfWeekDateAfter
-92 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
-56 -1: (Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
-46 -1: sun/util/locale/provider/LocaleProviderAdapter
-29 -1: Ljava/lang/StackTraceElement;
-47 -1: (TK;Ljava/util/function/Function<-TK;+TV;>;)TV;
-32 -1: enableContextClassLoaderOverride
-68 -1: (Ljava/lang/AbstractStringBuilder;)Ljava/lang/AbstractStringBuilder;
-51 -1: Ljava/util/concurrent/ConcurrentHashMap$KeySetView;
-9 -1: addAndGet
-5 -1: store
-7 -1: ([JII)V
-15 -1: signatureReturn
-18 -1: NF_reinvokerTarget
-22 -1: ()Ljava/nio/file/Path;
-25 -1: (C)Ljava/lang/Appendable;
-7 -1: expires
-18 -1: initializeInvokers
-19 -1: application/java-vm
-13 -1: stopOrSuspend
-13 -1: rawOffsetDiff
-6 -1: (JJZ)V
-9 -1: findValue
-5 -1: get32
-10 -1: asSubclass
-6 -1: forJRE
-3 -1: GMT
-7 -1: delete0
-69 -1: ([Ljava/security/cert/Certificate;[Ljava/security/cert/Certificate;)Z
-75 -1: (Ljava/util/LinkedList$Node;Ljava/lang/Object;Ljava/util/LinkedList$Node;)V
-6 -1: setEra
-24 -1: ()Ljava/util/Comparator;
-10 -1: access$200
-10 -1: access$202
-20 -1: retrieveDisplayNames
-3 -1: pae
-24 -1: java/lang/Byte$ByteCache
-7 -1: VM.java
-9 -1: TRANSIENT
-6 -1: setErr
-16 -1: jdkUpdateVersion
-10 -1: isResolved
-35 -1: sun/misc/JavaIOFileDescriptorAccess
-4 -1: char
-13 -1: Readable.java
-19 -1: UnixFileSystem.java
-43 -1: (Ljava/lang/ThreadLocal;)Ljava/lang/Object;
-40 -1: (Ljava/lang/String;[Ljava/lang/String;)V
-7 -1: profile
-11 -1: , version:
-25 -1: PermissionCollection.java
-13 -1: setNormalized
-10 -1: access$210
-24 -1: (Ljava/lang/String;IJZ)J
-19 -1: isAnnotationPresent
-85 -1: (Ljava/util/Map;Ljava/lang/Class;Ljava/lang/Class;)[Ljava/lang/annotation/Annotation;
-19 -1: DMH.invokeInterface
-157 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/concurrent/ConcurrentHashMap$CollectionView<TK;TV;TV;>;Ljava/util/Collection<TV;>;Ljava/io/Serializable;
-94 -1: <E:Ljava/lang/Object;>Ljava/util/Collections$UnmodifiableCollection<TE;>;Ljava/util/List<TE;>;
-41 -1: java/lang/StringIndexOutOfBoundsException
-29 -1: java/net/UnknownHostException
-11 -1: (BBBBBBBB)J
-4 -1: iioe
-12 -1: (TK;TV;Z)TV;
-5 -1: ERROR
-31 -1: (Ljava/io/File;Ljava/io/File;)I
-32 -1: [Ljava/lang/invoke/MethodHandle;
-27 -1: lambda$comparing$77a9974f$1
-13 -1: toLowerCaseEx
-61 -1: (Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;)V
-66 -1: (ILjava/lang/Object;Ljava/lang/Class;)Ljava/util/HashMap$TreeNode;
-43 -1: java/util/concurrent/ConcurrentHashMap$Node
-23 -1: latestUserDefinedLoader
-24 -1: buildAnnotatedSuperclass
-19 -1: compareToIgnoreCase
-31 -1: (Ljava/io/File;Ljava/io/File;)Z
-40 -1: (I[C)[Ljava/lang/invoke/LambdaForm$Name;
-16 -1: ROTATE_THRESHOLD
-18 -1: getClassAtIfLoaded
-37 -1: java/lang/IllegalThreadStateException
-5 -1: get64
-12 -1: writeReplace
-14 -1: DAYS_PER_CYCLE
-4 -1: _get
-6 -1: nChars
-26 -1: ()Ljava/net/SocketAddress;
-27 -1: setUncaughtExceptionHandler
-6 -1: jzfile
-42 -1: All subclasses should override this method
-3 2: Foo
-56 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/lang/String;
-136 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedExceptionAction<TT;>;Ljava/security/AccessControlContext;[Ljava/security/Permission;)TT;
-3 -1: pdt
-44 -1: sun/util/locale/LocaleObjectCache$CacheEntry
-20 -1: java/util/Comparator
-9 -1: suspended
-11 -1: removeEntry
-10 -1: SPACE_FREE
-12 -1: processQueue
-9 -1: java.home
-5 -1: valid
-23 -1: printEnclosedStackTrace
-4 -1: push
-5 -1: guard
-23 -1: javaNetHttpCookieAccess
-36 -1: (Ljava/security/cert/Certificate;)[B
-9 -1: isWrapped
-12 -1: CharIterator
-26 -1: sun.io.useCanonPrefixCache
-42 -1: (Lsun/misc/Cleaner;Ljava/lang/Throwable;)V
-7 -1: prepare
-8 -1: parseInt
-13 -1: Invokers.java
-63 -1: (Ljava/net/URLClassLoader;)Ljava/security/AccessControlContext;
-18 -1: defaultWriteObject
-5 -1: class
-15 -1: EnclosingMethod
-23 -1: ([BI)Ljava/lang/String;
-16 -1: rangeCheckForAdd
-11 -1: getTimeImpl
-15 -1: arrayIndexScale
-5 -1: scalb
-5 -1: scale
-45 -1: (Ljava/lang/String;J)Ljava/util/zip/ZipEntry;
-8 -1: ([FIIF)I
-16 -1: runAllFinalizers
-27 -1: ()Lsun/net/ProgressMonitor;
-15 -1: MemberName.java
-27 -1: [Ljava/lang/reflect/Member;
-6 -1: length
-14 -1: genericInvoker
-8 -1: ([FIIF)V
-34 -1: Ljava/nio/file/attribute/FileTime;
-6 -1: number
-70 -1: (Ljava/lang/StringBuilder;Ljava/lang/String;)Ljava/lang/StringBuilder;
-12 -1: printLocales
-38 -1: java/lang/invoke/MethodHandleStatics$1
-8 -1: private
-20 -1: invalid actions mask
-10 -1: not found
-13 -1: parseClassSig
-22 -1: getAllAvailableLocales
-175 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/Function;Ljava/util/concurrent/atomic/AtomicReference;)V
-8 -1: ([BII)[B
-35 -1: (Ljava/util/HashMap$Node<TK;TV;>;)V
-132 -1: (Ljava/lang/Thread;ILjava/lang/Object;Ljava/lang/Thread;JJJJ[Ljava/lang/StackTraceElement;[Ljava/lang/Object;[I[Ljava/lang/Object;)V
-8 -1: ([BII)[C
-20 -1: DECIMAL_DIGIT_NUMBER
-40 -1: (Ljava/lang/String;[Ljava/lang/Object;)Z
-7 -1: ([CCI)I
-64 -1: (TV;)Ljava/util/concurrent/ConcurrentHashMap$KeySetView<TK;TV;>;
-8 -1: aliasMap
-8 -1: checkfpx
-44 -1: java/util/Comparators$NaturalOrderComparator
-48 -1: (Ljava/lang/ClassLoader;)Ljava/lang/ClassLoader;
-12 -1: Name is null
-10 -1: invoke_L_L
-8 -1: URL.java
-51 -1: (JILjava/time/ZoneOffset;)Ljava/time/LocalDateTime;
-25 -1: Lsun/invoke/util/Wrapper;
-19 -1: LauncherHelper.java
-10 -1: invoke_L_V
-5 -1: index
-30 -1: sun/security/x509/X509CertImpl
-8 -1: addClass
-46 -1: (I)Ljava/lang/invoke/LambdaForm$NamedFunction;
-20 -1: refKindIsConstructor
-10 -1: getFieldAt
-5 -1: log10
-13 -1: GetPerfAction
-15 -1: isLetterOrDigit
-27 -1: hasCheckedSpecialAttributes
-25 -1: MapReduceEntriesToIntTask
-17 -1: probeHomeLocation
-9 -1: image/png
-19 -1: checkSpreadArgument
-12 -1: LinkedKeySet
-13 -1: removeMapping
-39 -1: sun/security/util/SecurityConstants$AWT
-9 -1: MAX_RADIX
-28 -1: (F)Ljava/lang/StringBuilder;
-11 -1: ([C[B[I[I)Z
-36 -1: (Ljava/lang/Class;)Ljava/lang/Class;
-32 -1: java/lang/invoke/MagicLambdaImpl
-6 -1: monday
-16 -1: closeClassLoader
-41 -1: (Ljava/util/concurrent/locks/Condition;)I
-8 -1: reversed
-27 -1: sun/util/calendar/Gregorian
-49 -1: (Lsun/nio/cs/FastCharsetProvider;)Ljava/util/Map;
-42 -1: (Ljava/lang/String;Ljava/lang/Throwable;)V
-18 -1: java/util/Calendar
-8 -1: vmtarget
-17 -1: TREEIFY_THRESHOLD
-41 -1: (Ljava/util/concurrent/locks/Condition;)Z
-9 -1: deadChild
-8 -1: EntrySet
-5 -1: log1p
-58 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/util/HashMap;)V
-9 -1: pageCount
-14 -1: slotToArgTable
-24 -1: toMethodDescriptorString
-25 -1: ([B)Ljava/nio/ByteBuffer;
-21 -1: twoToTheDoubleScaleUp
-32 -1: sun/misc/URLClassPath$FileLoader
-40 -1: (Ljava/util/List<Ljava/lang/String;>;Z)V
-6 -1: cache1
-6 -1: cache2
-27 -1: Ljava/net/URLStreamHandler;
-20 -1: Detect premature EOF
-94 -1: (Ljava/io/OutputStream;Ljava/lang/Object;Ljava/nio/charset/Charset;)Lsun/nio/cs/StreamEncoder;
-12 -1: NF_checkBase
-20 -1: (Ljava/nio/Buffer;)V
-45 -1: <E:Ljava/lang/Object;>Ljava/util/Vector<TE;>;
-4 -1: Sync
-12 -1: H_UNRESERVED
-32 -1: (Ljava/util/Map;)Ljava/util/Set;
-32 -1: (Ljava/util/Map$Entry<TK;TV;>;)Z
-25 -1: java/util/Locale$Category
-8 -1: receiver
-9 -1: MAX_VALUE
-4 -1: .RSA
-25 -1: Ljava/net/URLClassLoader;
-15 -1: Terminator.java
-26 -1: (Ljava/lang/String;TV;)TV;
-4 -1: null
-76 -1: (Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;)V
-9 -1: checkCast
-39 -1: ()Ljava/lang/AssertionStatusDirectives;
-15 -1: declaredMethods
-5 -1: clazz
-21 -1: Retention policy:
-20 -1: spreadArgElementType
-9 -1: WORD_MASK
-27 -1: ([IILjava/io/InputStream;)I
-11 -1: getMethodAt
-31 -1: (Ljava/net/URL;Ljava/net/URL;)Z
-13 -1: getLocaleName
-14 -1: isEnumConstant
-41 -1: (Ljava/lang/String;)Ljava/nio/CharBuffer;
-16 -1: newInvokeSpecial
-26 -1: (Ljava/nio/ByteBuffer;IS)V
-22 -1: sun/misc/JavaNioAccess
-184 -1: (Ljava/security/DomainCombiner;Ljava/lang/Class;Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;[Ljava/security/Permission;)Ljava/security/AccessControlContext;
-96 -1: (Ljava/lang/invoke/MethodHandle;ILjava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle;
-5 -1: ([S)I
-30 -1: java/security/AccessController
-37 -1: sun/misc/Launcher$SharedArchiveLoader
-4 -1: pack
-5 -1: ([S)V
-51 -1: failure before throwing exception, dump stack
-10 -1: dayOfMonth
-6 -1: CENSIG
-28 -1: java/util/function/Predicate
-26 -1: Malformed \\uxxxx encoding.
-9 -1: initIndex
-11 -1: invoke_LL_L
-23 -1: ConcurrentWeakInternSet
-14 -1: java/lang/Void
-42 -1: java/lang/String$CaseInsensitiveComparator
-38 -1: Ljava/lang/invoke/LambdaForm$Compiled;
-34 -1: java/util/Collections$SingletonSet
-142 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Class;)Ljava/lang/invoke/CallSite;
-35 -1: too many bootstrap method arguments
-17 -1: maxDelimCodePoint
-13 -1: previousIndex
-3 -1: pop
-6 -1: CENSIZ
-7 -1: ([Z[Z)Z
-11 -1: invoke_LL_V
-3 -1: pos
-33 -1: java/nio/file/WatchEvent$Modifier
-3 -1: pow
-12 -1: nextClearBit
-15 -1: Dictionary.java
-27 -1: sun/reflect/CallerSensitive
-13 -1: signatureType
-10 -1: dstSavings
-13 -1: UnicodeLittle
-16 -1: America/New_York
-82 -1: (Lsun/util/locale/BaseLocale;Lsun/util/locale/LocaleExtensions;)Ljava/util/Locale;
-25 -1: referenceKindIsConsistent
-62 -1: Ljava/nio/Buffer;Ljava/lang/Comparable<Ljava/nio/LongBuffer;>;
-4 -1: INTS
-11 -1: LOAD_FACTOR
-40 -1: sun/reflect/DelegatingMethodAccessorImpl
-16 -1: accumulateAndGet
-21 -1: (B)Ljava/lang/String;
-6 -1: UNSAFE
-13 -1: resolveOrFail
-21 -1: MapReduceMappingsTask
-5 -1: arity
-77 -1: (Ljava/io/FileDescriptor;ZZLjava/lang/Object;)Ljava/nio/channels/FileChannel;
-5 -1: value
-61 -1: Ljava/util/concurrent/ConcurrentHashMap$EntrySetView<TK;TV;>;
-6 -1: forJar
-52 -1: <T:Ljava/lang/Object;>Ljava/lang/ref/Reference<TT;>;
-21 -1: CREATE_ACC_PERMISSION
-28 -1: sun/misc/NativeSignalHandler
-11 -1: defineClass
-5 -1: match
-93 -1: (Ljava/util/zip/ZipFile;Ljava/util/zip/ZipFile$ZipFileInputStream;Ljava/util/zip/Inflater;I)V
-11 -1: Double.java
-30 -1: America/Argentina/Buenos_Aires
-8 -1: previous
-37 -1: (Ljava/io/Writer;Ljava/lang/String;)V
-9 -1: Synthetic
-18 -1: isVMAnonymousClass
-62 -1: ([Ljava/lang/Object;Ljava/lang/Object;Ljava/util/Comparator;)I
-22 -1: (JI)Ljava/lang/String;
-49 -1: (Ljava/lang/CharSequence;II)Ljava/io/PrintStream;
-52 -1: ([Ljava/lang/Thread;)[[Ljava/lang/StackTraceElement;
-12 -1: setDayOfWeek
-11 -1: getManifest
-30 -1: java/util/Locale$FilteringMode
-54 -1: (Ljava/lang/String;)Lsun/util/calendar/CalendarSystem;
-12 -1: nextHashCode
-19 -1: ()Ljava/io/Console;
-42 -1: AccessControlContext invoking the Combiner
-19 -1: shouldBeInitialized
-17 -1: invocationCounter
-21 -1: IMPLEMENTATION_VENDOR
-7 -1: chararr
-60 -1: (Ljava/lang/String;)Ljava/util/Iterator<Ljava/lang/String;>;
-11 -1: asCollector
-52 -1: (ILjava/lang/CharSequence;)Ljava/lang/StringBuilder;
-9 -1: exception
-22 -1: newInstanceCallerCache
-20 -1: nativeLibraryContext
-24 -1: MODIFY_THREAD_PERMISSION
-4 -1: WRAP
-19 -1: Method name is null
-32 -1: sun/invoke/util/ValueConversions
-7 -1: APP_TAG
-24 -1: (Ljava/util/Hashtable;)I
-23 -1: METHOD_FORMAL_PARAMETER
-18 -1: inflationThreshold
-24 -1: java/io/DeleteOnExitHook
-3 -1: pst
-13 -1: BITS_PER_WORD
-25 -1: getConstructorAnnotations
-17 -1: CheckedCollection
-24 -1: (Ljava/util/Hashtable;)V
-7 -1: inClass
-5 -1: getFD
-8 -1: readLong
-19 -1: aliases_ISO_8859_13
-19 -1: invokeWithArguments
-19 -1: aliases_ISO_8859_15
-42 -1: ()Ljava/util/concurrent/ConcurrentHashMap;
-8 -1: expandTo
-23 -1: java/text/MessageFormat
-8 -1: classID0
-11 -1: replaceWith
-21 -1: Invalid port number :
-65 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;)V
-19 -1: isGregorianLeapYear
-16 -1: asSpreaderChecks
-11 -1: withInitial
-10 -1: X-UTF-32BE
-57 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)V
-12 -1: wrong type:
-57 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Z
-17 -1: sun/misc/Resource
-14 -1: getReadTimeout
-8 -1: safeTrim
-38 -1: DIRECTIONALITY_RIGHT_TO_LEFT_EMBEDDING
-14 -1: isElementIndex
-23 -1: FilterOutputStream.java
-6 -1: (IJI)V
-3 -1: put
-57 -1: (Ljava/lang/String;[Ljava/lang/Object;)Ljava/lang/String;
-43 -1: Expecting an absolute path of the library:
-8 -1: checkRef
-53 -1: (Ljava/lang/String;)Ljava/lang/AbstractStringBuilder;
-74 -1: (Ljava/lang/Class<*>;[Ljava/lang/reflect/Field;)[Ljava/lang/reflect/Field;
-11 -1: user.script
-10 -1: H_ALPHANUM
-17 -1: getCalendarSystem
-48 -1: Ljava/util/concurrent/ConcurrentHashMap<TK;TV;>;
-17 -1: EnsureInitialized
-82 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;Ljava/lang/ThreadLocal;Ljava/lang/Object;)V
-243 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceMappingsToIntTask;Ljava/util/function/ToIntBiFunction;ILjava/util/function/IntBinaryOperator;)V
-26 -1: getAnnotatedExceptionTypes
-10 -1: validIndex
-6 -1: ([CC)I
-8 -1: overflow
-5 -1: getID
-93 -1: (Ljava/io/InputStream;Ljava/lang/Object;Ljava/nio/charset/Charset;)Lsun/nio/cs/StreamDecoder;
-22 -1: java/util/StringJoiner
-9 -1: putFields
-18 -1: USE_SHARED_ARCHIVE
-8 -1: thursday
-8 -1: nanoTime
-59 -1: (Lsun/reflect/annotation/AnnotationType;Ljava/lang/Class;)V
-69 -1: (Ljava/nio/charset/CoderResult$Cache;I)Ljava/nio/charset/CoderResult;
-36 -1: (J)Ljava/lang/AbstractStringBuilder;
-16 -1: java/util/Arrays
-6 -1: ([CC)V
-25 -1: registerAsParallelCapable
-4 -1: slot
-24 -1: java/net/URLConnection$1
-6 -1: koi8-r
-19 -1: should be of type
-46 -1: java/util/concurrent/ConcurrentHashMap$TreeBin
-6 -1: koi8-u
-34 -1: data type scale not a power of two
-53 -1: Ljava/util/Map<Ljava/lang/String;Ljava/lang/Object;>;
-21 -1: AccessibleObject.java
-53 -1: <E:Ljava/lang/Object;>()Ljava/util/NavigableSet<TE;>;
-88 -1: (Ljava/util/List;Ljava/util/Collection;Ljava/util/Locale$FilteringMode;)Ljava/util/List;
-17 -1: getAnnotationType
-36 -1: Ljava/util/HashMap$TreeNode<TK;TV;>;
-14 -1: declaringClass
-10 -1: read,write
-5 -1: getId
-10 -1: BIG_ENDIAN
-20 -1: PolymorphicSignature
-16 -1: comparingByValue
-67 -1: (ILjava/lang/invoke/MethodType;)[Ljava/lang/invoke/LambdaForm$Name;
-19 -1: java/util/Hashtable
-20 -1: getUnicodeLocaleKeys
-27 -1: ()Ljava/util/LinkedHashMap;
-51 -1: (Ljava/lang/CharSequence;)Ljava/lang/StringBuilder;
-30 -1: java/util/HashMap$HashIterator
-22 -1: (IZ)Ljava/lang/String;
-5 -1: yield
-34 -1: java/lang/Throwable$SentinelHolder
-62 -1: (Ljava/lang/invoke/MethodType;ZI)Ljava/lang/invoke/LambdaForm;
-5 -1: (FD)F
-17 -1: java/util/SubList
-24 -1: (Ljava/io/PrintStream;)V
-7 -1: LF.zero
-25 -1: java/util/StringTokenizer
-15 -1: ISO8859_15_FDIS
-11 -1: powerOfTwoD
-11 -1: powerOfTwoF
-22 -1: WeakHashMapSpliterator
-15 -1: refKindIsGetter
-12 -1: setRawOffset
-11 -1: setProperty
-23 -1: (Ljava/lang/Object;IB)V
-45 -1: (ILjava/lang/Object;)Ljava/util/HashMap$Node;
-13 -1: applyAsDouble
-83 -1: (Lsun/misc/URLClassPath$FileLoader;Ljava/lang/String;Ljava/net/URL;Ljava/io/File;)V
-19 -1: MethodAccessor.java
-9 -1: WALL_TIME
-7 -1: INVOKES
-13 -1: java.ext.dirs
-9 -1: getStatic
-56 -1: (Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/String;
-42 -1: (Ljava/util/function/UnaryOperator<TE;>;)V
-27 -1: java/lang/Class$MethodArray
-10 -1: H_USERINFO
-19 -1: PostVMInitHook.java
-7 -1: running
-32 -1: Warning: passing argument as-is
-13 -1: EntryIterator
-22 -1: NF_checkSpreadArgument
-46 -1: ([DLjava/util/function/IntToDoubleFunction;I)V
-7 -1: .<init>
-13 -1: mappingLength
-20 -1: implOnMalformedInput
-53 -1: (Ljava/lang/String;ILjava/lang/reflect/Executable;I)V
-26 -1: cannot make variable arity
-18 -1: SharedSecrets.java
-27 -1: (Ljava/io/InputStream;IZ)[B
-9 -1: Asia/Gaza
-55 -1: Ljava/util/Map<Ljava/lang/String;Ljava/lang/Class<*>;>;
-5 -1: NTLM
-19 -1: defaultCenturyStart
-18 -1: addElapsedTimeFrom
-38 -1: (Lsun/misc/Cleaner;)Lsun/misc/Cleaner;
-44 -1: (Ljava/io/OutputStream;ZLjava/lang/String;)V
-22 -1: (Ljava/lang/Object;B)V
-6 1: [LBar;
-7 -1: classes
-23 -1: java/net/URLClassLoader
-17 -1: sun/misc/Launcher
-163 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;)[Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
-12 -1: updateAndGet
-90 -1: (Ljava/net/URL;Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;)V
-9 -1: increment
-27 -1: (Ljava/lang/CharSequence;)V
-16 -1: Ljava/io/Reader;
-27 -1: java/io/PushbackInputStream
-6 -1: (JFZ)V
-17 -1: getAppClassLoader
-35 -1: sun/reflect/generics/tree/Signature
-9 -1: elementAt
-27 -1: (Ljava/lang/CharSequence;)Z
-10 -1: readDouble
-37 -1: ([B)Ljava/nio/charset/CharsetEncoder;
-46 -1: (Ljava/lang/ThreadGroup;Ljava/lang/Runnable;)V
-4 -1: park
-36 -1: java/lang/NegativeArraySizeException
-49 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/Class;)Z
-121 -1: <T:Ljava/lang/Object;U::Ljava/lang/Comparable<-TU;>;>(Ljava/util/function/Function<-TT;+TU;>;)Ljava/util/Comparator<TT;>;
-101 -1: (Ljava/lang/annotation/Annotation;Ljava/lang/annotation/Annotation;)Ljava/lang/annotation/Annotation;
-12 -1: .$|()[{^?*+\\
-6 -1: manRef
-3 -1: 437
-15 -1: newStringUnsafe
-15 -1: constantPoolOop
-10 -1: getPackage
-24 -1: FastCharsetProvider.java
-18 -1: getAnnotationBytes
-187 -1: (Ljava/security/DomainCombiner;Ljava/lang/Class<*>;Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;[Ljava/security/Permission;)Ljava/security/AccessControlContext;
-33 -1: Cannot suppress a null exception.
-27 -1: sun/nio/cs/StandardCharsets
-33 -1: (BB)Ljava/lang/invoke/MemberName;
-61 -1: ([Ljava/lang/ClassValue$Entry;ILjava/lang/ClassValue$Entry;)I
-10 -1: X-UTF-32LE
-5 -1: toMap
-89 -1: (Ljava/lang/Class<*>;Ljava/util/List<Ljava/lang/Class<*>;>;)Ljava/lang/invoke/MethodType;
-46 -1: ([Ljava/lang/Object;IILjava/util/Comparator;)V
-66 -1: ([Ljava/lang/reflect/Constructor;)[Ljava/lang/reflect/Constructor;
-22 -1: ()Ljava/nio/ByteOrder;
-20 -1: isMethodHandleInvoke
-25 -1: sun/net/www/URLConnection
-89 -1: Ljava/util/concurrent/ConcurrentHashMap<Ljava/lang/String;Ljava/lang/invoke/LambdaForm;>;
-49 -1: (Ljava/nio/charset/Charset;FFLjava/lang/String;)V
-17 -1: MIN_LOW_SURROGATE
-23 -1: AbstractCollection.java
-19 -1: (Ljava/util/Date;)I
-19 -1: (Ljava/util/Date;)J
-12 -1: cldrdata.jar
-4 -1: path
-77 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class;IILjava/lang/String;[B)V
-6 -1: MS1250
-37 -1: setJavaSecurityProtectionDomainAccess
-11 -1: isDelimiter
-5 -1: char0
-6 -1: MS1251
-5 -1: char1
-16 -1: getJavaNetAccess
-6 -1: MS1252
-6 -1: MS1253
-6 -1: MS1254
-51 -1: (Ljava/lang/Class;)Ljava/security/ProtectionDomain;
-6 -1: MS1257
-93 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;Ljava/security/ProtectionDomain;)Ljava/lang/Class<*>;
-10 -1: access$300
-5 -1: (JZ)C
-19 -1: (Ljava/util/Date;)Z
-5 -1: (JZ)D
-26 -1: java/lang/Character$Subset
-10 -1: access$302
-5 -1: (JZ)F
-9 -1: emptyList
-5 -1: (JZ)I
-5 -1: (JZ)J
-23 -1: (Ljava/lang/Runnable;)V
-27 -1: java/lang/invoke/MemberName
-29 -1: ()Ljava/util/Comparator<TT;>;
-18 -1: retrieveDirectives
-7 -1: ([F[F)Z
-40 -1: (Lsun/misc/URLClassPath;Ljava/net/URL;)V
-5 -1: (JZ)S
-40 -1: (Ljava/util/function/IntUnaryOperator;)I
-5 -1: (JZ)V
-16 -1: parseAnnotations
-21 -1: (C)Ljava/lang/String;
-73 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(TK;TV;)Ljava/util/Map<TK;TV;>;
-15 -1: charset encoder
-17 -1: getDomainCombiner
-9 -1: EmptyList
-15 -1: java.vm.version
-19 -1: getResourceAsStream
-94 -1: Ljava/lang/ThreadLocal<Ljava/lang/ref/SoftReference<Ljava/lang/StringCoding$StringEncoder;>;>;
-26 -1: java/util/HashMap$TreeNode
-22 -1: (Ljava/util/HashMap;)V
-23 -1: sun/misc/URLClassPath$1
-65 -1: ([Ljava/net/URL;Ljava/lang/ClassLoader;)Ljava/net/URLClassLoader;
-20 -1: Hashtable Enumerator
-23 -1: sun/misc/URLClassPath$2
-10 -1: Array.java
-8 -1: FT_LIMIT
-24 -1: ()[Ljava/lang/Throwable;
-23 -1: sun/misc/URLClassPath$3
-14 -1: java/io/Writer
-5 -1: chars
-76 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>()Ljava/util/NavigableMap<TK;TV;>;
-6 -1: final
-5 -1: error
-34 -1: java/lang/ApplicationShutdownHooks
-29 -1: Lsun/launcher/LauncherHelper;
-30 -1: ()Ljava/util/Enumeration<TE;>;
-47 -1: (Ljava/util/List;)Ljava/lang/invoke/MethodType;
-9 -1: scriptKey
-5 -1: BYTES
-12 -1: getException
-69 -1: (Ljava/lang/Class<*>;Ljava/lang/Object;)Ljava/lang/invoke/MethodType;
-14 -1: Illegal Load:
-189 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$ReduceValuesTask;Ljava/util/function/BiFunction;)V
-66 -1: java/util/concurrent/ConcurrentHashMap$MapReduceMappingsToLongTask
-29 -1: getJavaIOFileDescriptorAccess
-11 -1: toCodePoint
-15 -1: setCreationTime
-18 -1: NULL_CAUSE_MESSAGE
-8 -1: elements
-32 -1: ()Ljava/nio/charset/CoderResult;
-8 -1: utf-32be
-7 -1: addDate
-4 -1: Cast
-23 -1: sun/misc/JavaLangAccess
-8 -1: 0{1,12}$
-27 -1: (Ljava/util/ArrayList;III)V
-11 -1: lastIndexOf
-14 -1: getCodeSources
-53 -1: (Lsun/util/calendar/CalendarDate;Ljava/lang/String;)V
-17 -1: cachedConstructor
-7 -1: forName
-74 -1: (Ljava/util/function/ToLongFunction;Ljava/lang/Object;Ljava/lang/Object;)I
-47 -1: (Ljava/lang/Object;)Lsun/reflect/FieldAccessor;
-8 -1: getDebug
-18 -1: currentClassLoader
-49 -1: Illegal leading minus sign on unsigned string %s.
-20 -1: toLowerCaseCharArray
-38 -1: java/util/concurrent/ConcurrentHashMap
-8 -1: isHidden
-92 -1: (Ljava/lang/Thread;ILjava/lang/Object;Ljava/lang/Thread;JJJJ[Ljava/lang/StackTraceElement;)V
-29 -1: java/lang/ArithmeticException
-26 -1: (Ljava/io/OutputStream;Z)V
-66 -1: (Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/RuntimeException;
-38 -1: Ljava/util/Map<Ljava/lang/String;TT;>;
-16 -1: getFindClassTime
-34 -1: ([J)Ljava/util/Spliterator$OfLong;
-24 -1: UnmodifiableNavigableSet
-32 -1: java/lang/ClassNotFoundException
-3 -1: \\n
-6 -1: SEALED
-14 -1: Flushable.java
-3 -1: HST
-24 -1: (Ljava/lang/Object;JII)Z
-13 -1: toSecondOfDay
-16 -1: thenComparingInt
-26 -1: java/lang/NoSuchFieldError
-18 -1: java/util/Locale$1
-25 -1: [Ljava/util/HashMap$Node;
-75 -1: ([Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)Ljava/lang/String;
-11 -1: x-mswin-936
-32 -1: java/lang/management/MemoryUsage
-25 -1: (JS)Ljava/nio/ByteBuffer;
-25 -1: java/lang/ref/Finalizer$1
-25 -1: java/lang/ref/Finalizer$2
-21 -1: (Ljava/util/BitSet;)V
-25 -1: java/lang/ref/Finalizer$3
-83 -1: <T:Ljava/lang/Object;>(Ljava/util/Collection<+TT;>;Ljava/util/Comparator<-TT;>;)TT;
-24 -1: sun/nio/ch/Interruptible
-21 -1: (Ljava/util/BitSet;)Z
-72 -1: ([Ljava/security/ProtectionDomain;Ljava/security/AccessControlContext;)V
-54 -1: Ljava/util/AbstractSet<Ljava/util/Map$Entry<TK;TV;>;>;
-34 -1: getConstructorParameterAnnotations
-4 -1: name
-92 -1: <E:Ljava/lang/Enum<TE;>;>Ljava/lang/Object;Ljava/lang/Comparable<TE;>;Ljava/io/Serializable;
-11 -1: FORM_OFFSET
-13 -1: getAliasTable
-5 -1: (DD)D
-23 -1: reflectionFactoryAccess
-221 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceValuesTask;Ljava/util/function/Function;Ljava/util/function/BiFunction;)V
-59 -1: (Ljava/lang/String;[Ljava/lang/String;)Ljava/nio/file/Path;
-6 -1: DELETE
-10 -1: returnType
-5 -1: (DD)I
-51 -1: ()Lsun/reflect/generics/repository/FieldRepository;
-8 -1: delegate
-12 -1: OTHER_LETTER
-18 -1: getTransitionIndex
-3 -1: HUP
-10 -1: (IIII[CI)V
-10 -1: ISO_8859-1
-17 -1: ArrayEncoder.java
-10 -1: ISO_8859-2
-34 -1: java/lang/reflect/AnnotatedElement
-10 -1: ISO_8859-4
-27 -1: sun/nio/cs/UTF_16LE$Decoder
-10 -1: ISO_8859-5
-13 -1: prefetchWrite
-9 -1: getFloatB
-10 -1: ISO_8859-7
-37 -1: (I)Ljava/lang/invoke/LambdaForm$Name;
-10 -1: ISO_8859-9
-10 -1: getActions
-11 -1: negateExact
-10 -1: isAbstract
-9 -1: getFloatL
-29 -1: java/lang/ClassValue$Identity
-14 -1: java/io/Reader
-8 -1: getOwner
-24 -1: java/lang/AssertionError
-17 -1: MethodHandle.java
-19 -1: classRedefinedCount
-10 -1: cachedYear
-15 -1: getAndIncrement
-26 -1: java.protocol.handler.pkgs
-14 -1: cleanSomeSlots
-27 -1: java/util/Spliterator$OfInt
-31 -1: getRawExecutableTypeAnnotations
-20 -1: ensureInitialization
-7 -1: os.arch
-57 -1: (Ljava/security/cert/CertPath;Ljava/security/Timestamp;)V
-21 -1: UNSAFE_COPY_THRESHOLD
-20 -1: toUnsignedBigInteger
-82 -1: (Ljava/util/concurrent/locks/Condition;)Ljava/util/Collection<Ljava/lang/Thread;>;
-15 -1: Reflection.java
-12 -1: decryptBlock
-3 -1: \\r
-8 -1: newArray
-8 -1: Category
-36 -1: java/lang/reflect/GenericDeclaration
-22 -1: (Ljava/lang/String;Z)V
-8 -1: suspend0
-10 -1: getSigners
-22 -1: (Ljava/lang/String;Z)Z
-31 -1: Unable to create temporary file
-117 -1: <T:Ljava/lang/Object;>(Ljava/lang/ClassValue<TT;>;Ljava/lang/ClassValue$Entry<TT;>;)Ljava/lang/ClassValue$Entry<TT;>;
-17 -1: channelsAvailable
-9 -1: Date.java
-13 -1: toIndex < 0:
-18 -1: mark > position: (
-11 -1: loadConvert
-4 -1: july
-42 -1: (Ljava/math/BigInteger;)Ljava/lang/String;
-6 -1: enable
-47 -1: (Ljava/util/zip/ZipEntry;)Ljava/io/InputStream;
-6 -1: unpack
-13 -1: setDayOfMonth
-19 -1: name can't be empty
-16 -1: getExtensionKeys
-15 -1: getAndDecrement
-36 -1: Ljava/lang/ClassValue$ClassValueMap;
-38 -1: (Ljava/lang/Class;Ljava/lang/String;)V
-11 -1: csISOlatin0
-9 -1: retention
-23 -1: system protocol handler
-9 -1: nullsLast
-15 -1: refKindIsStatic
-3 -1: (\n
-48 -1: sun/launcher/LauncherHelper$ResourceBundleHolder
-29 -1: ()Ljava/util/LinkedList<TE;>;
-11 -1: csISOlatin9
-31 -1: ([CII)Ljava/lang/StringBuilder;
-29 -1: (II)Ljava/lang/StringBuilder;
-7 -1: pdcache
-4 -1: june
-12 -1: ;/?:@&=+$,[]
-141 -1: ([Ljava/lang/invoke/LambdaForm$Name;[Ljava/lang/invoke/LambdaForm$Name;Ljava/lang/invoke/LambdaForm$Name;)[Ljava/lang/invoke/LambdaForm$Name;
-32 -1: ()[Ljava/util/WeakHashMap$Entry;
-110 -1: (Ljava/lang/Class<*>;ILjava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle;
-81 -1: (Lsun/reflect/annotation/AnnotationType;Lsun/reflect/annotation/AnnotationType;)Z
-46 -1: String value %s exceeds range of unsigned int.
-6 -1: close0
-6 -1: (JDZ)V
-160 -1: <T:Ljava/lang/Object;>Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/reflect/GenericDeclaration;Ljava/lang/reflect/Type;Ljava/lang/reflect/AnnotatedElement;
-12 -1: LinkedValues
-24 -1: java/nio/HeapCharBufferR
-23 -1: jvmVersionInfoAvailable
-16 -1: classLoaderDepth
-33 -1: (Lsun/nio/ch/DirectBuffer;IIIII)V
-32 -1: java/nio/file/attribute/FileTime
-50 -1: java/util/concurrent/ConcurrentHashMap$CounterCell
-73 -1: (Lsun/misc/URLClassPath$JarLoader;Lsun/misc/JarIndex;)Lsun/misc/JarIndex;
-60 -1: (Ljava/net/URL;Ljava/lang/String;)Ljava/security/CodeSource;
-25 -1: Ljava/lang/ref/Finalizer;
-12 -1: utf-32be-bom
-40 -1: (Ljava/lang/String;ILjava/lang/Object;)V
-9 -1: THROW_UCS
-23 -1: java/util/AbstractMap$1
-23 -1: java/util/AbstractMap$2
-10 -1: x-utf-32be
-4 -1: (S)B
-60 -1: (Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/LambdaForm;
-20 -1: ResourceBundleHolder
-4 -1: (S)I
-13 -1: getSuppressed
-17 -1: jdk_micro_version
-4 -1: (S)J
-9 -1: isNumeric
-10 -1: variantKey
-8 -1: utf-32le
-47 -1: java/util/concurrent/ConcurrentHashMap$MapEntry
-25 -1: ()Ljava/lang/Class<-TT;>;
-6 -1: closed
-4 -1: (S)S
-15 -1: setStandardTime
-10 -1: ShortCache
-4 -1: (S)V
-40 -1: sun/net/www/MessageHeader$HeaderIterator
-17 -1: jdk_major_version
-8 -1: FXHelper
-6 -1: CENTIM
-19 -1: java/security/Guard
-46 -1: java.lang.invoke.MethodHandle.DUMP_CLASS_FILES
-4 -1: ENUM
-27 -1: Ljava/lang/SecurityManager;
-39 -1: ([Ljava/lang/Class;[Ljava/lang/Class;)Z
-11 -1: getFieldAt0
-12 -1: user.variant
-28 -1: (Ljava/io/DataInputStream;)V
-44 -1: ([JLjava/util/function/LongBinaryOperator;)V
-7 -1: getRoot
-3 -1: +
-16 -1: identityHashCode
-25 -1: java/security/Permissions
-16 -1: Ljava/net/Proxy;
-23 -1: java/io/ExpiringCache$1
-5 -1: more
-10 -1: formatList
-49 -1: (Ljava/lang/String;)Lsun/launcher/LauncherHelper;
-29 -1: Relative path in absolute URI
-11 -1: checkMapped
-8 -1: Checksum
-8 -1: " Radix:
-9 -1: getAndAdd
-9 -1: implReady
-16 -1: SynchronizedList
-30 -1: [Ljava/lang/StackTraceElement;
-5 -1: right
-13 -1: UTF_16BE.java
-4 -1: HEAD
-11 -1: isInvocable
-6 -1: ENDCOM
-15 -1: getPropertiesEx
-6 -1: Unsafe
-7 -1: IBM-819
-37 -1: : 0 <= i2 && i2 < names.length: 0 <=
-19 -1: filterAndAddHeaders
-22 -1: nativeParkEventPointer
-18 -1: checkPositionIndex
-13 -1: invalid url:
-25 -1: out of range from input
-9 -1: loadClass
-12 -1: encodingName
-9 -1: x-JIS0208
-38 -1: (Ljava/lang/Class;Ljava/lang/Object;)Z
-28 -1: (I)Ljava/lang/reflect/Field;
-17 -1: getJvmVersionInfo
-6 -1: LIJFDV
-21 -1: (D)Ljava/lang/String;
-7 -1: oomeMsg
-30 -1: java/io/InvalidObjectException
-25 -1: java/io/FilterInputStream
-32 -1: Ljava/net/ContentHandlerFactory;
-13 -1: toUnsignedInt
-17 -1: reconstitutionPut
-37 -1: (Ljava/lang/Object;)Ljava/lang/Class;
-14 -1: getContentType
-43 -1: java/util/Collections$SynchronizedSortedSet
-24 -1: (II)Ljava/nio/file/Path;
-25 -1: JAVAFX_APPLICATION_MARKER
-29 -1: (IC)Ljava/lang/StringBuilder;
-13 -1: java/util/Set
-10 -1: clearError
-64 -1: (Ljava/lang/invoke/MethodType;[I)Ljava/lang/invoke/MethodHandle;
-25 -1: java/io/FileInputStream$1
-8 -1: getFirst
-36 -1: (Lsun/reflect/ConstructorAccessor;)V
-84 -1: (Ljava/util/NavigableMap;Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/NavigableMap;
-42 -1: (Ljava/lang/CharSequence;)Ljava/io/Writer;
-52 -1: ([Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
-6 -1: (IFI)V
-62 -1: <E:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Queue<TE;>;
-17 -1: getHeaderFieldInt
-16 -1: CheckedSortedMap
-39 -1: (ZILjava/lang/String;)Ljava/lang/Class;
-10 -1: getterName
-10 -1: Asia/Tokyo
-4 -1: Node
-7 -1: rotate1
-13 -1: Stream closed
-7 -1: rotate2
-9 -1: checkExec
-17 -1: NF_checkExactType
-18 -1: ReverseComparator2
-18 -1: arrayElementGetter
-97 -1: (Ljava/util/ArrayPrefixHelpers$DoubleCumulateTask;Ljava/util/function/DoubleBinaryOperator;[DII)V
-9 -1: iso8859-1
-9 -1: iso8859-2
-9 -1: iso8859-4
-9 -1: iso8859-5
-9 -1: iso8859-7
-16 -1: getPermissions
-9 -1: iso8859-9
-9 -1: fromClass
-17 -1: with modifiers "
-8 -1: isBooted
-24 -1: getCommonPoolParallelism
-10 -1: initialize
-47 -1: <T:Ljava/lang/Object;>(TT;)Ljava/util/Set<TT;>;
-17 -1: checkElementIndex
-14 -1: openConnection
-47 -1: (Ljava/lang/Thread;Lsun/nio/ch/Interruptible;)V
-12 -1: isAuthorized
-17 -1: ReduceEntriesTask
-7 -1: command
-24 -1: ArithmeticException.java
-24 -1: ensureOpenOrZipException
-67 -1: (Lsun/util/calendar/CalendarDate;I)Lsun/util/calendar/CalendarDate;
-39 -1: Ljava/lang/invoke/MethodHandles$Lookup;
-31 -1: Enclosing constructor not found
-34 -1: ()Lsun/util/calendar/BaseCalendar;
-25 -1: (JLjava/lang/Object;JJJ)V
-12 -1: > toIndex:
-22 -1: LocaleObjectCache.java
-19 -1: sun/misc/Launcher$1
-31 -1: java/util/HashMap$EntryIterator
-8 -1: contains
-60 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/lang/Object;
-53 -1: (I[Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
-19 -1: java/io/PrintStream
-42 -1: java/lang/Math$RandomNumberGeneratorHolder
-100 -1: <K:Ljava/lang/Object;>(I)Ljava/util/concurrent/ConcurrentHashMap$KeySetView<TK;Ljava/lang/Boolean;>;
-14 -1: getCapturedArg
-14 -1: getCodeSigners
-20 -1: mark() not supported
-56 -1: (Lsun/misc/URLClassPath;I)Lsun/misc/URLClassPath$Loader;
-20 -1: java/lang/StrictMath
-14 -1: annotationType
-3 -1: IET
-4 -1: lang
-13 -1: JarEntry.java
-9 -1: ([CIIII)I
-9 -1: canEncode
-5 -1: extra
-30 -1: java/lang/ref/ReferenceQueue$1
-37 -1: java/nio/channels/ReadableByteChannel
-73 -1: (Ljava/util/Map$Entry<Ljava/lang/String;Ljava/io/ExpiringCache$Entry;>;)Z
-24 -1: java/io/BufferedReader$1
-10 -1: x-utf-32le
-16 -1: methodDescriptor
-25 -1: (IJ)Ljava/nio/ByteBuffer;
-18 -1: getSystemResources
-46 -1: (Ljava/lang/String;I)Ljava/util/regex/Pattern;
-46 -1: (Ljava/net/URL;)Lsun/misc/URLClassPath$Loader;
-20 -1: calendars.properties
-25 -1: implOnUnmappableCharacter
-12 -1: signers_name
-40 -1: (ZILjava/util/Locale;)Ljava/lang/String;
-8 -1: (TE;)TE;
-50 -1: ()Lsun/util/locale/provider/LocaleProviderAdapter;
-11 -1: key is null
-7 -1: encrypt
-21 -1: millisUntilExpiration
-55 -1: Unable to parse property sun.reflect.inflationThreshold
-9 -1: checkExit
-5 -1: SHORT
-43 -1: java/util/Collections$UnmodifiableSortedSet
-10 -1: ISO8859_15
-16 -1: verifyParameters
-24 -1: buildAnnotatedInterfaces
-15 -1: refKindIsSetter
-45 -1: (JLjava/util/function/BiConsumer<-TK;-TV;>;)V
-23 -1: (Ljava/lang/Object;IC)V
-90 -1: <T:Ljava/lang/Object;>(Ljava/lang/ClassValue$Entry<TT;>;)Ljava/lang/ClassValue$Entry<TT;>;
-30 -1: (Ljava/net/URL;)Ljava/net/URI;
-60 -1: (BLjava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Object;)V
-43 -1: (Ljava/util/Collection;Ljava/lang/Object;)I
-44 -1: (Ljava/net/URLConnection;)Ljava/lang/Object;
-17 -1: Stream not marked
-11 -1: targetCheck
-127 -1: (Ljava/lang/Class<*>;ILjava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Object;[Ljava/lang/Object;)Ljava/lang/invoke/MemberName;
-11 -1: debugString
-112 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle;
-43 -1: (Ljava/util/Collection;Ljava/lang/Object;)V
-15 -1: NF_staticOffset
-22 -1: CASE_INSENSITIVE_ORDER
-6 -1: unpark
-29 -1: (Ljava/lang/CharSequence;II)I
-59 -1: Ljava/util/concurrent/ConcurrentHashMap$KeySetView<TK;TV;>;
-19 -1: defaultFormatLocale
-7 -1: combine
-58 -1: (Ljava/util/Locale$LocaleKey;)Lsun/util/locale/BaseLocale;
-29 -1: (Ljava/lang/CharSequence;II)V
-35 -1: sun/util/calendar/BaseCalendar$Date
-57 -1: Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater;
-75 -1: ([Ljava/lang/reflect/Member;[Ljava/lang/String;)[Ljava/lang/reflect/Member;
-15 -1: MethodType_init
-5 -1: (JF)V
-20 -1: AUTOSELECT_FILTERING
-12 -1: invokeStatic
-18 -1: readFileDescriptor
-22 -1: java/lang/Terminator$1
-72 -1: (Ljava/lang/Object;Ljava/util/function/UnaryOperator;)Ljava/lang/Object;
-17 -1: EMPTY_STACK_TRACE
-13 -1: isSamePackage
-32 -1: ()Ljava/security/DomainCombiner;
-10 -1: decodeLoop
-30 -1: DIRECTIONALITY_EUROPEAN_NUMBER
-112 -1: (Ljava/util/List<Ljava/util/Locale$LanguageRange;>;Ljava/util/Collection<Ljava/lang/String;>;)Ljava/lang/String;
-33 -1: (Ljava/util/function/Predicate;)Z
-35 -1: logincontext login context results
-17 -1: sun/nio/cs/UTF_16
-13 -1: SingletonList
-5 -1: end=
-7 -1: getURLs
-17 -1: traceInstructions
-22 -1: generateCustomizedCode
-9 -1: NO_CHANGE
-11 -1: Number.java
-49 -1: <T:Ljava/lang/Object;>(ITT;)Ljava/util/List<TT;>;
-19 -1: checkSpecifyHandler
-8 -1: setValue
-30 -1: (Ljava/net/URL;)Ljava/net/URL;
-22 -1: (Ljava/lang/Object;C)V
-19 -1: Negative capacity:
-24 -1: ArrayStoreException.java
-52 -1: (Ljava/lang/StringBuffer;II)Ljava/lang/StringBuffer;
-14 -1: linkMethodImpl
-42 -1: java/util/InvalidPropertiesFormatException
-4 -1: last
-19 -1: getLocalizedMessage
-65 -1: (Ljava/text/MessageFormat;[Ljava/lang/String;)[Ljava/lang/String;
-61 -1: Ljava/lang/Object;Ljava/util/Enumeration<Ljava/lang/Object;>;
-40 -1: (I[CII)Ljava/lang/AbstractStringBuilder;
-27 -1: java.launcher.opt.datamodel
-29 -1: (Ljava/lang/reflect/Method;)V
-19 -1: SPECIFICATION_TITLE
-123 -1: (Ljava/lang/Class;[Ljava/lang/Class;[Ljava/lang/Class;ILjava/lang/Class;)Lsun/reflect/SerializationConstructorAccessorImpl;
-32 -1: (I[CII)Ljava/lang/StringBuilder;
-29 -1: (Ljava/lang/reflect/Method;)Z
-23 -1: (Z[B)Ljava/lang/String;
-27 -1: sun/nio/cs/Surrogate$Parser
-32 -1: (Ljavax/security/auth/Subject;)Z
-29 -1: ()Ljava/lang/invoke/Invokers;
-7 -1: getPool
-7 -1: textOut
-12 -1: getEntryTime
-14 -1: classModifiers
-47 -1: (Ljava/util/Locale$Category;)Ljava/util/Locale;
-32 -1: getInheritedAccessControlContext
-4 -1: rcbt
-37 -1: (Ljava/lang/Class<*>;Ljava/io/File;)Z
-25 -1: AccessControlContext.java
-22 -1: FileURLConnection.java
-12 -1: NaturalOrder
-34 -1: sun/util/calendar/CalendarSystem$1
-94 -1: ([Ljava/lang/reflect/Method;Ljava/lang/String;[Ljava/lang/Class<*>;)Ljava/lang/reflect/Method;
-17 -1: No enum constant
-7 -1: ([DII)V
-8 -1: register
-23 -1: FINAL_QUOTE_PUNCTUATION
-27 -1: ACCESS_CLIPBOARD_PERMISSION
-15 -1: verifyConstants
-20 -1: (Ljava/io/Writer;I)V
-45 -1: (Ljava/lang/String;)Ljava/lang/reflect/Field;
-24 -1: linkMethodHandleConstant
-43 -1: (Ljava/io/OutputStream;Ljava/lang/String;)V
-125 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/Comparator<-TV;>;)Ljava/util/Comparator<Ljava/util/Map$Entry<TK;TV;>;>;
-14 -1: ALL_PERMISSION
-12 -1: createObject
-10 -1: CRC32.java
-14 -1: reservedMemory
-22 -1: ensureCapacityInternal
-11 -1: FormatData_
-9 -1: maxMemory
-27 -1: (I)Ljava/util/ListIterator;
-8 -1: UTF-16BE
-27 -1: AbstractSequentialList.java
-10 -1: access$400
-16 -1: Locale settings:
-10 -1: access$402
-12 -1: HashSet.java
-24 -1: java/lang/Long$LongCache
-30 -1: [Ljava/lang/reflect/Parameter;
-11 -1: single_step
-45 -1: (Ljava/lang/String;)Lsun/security/util/Debug;
-97 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;)Ljava/lang/invoke/SimpleMethodHandle;
-16 -1: indexOfBangSlash
-7 -1: region=
-26 -1: ([BII)Ljava/lang/Class<*>;
-8 -1: bitCount
-3 -1: INT
-67 -1: <T:Ljava/lang/Object;>([TT;Ljava/util/function/IntFunction<+TT;>;)V
-35 -1: newGetFloatIllegalArgumentException
-11 -1: ([DII[DII)V
-22 -1: makePreparedLambdaForm
-3 -1: <
-35 -1: sun/management/GarbageCollectorImpl
-4 -1: (*)*
-7 -1: getPort
-18 -1: java/io/FileSystem
-7 -1: getNode
-38 -1: (Ljava/lang/Object;I)Ljava/lang/Class;
-36 -1: $SwitchMap$java$util$Locale$Category
-18 -1: securityCheckCache
-5 -1: cdate
-10 -1: childValue
-19 -1: getMainClassFromJar
-70 -1: <T:Ljava/lang/Enum<TT;>;>(Ljava/lang/Class<TT;>;Ljava/lang/String;)TT;
-20 -1: unsuspendSomeThreads
-29 -1: sun.classloader.findClassTime
-11 -1: plusSeconds
-3 -1: =
-4 -1: Lock
-7 -1: regions
-38 -1: ()Ljava/lang/reflect/Constructor<TT;>;
-25 -1: parseParameterAnnotations
-20 -1: getSystemGMTOffsetID
-33 -1: [Cc][Oo][Dd][Ee][Bb][Aa][Ss][Ee]=
-37 -1: (Ljava/lang/String;I)Ljava/lang/Byte;
-10 -1: permission
-78 -1: (Ljava/lang/reflect/Constructor;)Lsun/reflect/generics/scope/ConstructorScope;
-28 -1: (Lsun/misc/JavaLangAccess;)V
-26 -1: GET_CLASSLOADER_PERMISSION
-24 -1: (J)Ljava/nio/ByteBuffer;
-20 -1: getUnresolvedActions
-49 -1: (I[BIILsun/security/util/ManifestEntryVerifier;)V
-5 -1: (ZJ)V
-14 -1: isClassOnlyJar
-35 -1: ()[Ljava/util/HashMap$Node<TK;TV;>;
-23 -1: ()Ljava/util/SortedMap;
-29 -1: HistoricallyNamedCharset.java
-30 -1: no leading reference parameter
-8 -1: csCESU-8
-3 -1: >
-13 -1: invoke_LLLL_L
-109 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/NavigableMap<TK;+TV;>;)Ljava/util/NavigableMap<TK;TV;>;
-13 -1: invoke_LLLL_V
-46 -1: (Ljava/lang/Class;Z)[Ljava/lang/reflect/Field;
-5 -1: offer
-12 -1: isoLanguages
-61 -1: (Ljava/io/OutputStream;Ljava/lang/String;Ljava/lang/String;)V
-44 -1: sun/reflect/BootstrapConstructorAccessorImpl
-12 -1: BaseIterator
-58 -1: (IZ[Ljava/lang/Class;[Ljava/lang/Class;)Ljava/lang/String;
-23 -1: initializeOSEnvironment
-62 -1: ([Ljava/security/cert/Certificate;)[Ljava/security/CodeSigner;
-3 -1: >>
-13 -1: searchEntries
-7 -1: setDate
-3 -1: red
-3 -1: ref
-10 -1: EMPTY_LIST
-3 -1: rem
-78 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractCollection<TE;>;Ljava/util/List<TE;>;
-9 -1: scanToken
-6 -1: greek8
-9 -1: basicType
-12 -1: getFromClass
-43 -1: averageCharsPerByte exceeds maxCharsPerByte
-8 -1: isDaemon
-7 -1: nonNull
-17 -1: Invalid default:
-45 -1: (Lsun/misc/URLClassPath;Ljava/lang/String;Z)V
-18 -1: java/lang/String$1
-11 -1: copyMethods
-15 -1: sun/misc/Signal
-5 -1: float
-18 -1: StreamDecoder.java
-19 -1: no such constructor
-14 -1: bad arity for
-14 -1: divideUnsigned
-10 -1: CODING_END
-3 -1: IST
-14 -1: HeaderIterator
-9 -1: september
-20 -1: makeVarargsCollector
-6 -1: L_PATH
-45 -1: (Ljava/lang/String;)Ljava/io/File$PathStatus;
-24 -1: URI scheme is not "file"
-85 -1: (Ljava/lang/Class<TT;>;Ljava/lang/Class<TV;>;Ljava/lang/String;Ljava/lang/Class<*>;)V
-27 -1: java/util/function/Supplier
-17 -1: checkedCollection
-8 -1: MapEntry
-81 -1: (Ljava/lang/invoke/MethodHandle;ILjava/util/List;)Ljava/lang/invoke/MethodHandle;
-34 -1: java/security/ProtectionDomain$Key
-14 -1: List length =
-39 -1: ([Ljava/lang/Object;)Ljava/lang/String;
-87 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/util/function/BiFunction;)Ljava/lang/Object;
-7 -1: unparse
-28 -1: jarFileHasClassPathAttribute
-40 -1: (Lsun/misc/JavaIOFileDescriptorAccess;)V
-30 -1: (Ljava/lang/reflect/Field;ZZ)V
-22 -1: GetPropertyAction.java
-8 -1: RUNNABLE
-10 -1: exprString
-13 -1: getAnnotation
-19 -1: class can't be null
-22 -1: defaultAssertionStatus
-8 -1: getName0
-16 -1: quoteReplacement
-15 -1: getMemberVMInfo
-42 -1: (Ljava/lang/Class<*>;)Ljava/lang/Class<*>;
-16 -1: cachedLambdaForm
-16 -1: addFinalRefCount
-12 -1: getMethodAt0
-8 -1: ([ZII)[Z
-44 -1: (Ljava/lang/Object;TV;Ljava/lang/Object;)TV;
-4 -1: [TT;
-29 -1: Ljava/lang/invoke/LambdaForm;
-28 -1: java/util/DualPivotQuicksort
-61 -1: ()Ljava/util/concurrent/ConcurrentHashMap$KeySetView<TK;TV;>;
-17 -1: registerDirectory
-8 -1: jarFiles
-69 -1: (Ljava/lang/CharSequence;[Ljava/lang/CharSequence;)Ljava/lang/String;
-54 -1: [Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
-15 -1: getDefaultValue
-39 -1: sun/util/calendar/ZoneInfoFile$Checksum
-20 -1: DISABLE_JAR_CHECKING
-12 -1: CONTENT_TYPE
-46 -1: array type not assignable to trailing argument
-60 -1: <T:Ljava/lang/Object;>([TT;II)Ljava/util/stream/Stream<TT;>;
-47 -1: java.lang.invoke.MethodHandle.COMPILE_THRESHOLD
-9 -1: toInstant
-152 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/NavigableMap<TK;TV;>;Ljava/lang/Class<TK;>;Ljava/lang/Class<TV;>;)Ljava/util/NavigableMap<TK;TV;>;
-7 -1: L_ALPHA
-29 -1: java/lang/AbstractMethodError
-29 -1: java/util/jar/Attributes$Name
-15 -1: LOCALE_SETTINGS
-19 -1: (J)Ljava/lang/Long;
-4 -1: jar:
-17 -1: ensureInitialized
-13 -1: LAST_MODIFIED
-40 -1: ([Ljava/lang/String;)[Ljava/lang/String;
-7 -1: shuffle
-70 -1: (Lsun/util/locale/LanguageTag;)Lsun/util/locale/InternalLocaleBuilder;
-19 -1: isPackageAccessible
-17 -1: compileToBytecode
-11 -1: getPackages
-237 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceKeysToIntTask;Ljava/util/function/ToIntFunction;ILjava/util/function/IntBinaryOperator;)V
-53 -1: java/util/concurrent/ConcurrentHashMap$KeySpliterator
-26 -1: setURLStreamHandlerFactory
-47 -1: access print all checkPermission results
-22 -1: sun/reflect/MethodInfo
-75 -1: (Ljava/lang/String;ZLjava/util/Set<Ljava/lang/String;>;)Lsun/misc/Resource;
-6 -1: KOI8-R
-14 -1: Character.java
-5 -1: (SS)I
-8 -1: unshared
-73 -1: (Ljava/lang/String;[BIILjava/security/ProtectionDomain;)Ljava/lang/Class;
-19 -1: replacementTreeNode
-10 -1: BA_REGULAR
-8 -1: UTF-16LE
-44 -1: (Ljava/lang/Class<*>;[Ljava/lang/Class<*>;)V
-22 -1: InputStreamReader.java
-17 -1: getInvocationType
-23 -1: getDeclaredConstructors
-48 -1: [Lsun/reflect/generics/tree/FormalTypeParameter;
-67 -1: (Ljava/util/Comparator;Ljava/util/Map$Entry;Ljava/util/Map$Entry;)I
-6 -1: koi8_r
-14 -1: ofTotalSeconds
-16 -1: content-encoding
-6 -1: koi8_u
-10 -1: getEncoded
-6 -1: ()[TT;
-43 -1: ([ILjava/util/function/IntUnaryOperator;I)V
-18 -1: getSecurityContext
-13 -1: LF_GEN_LINKER
-78 -1: (BLjava/lang/invoke/MemberName;Ljava/lang/Class;)Ljava/lang/invoke/MemberName;
-49 -1: (Ljava/util/HashMap;[Ljava/util/HashMap$Node;II)V
-19 -1: LinkedEntryIterator
-23 -1: Warning: JIT compiler "
-7 -1: static
-100 -1: (Ljava/lang/Class;ZLjava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Class;)Ljava/util/List;
-79 -1: <T:Ljava/lang/Object;>(Ljava/util/Collection<+TT;>;)Ljava/util/Collection<TT;>;
-10 -1: iso-ir-100
-10 -1: iso-ir-101
-13 -1: toUpperString
-31 -1: ()Ljava/util/Spliterator$OfInt;
-43 -1: Ljava/lang/StringIndexOutOfBoundsException;
-19 -1: Lsun/misc/JarIndex;
-7 -1: Version
-90 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;Ljava/security/ProtectionDomain;)Ljava/lang/Class;
-10 -1: getHandler
-45 -1: (ILjava/lang/Object;)Ljava/lang/StringBuffer;
-28 -1: getDeclaredAnnotationsByType
-46 -1: ([Ljava/lang/Class;Ljava/lang/StringBuilder;)V
-53 -1: ()Ljava/util/Enumeration<Ljava/security/Permission;>;
-15 -1: addAllNonStatic
-10 -1: iso-ir-110
-14 -1: Using VM:
-17 -1: casReflectionData
-26 -1: (Lsun/util/PreHashedMap;)I
-24 -1: removeByNameAndSignature
-4 -1: OS X
-85 -1: (Ljava/lang/ClassLoader;Ljava/lang/String;Ljava/lang/ClassLoader;Ljava/lang/String;)Z
-16 -1: JarEntryIterator
-38 -1: Ljava/lang/Class<Ljava/lang/Integer;>;
-37 -1: Ljava/lang/Class<Ljava/lang/Double;>;
-28 -1: ([Ljava/util/HashMap$Node;)V
-34 -1: java/lang/reflect/GenericArrayType
-14 -1: annotationData
-26 -1: (Lsun/util/PreHashedMap;)V
-22 -1: checkPackageDefinition
-30 -1: ACCUMULATED_DAYS_IN_MONTH_LEAP
-12 -1: lowestOneBit
-64 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;Ljava/lang/ThreadLocal;)V
-16 -1: asReadOnlyBuffer
-11 -1: getRealName
-17 -1: StringCoding.java
-10 -1: iso-ir-126
-11 -1: isSurrogate
-8 -1: setError
-138 -1: <T:Ljava/lang/Object;U:Ljava/lang/Object;>(Ljava/util/function/Function<-TT;+TU;>;Ljava/util/Comparator<-TU;>;)Ljava/util/Comparator<TT;>;
-8 -1: (TK;)TK;
-4 -1: java
-136 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedAction<TT;>;Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;)TT;
-36 -1: ()Lsun/util/locale/LocaleExtensions;
-12 -1: doubleStream
-28 -1: ()Ljava/util/SimpleTimeZone;
-7 -1: :@&=+$,
-94 -1: Ljava/lang/ThreadLocal<Ljava/lang/ref/SoftReference<Ljava/lang/StringCoding$StringDecoder;>;>;
-64 -1: (Ljava/lang/String;[Ljava/lang/Class;)Ljava/lang/reflect/Method;
-19 -1: getSystemTimeZoneID
-18 -1: ReentrantLock.java
-8 -1: emptyMap
-16 -1: getSavedProperty
-249 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceEntriesToDoubleTask;Ljava/util/function/ToDoubleFunction;DLjava/util/function/DoubleBinaryOperator;)V
-14 -1: KeySpliterator
-13 -1: findResources
-14 -1: forWrapperType
-8 -1: floorMod
-12 -1: isoCountries
-10 -1: CheckedSet
-21 -1: AbstractCalendar.java
-12 -1: IS_INVOCABLE
-45 -1: (Ljava/lang/Class;)Lsun/reflect/ConstantPool;
-19 -1: checkSecurityAccess
-13 -1: Invalid index
-28 -1: STACK_TRACE_ELEMENT_SENTINEL
-88 -1: (ILjava/lang/Object;Ljava/lang/Object;)Ljava/util/concurrent/ConcurrentHashMap$TreeNode;
-130 -1: (Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)V
-14 -1: aliases_IBM437
-10 -1: iso-ir-144
-10 -1: iso-ir-148
-35 -1: ()Ljava/nio/charset/CharsetDecoder;
-95 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle;
-16 -1: UnmodifiableList
-40 -1: ()Ljava/util/concurrent/locks/Condition;
-9 -1: Path.java
-80 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/Class;[Ljava/lang/Class;)Ljava/util/Map;
-36 -1: Ljava/lang/Class<Ljava/lang/Float;>;
-124 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;)Ljava/lang/Object;
-20 -1: privateGetParameters
-24 -1: sun/nio/cs/StreamDecoder
-12 -1: getFreeSpace
-8 -1: US-ASCII
-22 -1: negativeZeroDoubleBits
-9 -1: putObject
-13 -1: linkToVirtual
-35 -1: Ljava/lang/Class<Ljava/lang/Long;>;
-15 -1: detectedCharset
-26 -1: java/lang/reflect/Modifier
-22 -1: JAVAFX_LAUNCH_MODE_JAR
-32 -1: java/net/URLStreamHandlerFactory
-7 -1: IBM-923
-80 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;)Ljava/lang/String;
-13 -1: TRANSFERINDEX
-34 -1: (Lsun/nio/cs/StandardCharsets$1;)V
-23 -1: ()Ljava/io/InputStream;
-16 -1: ()Ljava/io/File;
-41 -1: (Ljava/lang/String;)Ljava/nio/ByteBuffer;
-22 -1: sun/reflect/Reflection
-23 -1: java/lang/AutoCloseable
-25 -1: BootstrapMethodError.java
-19 -1: EnclosingMethodInfo
-13 -1: transferIndex
-18 -1: java/lang/Compiler
-4 -1: zero
-29 -1: java/util/Arrays$NaturalOrder
-9 -1: language=
-37 -1: Ljava/util/ArrayList<Ljava/net/URL;>;
-73 -1: ()Ljava/util/concurrent/locks/AbstractQueuedSynchronizer$ConditionObject;
-16 -1: balanceInsertion
-82 -1: (Ljava/lang/StringBuffer;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;I)V
-11 -1: asIntBuffer
-27 -1: (Ljava/util/LinkedList;II)V
-13 -1: ofEpochSecond
-19 -1: sunjce_provider.jar
-21 -1: (F)Ljava/lang/String;
-32 -1: >> does not contain binding <<
-21 -1: declaredPublicMethods
-5 -1: FIELD
-17 -1: getPrimitiveClass
-127 -1: (Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater$AtomicReferenceFieldUpdaterImpl;Ljava/lang/Class;Ljava/lang/String;)V
-21 -1: replaceParameterTypes
-73 -1: Ljava/util/Map<Ljava/lang/Class<*>;Ljava/security/PermissionCollection;>;
-21 -1: (Ljava/lang/Double;)I
-5 -1: floor
-4 -1: halt
-14 -1: newConstructor
-48 -1: (Ljava/util/function/BiFunction<-TK;-TV;+TV;>;)V
-17 -1: packageAccessLock
-15 -1: America/Phoenix
-19 -1: Incoming arguments:
-11 -1: V_Monotonic
-14 -1: decrementExact
-15 -1: updatePositions
-14 -1: toLocaleString
-12 -1: appendEscape
-7 -1: DISPLAY
-27 -1: sun/nio/cs/US_ASCII$Decoder
-13 -1: LITTLE_ENDIAN
-6 -1: isNull
-13 -1: TempDirectory
-6 -1: LM_JAR
-39 -1: JVMTI_THREAD_STATE_WAITING_WITH_TIMEOUT
-10 -1: isCompiled
-36 -1: (Ljava/lang/AbstractStringBuilder;)Z
-3 -1: run
-17 -1: START_PUNCTUATION
-33 -1: Ljava/util/Stack<Ljava/net/URL;>;
-49 -1: (Ljava/lang/String;)Ljava/lang/invoke/LambdaForm;
-28 -1: java/security/DomainCombiner
-53 -1: (Ljava/lang/String;Ljava/util/Map;)Ljava/time/ZoneId;
-81 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/Class;)[Ljava/lang/reflect/AnnotatedType;
-43 -1: java/lang/management/GarbageCollectorMXBean
-11 -1: toTitleCase
-12 -1: getHoldCount
-4 -1: ()[B
-4 -1: ()[C
-4 -1: ()[J
-20 -1: (Ljava/io/File;IZZ)Z
-18 -1: fileTimeToUnixTime
-23 -1: java/nio/HeapCharBuffer
-30 -1: Ljava/lang/ref/ReferenceQueue;
-6 -1: rt.jar
-69 -1: (Ljava/util/function/ToIntFunction<-TT;>;)Ljava/util/Comparator<TT;>;
-21 -1: java/lang/ThreadLocal
-25 -1: Ljava/lang/reflect/Field;
-44 -1: (Ljava/lang/String;Ljava/lang/Throwable;ZZ)V
-93 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/MethodHandle;
-22 -1: getDayOfWeekDateBefore
-37 -1: [Lsun/reflect/generics/tree/TypeTree;
-83 -1: <E:Ljava/lang/Object;>(Ljava/util/Map<TE;Ljava/lang/Boolean;>;)Ljava/util/Set<TE;>;
-10 -1: readFields
-42 -1: (Ljava/net/URL;)Ljava/security/CodeSource;
-44 -1: (Ljava/lang/String;IIJ)Ljava/nio/ByteBuffer;
-27 -1: Ljava/util/Collection<TE;>;
-13 -1: checkResource
-7 -1: rename0
-51 -1: (C)Ljava/lang/invoke/BoundMethodHandle$SpeciesData;
-47 -1: sun/reflect/generics/repository/FieldRepository
-11 -1: readBoolean
-134 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$TreeNode;)V
-13 -1: getZoneOffset
-17 -1: getJdkVersionInfo
-21 -1: sun/misc/MessageUtils
-23 -1: defaultAllowArraySyntax
-31 -1: java/util/concurrent/locks/Lock
-24 -1: java/lang/reflect/Method
-7 -1: toUpper
-17 -1: sun/misc/Signal$1
-51 -1: (JLjava/util/function/BiFunction<-TK;-TK;+TK;>;)TK;
-28 -1: (Ljava/lang/ref/Reference;)Z
-8 -1: nthreads
-26 -1: MapReduceEntriesToLongTask
-27 -1: (Ljava/util/NavigableSet;)V
-10 -1: savedProps
-25 -1: Lsun/security/util/Debug;
-12 -1: CR_MALFORMED
-13 -1: com.sun.proxy
-17 -1: CharSequence.java
-24 -1: (ILjava/lang/String;II)Z
-13 -1: findNextValue
-108 -1: <K::Ljava/lang/Comparable<-TK;>;V:Ljava/lang/Object;>()Ljava/util/Comparator<Ljava/util/Map$Entry<TK;TV;>;>;
-5 -1: (FF)F
-9 -1: typeClass
-5 -1: (FF)I
-11 -1: segmentMask
-7 -1: (JJJJ)V
-14 -1: aliases_CESU_8
-85 -1: (Ljava/lang/Class;Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/DirectMethodHandle;
-15 -1: getCalendarDate
-21 -1: getDeclaredAnnotation
-8 -1: ([BIIB)I
-15 -1: stripExtensions
-14 -1: getISO3Country
-5 -1: short
-47 -1: String value %s exceeds range of unsigned long.
-34 -1: ()Ljava/security/ProtectionDomain;
-8 -1: ([BIIB)V
-23 -1: (Ljava/lang/Object;ID)V
-47 -1: (Ljava/lang/String;Ljava/nio/charset/Charset;)V
-29 -1: RuntimeVisibleTypeAnnotations
-24 -1: (Ljava/io/InputStream;)V
-39 -1: (Ljava/lang/Class;Ljava/lang/String;Z)V
-16 -1: convertPrimitive
-8 -1: (TK;)TV;
-24 -1: (Ljava/io/InputStream;)Z
-6 -1: start
-243 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceEntriesToLongTask;Ljava/util/function/ToLongFunction;JLjava/util/function/LongBinaryOperator;)V
-9 -1: asSpecial
-20 -1: java/text/Normalizer
-17 -1: DAYS_0000_TO_1970
-9 -1: toCharset
-20 -1: REPLACEALL_THRESHOLD
-20 -1: sun/net/util/URLUtil
-16 -1: findLoadedClass0
-14 -1: localedata.jar
-6 -1: Parser
-6 -1: start0
-4 -1: hash
-83 -1: (Ljava/lang/Class;Ljava/lang/Class;[Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
-29 -1: Ljava/lang/invoke/MemberName;
-8 -1: BOOT_TAG
-22 -1: MH_LINKER_ARG_APPENDED
-14 -1: comparingByKey
-47 -1: ([Ljava/lang/String;)Ljava/lang/ProcessBuilder;
-6 -1: start=
-18 -1: StringBuilder.java
-7 -1: getLong
-12 -1: copyElements
-16 -1: highResFrequency
-11 -1: toGMTString
-10 -1: ISO_8859_1
-10 -1: ISO_8859_2
-6 -1: result
-10 -1: ISO_8859_4
-10 -1: ISO_8859_5
-10 -1: ISO_8859_7
-15 -1: unmodifiableSet
-10 -1: ISO_8859_9
-25 -1: NoClassDefFoundError.java
-42 -1: (Ljava/lang/String;)Ljava/util/LinkedList;
-14 -1: parallelPrefix
-22 -1: ARRAY_LONG_INDEX_SCALE
-6 -1: resume
-36 -1: Ljava/lang/invoke/LambdaForm$Hidden;
-50 -1: java/util/Collections$UnmodifiableRandomAccessList
-130 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/Consumer;)V
-6 -1: getInt
-13 -1: getCachedYear
-21 -1: CONNECTOR_PUNCTUATION
-73 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/Object;ILjava/lang/Class;)V
-24 -1: [Lsun/util/calendar/Era;
-22 -1: (Ljava/lang/Object;D)V
-74 -1: (Ljava/security/AccessControlContext;)Ljava/security/AccessControlContext;
-109 -1: <T:Ljava/lang/Object;>(Ljava/lang/Class<*>;Ljava/lang/Class$AnnotationData;Ljava/lang/Class$AnnotationData;)Z
-6 -1: ([CZ)V
-74 -1: (Ljava/util/HashMap$Node;Ljava/util/HashMap$Node;)Ljava/util/HashMap$Node;
-19 -1: TRADITIONAL_CHINESE
-125 -1: (Ljava/lang/Throwable$PrintStreamOrWriter;[Ljava/lang/StackTraceElement;Ljava/lang/String;Ljava/lang/String;Ljava/util/Set;)V
-18 -1: unknown protocol:
-57 -1: (Ljava/lang/reflect/Method;Lsun/reflect/MethodAccessor;)V
-13 -1: writeComments
-9 -1: Negotiate
-14 -1: Closeable.java
-10 -1: asSpreader
-122 -1: (Ljava/nio/file/WatchService;[Ljava/nio/file/WatchEvent$Kind;[Ljava/nio/file/WatchEvent$Modifier;)Ljava/nio/file/WatchKey;
-17 -1: jvm_minor_version
-9 -1: getDouble
-25 -1: Ljava/io/File$PathStatus;
-19 -1: averageCharsPerByte
-22 -1: getConstructorAccessor
-61 -1: (Ljava/lang/String;)Ljava/lang/management/MemoryManagerMBean;
-45 -1: (Ljava/lang/String;)Ljava/util/regex/Pattern;
-25 -1: (JC)Ljava/nio/ByteBuffer;
-20 -1: exclusiveOwnerThread
-85 -1: <T:Ljava/lang/Object;>(Ljava/lang/ClassValue<TT;>;Ljava/lang/ClassValue$Entry<TT;>;)V
-17 -1: getExtensionValue
-14 -1: getLoadAverage
-17 -1: GET_PD_PERMISSION
-6 -1: METHOD
-23 -1: sun/nio/cs/ISO_8859_1$1
-23 -1: (I[Ljava/lang/Object;)I
-4 1: zzz1
-13 -1: createWrapper
-4 1: zzz2
-4 1: zzz3
-33 -1: greater than Character.MAX_RADIX
-37 -1: DIRECTIONALITY_RIGHT_TO_LEFT_OVERRIDE
-6 -1: BRIDGE
-20 -1: canonicalizeLanguage
-13 -1: setPermission
-46 -1: (Ljava/io/OutputStream;)Ljava/io/OutputStream;
-3 -1: 646
-14 -1: java/lang/Long
-55 -1: java/util/concurrent/ConcurrentHashMap$SearchValuesTask
-38 -1: (IC)Ljava/lang/invoke/LambdaForm$Name;
-37 -1: (Ljava/lang/Class;)Ljava/lang/String;
-17 -1: javaUtilJarAccess
-23 -1: registerMethodsToFilter
-34 -1: (Ljava/nio/charset/Charset;[CII)[B
-11 -1: % VERSION 2
-37 -1: ([DI)Ljava/util/Spliterator$OfDouble;
-16 -1: Stack Size:
-52 -1: (Ljava/lang/Class;)Ljava/lang/annotation/Annotation;
-17 -1: putDoubleVolatile
-10 -1: access$500
-10 -1: access$502
-28 -1: malformed input around byte
-13 -1: LF_INVSPECIAL
-32 -1: Non-positive averageCharsPerByte
-14 -1: NF_fieldOffset
-10 -1: access$508
-48 -1: <T:Ljava/lang/Object;>(TT;)Ljava/util/List<TT;>;
-17 -1: defaultReadObject
-17 -1: java/util/TimSort
-13 -1: resolveClass0
-92 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;[Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
-20 -1: setLangReflectAccess
-30 -1: java/lang/reflect/TypeVariable
-56 -1: <T:Ljava/lang/Object;>([TT;)Ljava/util/Spliterator<TT;>;
-8 -1: VOLATILE
-10 -1: Big5-HKSCS
-23 -1: (Ljava/util/Locale$1;)V
-15 -1: ISO_8859-1:1987
-14 -1: no such method
-10 -1: null value
-8 -1: checkURL
-22 -1: ARRAY_BYTE_INDEX_SCALE
-27 -1: (Ljava/lang/ClassLoader;Z)V
-22 -1: java/lang/reflect/Type
-25 -1: java/net/JarURLConnection
-36 -1: java/util/WeakHashMap$KeySpliterator
-26 -1: ()Lsun/misc/JavaAWTAccess;
-50 -1: (I[Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
-9 -1: toDegrees
-12 -1: lowSurrogate
-19 -1: getEnclosingMethod0
-7 -1: bytearr
-35 -1: (Ljava/util/List;Ljava/util/List;)I
-25 -1: [Ljava/lang/reflect/Type;
-34 -1: javaSecurityProtectionDomainAccess
-21 -1: java.launcher.X.usage
-37 -1: sun/util/locale/InternalLocaleBuilder
-33 -1: ()Ljava/lang/invoke/MethodHandle;
-3 -1: scl
-19 -1: synthesizeAllParams
-68 -1: Ljava/util/Map<Ljava/lang/String;[Ljava/security/cert/Certificate;>;
-6 -1: vclass
-35 -1: (Ljava/util/List;Ljava/util/List;)V
-59 -1: Ljava/lang/Number;Ljava/lang/Comparable<Ljava/lang/Float;>;
-13 -1: CallSite.java
-10 1: Bar loaded
-21 -1: ARRAY_INT_BASE_OFFSET
-49 -1: Ljava/util/concurrent/ConcurrentHashMap$TreeNode;
-32 -1: [Ljava/lang/reflect/Constructor;
-4 -1: type
-34 -1: <T:Ljava/lang/Object;>([TT;II)[TT;
-25 -1: BufferedOutputStream.java
-23 -1: java/util/zip/ZipFile$1
-24 -1: ()Ljava/lang/ClassValue;
-50 -1: (Ljava/util/concurrent/CountedCompleter;[F[FIIII)V
-16 -1: getQueuedThreads
-26 -1: getJavaNetHttpCookieAccess
-8 -1: setExtra
-8 -1: implRead
-20 -1: linkMethod => throw
-76 -1: (Ljava/util/function/ToDoubleFunction;Ljava/lang/Object;Ljava/lang/Object;)I
-11 -1: KeyIterator
-39 -1: Ljava/util/List<Ljava/lang/Throwable;>;
-3 -1: " "
-36 -1: Ljava/lang/IllegalArgumentException;
-11 -1: checkBounds
-30 -1: sun/nio/cs/FastCharsetProvider
-11 -1: toLongArray
-107 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Class<*>;IILjava/lang/String;[B)Ljava/lang/reflect/Field;
-8 -1: (build
-39 -1: (Ljava/nio/Buffer;ILjava/nio/Buffer;I)V
-31 -1: [Ljava/lang/reflect/Executable;
-3 -1: set
-21 -1: PhantomReference.java
-41 -1: java/util/Collections$CheckedNavigableMap
-53 -1: Can not make a java.lang.Class constructor accessible
-12 -1: ([CII[CIII)I
-55 -1: Ljava/util/HashMap<Ljava/lang/String;Ljava/lang/Void;>;
-12 -1: MICROSECONDS
-11 -1: writeBuffer
-52 -1: and domain that didn't have permission
-37 -1: java/nio/channels/WritableByteChannel
-26 -1: getRawClassTypeAnnotations
-15 -1: putCharVolatile
-33 -1: java/security/InvalidKeyException
-19 -1: Ljava/io/Closeable;
-83 -1: Lsun/util/locale/LocaleObjectCache<Ljava/util/Locale$LocaleKey;Ljava/util/Locale;>;
-10 -1: SetFromMap
-24 -1: JavaFX-Application-Class
-13 -1: asShortBuffer
-10 -1: getReifier
-15 -1: isPositionIndex
-18 -1: SignalHandler.java
-3 -1: JST
-28 -1: (Ljava/io/FileDescriptor;I)I
-28 -1: getStackAccessControlContext
-16 -1: updateByteBuffer
-27 -1: ()Ljava/net/ContentHandler;
-25 -1: (JD)Ljava/nio/ByteBuffer;
-39 -1: ()Lsun/misc/JavaIOFileDescriptorAccess;
-107 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;Ljava/lang/ThreadLocal;)Ljava/lang/ThreadLocal$ThreadLocalMap$Entry;
-42 -1: sun/misc/PerfCounter$WindowsClientCounters
-8 -1: addExact
-28 -1: (Ljava/io/FileDescriptor;I)V
-36 -1: ([Ljava/lang/String;)Ljava/util/Map;
-21 -1: ()Ljava/lang/Process;
-4 -1: UTF8
-5 -1: mkdir
-10 -1: transient
-3 -1: sgp
-15 -1: balanceDeletion
-161 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/net/URL;)Ljava/lang/Package;
-15 -1: SynchronizedMap
-40 -1: sun.misc.URLClassPath.disableJarChecking
-92 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractSet<TE;>;Ljava/util/Set<TE;>;Ljava/io/Serializable;
-17 -1: removeEldestEntry
-35 -1: (I)Ljava/lang/Class$AnnotationData;
-24 -1: Ljava/util/Locale$Cache;
-13 -1: STANDARD_TIME
-17 -1: sun/nio/cs/MS1252
-99 -1: <K:Ljava/lang/Object;>()Ljava/util/concurrent/ConcurrentHashMap$KeySetView<TK;Ljava/lang/Boolean;>;
-23 -1: java/util/LinkedHashSet
-9 -1: iso8859_1
-9 -1: iso8859_2
-9 -1: iso8859_4
-66 -1: <A::Ljava/lang/annotation/Annotation;>(Ljava/lang/Class<TA;>;)[TA;
-9 -1: iso8859_5
-9 -1: iso8859_7
-9 -1: iso8859_9
-21 -1: Ljava/util/Formatter;
-6 -1: isPath
-21 -1: makeReferenceIdentity
-24 -1: sun/net/ApplicationProxy
-23 -1: ClassCastException.java
-11 -1: MethodArray
-12 -1: SingletonMap
-41 -1: java/util/ArrayPrefixHelpers$CumulateTask
-7 -1: seconds
-20 -1: ClassRepository.java
-14 -1: allocateMemory
-24 -1: java.launcher.jar.error1
-24 -1: java.launcher.jar.error2
-24 -1: java.launcher.jar.error3
-45 -1: (Ljava/lang/String;Ljava/util/jar/Manifest;)Z
-3 -1: sin
-7 -1: (J[II)I
-3 -1: Itr
-18 -1: findBootstrapClass
-10 -1: getElement
-15 -1: ISO_8859-4:1988
-34 -1: newGetLongIllegalArgumentException
-7 -1: pending
-17 -1: isNotContinuation
-6 -1: EXTSIG
-13 -1: searchMethods
-32 -1: Lsun/misc/JavaUtilZipFileAccess;
-33 -1: ([Ljava/lang/reflect/Parameter;)V
-31 -1: defaultUncaughtExceptionHandler
-89 -1: (Ljava/nio/file/WatchService;[Ljava/nio/file/WatchEvent$Kind<*>;)Ljava/nio/file/WatchKey;
-5 -1: ASCII
-28 -1: ()Lsun/reflect/ConstantPool;
-20 -1: isJavaIdentifierPart
-6 -1: EXTSIZ
-34 -1: Lsun/misc/JavaNetHttpCookieAccess;
-34 -1: ClassLoader object not initialized
-7 -1: CHECKED
-16 -1: encodeBufferLoop
-37 -1: (Ljava/time/Instant;)Ljava/util/Date;
-24 -1: (Ljava/util/Map$Entry;)Z
-50 -1: java/util/concurrent/ConcurrentHashMap$KeyIterator
-31 -1: ()[Ljava/lang/ClassValue$Entry;
-31 -1: java/lang/IllegalStateException
-43 -1: (Ljava/lang/Appendable;Ljava/util/Locale;)V
-6 -1: CENVEM
-53 -1: Ljava/util/ArrayList<Lsun/misc/URLClassPath$Loader;>;
-17 -1: getHeaderFieldKey
-71 -1: (Ljava/lang/CharSequence;Ljava/text/Normalizer$Form;)Ljava/lang/String;
-6 -1: CENVER
-17 -1: cleanStaleEntries
-9 -1: linkFirst
-57 -1: (Ljava/util/Comparator<-TT;>;)Ljava/util/Comparator<TT;>;
-8 -1: val$file
-27 -1: Invalid parameter modifiers
-6 -1: append
-57 -1: ()Lsun/reflect/generics/repository/ConstructorRepository;
-65 -1: java/util/concurrent/ConcurrentHashMap$MapReduceMappingsToIntTask
-39 -1: (Ljava/lang/String;)Ljava/lang/Integer;
-25 -1: lambda$parallelSetAll$191
-25 -1: lambda$parallelSetAll$192
-25 -1: lambda$parallelSetAll$193
-23 -1: INSERTIONSORT_THRESHOLD
-17 -1: java/time/Instant
-25 -1: lambda$parallelSetAll$194
-14 -1: dynamicInvoker
-9 -1: iso646-us
-8 -1: position
-29 -1: java/nio/channels/FileChannel
-27 -1: java/util/stream/Collectors
-64 -1: (Ljava/lang/CharSequence;Ljava/lang/Iterable;)Ljava/lang/String;
-10 -1: INDEX_NAME
-15 -1: getCommentBytes
-67 -1: (Ljava/io/FileOutputStream;Ljava/lang/String;)Ljava/io/PrintStream;
-22 -1: privateGetPublicFields
-32 -1: java/util/BitSet$1BitSetIterator
-12 -1: PERF_MODE_RO
-89 -1: ([Ljava/lang/ClassValue$Entry;ILjava/lang/ClassValue$Entry;Z)Ljava/lang/ClassValue$Entry;
-30 -1: java/security/PrivilegedAction
-18 -1: host can't be null
-26 -1: package name can't be null
-12 -1: PERF_MODE_RW
-10 -1: isEnqueued
-18 -1: argSlotToParameter
-37 -1: (II)Ljava/lang/AbstractStringBuilder;
-5 -1: tabAt
-53 -1: (Ljava/lang/Object;)Ljava/lang/AbstractStringBuilder;
-11 -1: PATH_OFFSET
-18 -1: unicodebigunmarked
-15 -1: ConditionObject
-6 -1: KOREAN
-13 -1: isNamePresent
-24 -1: ()Ljava/lang/Class<TE;>;
-14 -1: isStandardTime
-8 -1: ([IIII)I
-9 -1: WeakEntry
-12 -1: javaIOAccess
-17 -1: key can't be null
-129 -1: Ljava/lang/Object;Ljava/lang/Comparable<Ljava/nio/file/Path;>;Ljava/lang/Iterable<Ljava/nio/file/Path;>;Ljava/nio/file/Watchable;
-8 -1: handler
-8 -1: ([IIII)V
-10 -1: atBugLevel
-18 -1: makeGuardWithCatch
-18 -1: currentLoadedClass
-11 -1: getCodeBase
-67 -1: <T:Ljava/lang/Object;>(Ljava/util/List<+TT;>;)Ljava/util/List<TT;>;
-12 -1: JarFile.java
-19 -1: (C)Ljava/io/Writer;
-22 -1: createURLStreamHandler
-23 -1: sun/nio/cs/ArrayDecoder
-13 -1: setAccessible
-18 -1: stripOffParameters
-101 -1: ([Ljava/security/ProtectionDomain;[Ljava/security/ProtectionDomain;)[Ljava/security/ProtectionDomain;
-18 -1: Ljava/util/Random;
-16 -1: Pacific/Honolulu
-13 -1: useOldMapping
-65 -1: (Ljava/lang/invoke/LambdaForm$NamedFunction;[Ljava/lang/Object;)V
-14 -1: filterArgument
-12 -1: LF_MH_LINKER
-25 -1: isDirectMemoryPageAligned
-49 -1: (Ljava/util/BitSet;)Ljava/util/function/Supplier;
-54 -1: (Ljava/util/concurrent/ConcurrentHashMap<TK;TV;>;TV;)V
-16 -1: java/time/ZoneId
-4 -1: zfot
-18 -1: isSameClassPackage
-6 -1: julian
-8 -1: (TT;)TT;
-22 -1: java/util/jar/Manifest
-7 -1: charOut
-16 -1: getOffsetsByWall
-19 -1: Illegal replacement
-139 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractList<TE;>;Ljava/util/List<TE;>;Ljava/util/RandomAccess;Ljava/lang/Cloneable;Ljava/io/Serializable;
-96 -1: <T:Ljava/lang/Object;>(Ljava/lang/reflect/Constructor<TT;>;)Ljava/lang/reflect/Constructor<TT;>;
-15 -1: Annotation.java
-24 -1: (Ljava/lang/Class<*>;)[B
-6 -1: CODING
-34 -1: ([Ljava/lang/ClassValue$Entry;II)V
-6 -1: IGNORE
-62 -1: (Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodHandle;
-29 -1: specificToGenericStringHeader
-12 -1: helpTransfer
-8 -1: fastTime
-62 -1: (Ljava/net/URLConnection;[Ljava/lang/Class;)Ljava/lang/Object;
-18 -1: Unhandled signal:
-8 -1: isStrict
-15 -1: ISO_8859-7:1987
-13 -1: getWeekLength
-14 -1: jvmBuildNumber
-40 -1: (Ljava/lang/String;)Ljava/util/Iterator;
-6 -1: short0
-6 -1: short1
-73 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedExceptionAction<TT;>;)TT;
-10 -1: removeNode
-8 -1: setFloat
-18 -1: cspc862latinhebrew
-11 -1: setTimeZone
-34 -1: java/lang/reflect/AccessibleObject
-25 -1: MapReduceKeysToDoubleTask
-25 -1: java/lang/ref/Reference$1
-24 -1: java/nio/HeapByteBufferR
-15 -1: jdkMicroVersion
-117 -1: (Ljava/lang/Class;Ljava/lang/String;[Ljava/lang/Class;Ljava/lang/Class;[Ljava/lang/Class;IILjava/lang/String;[B[B[B)V
-8 -1: (TT;)TV;
-16 -1: Permissions.java
-22 -1: Ljava/util/Comparator;
-17 -1: getDaylightSaving
-25 -1: ([BIILjava/lang/String;)V
-9 -1: stillborn
-11 -1: maxPosition
-28 -1: java/util/ArrayPrefixHelpers
-73 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>()Ljava/util/SortedMap<TK;TV;>;
-14 -1: useCanonCaches
-5 -1: clean
-16 -1: checkPermission2
-34 -1: sun.misc.launcher.useSharedArchive
-13 -1: shutdownHooks
-5 -1: clear
-240 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceKeysToLongTask;Ljava/util/function/ToLongFunction;JLjava/util/function/LongBinaryOperator;)V
-67 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<-TV;+TU;>;)TU;
-6 -1: cp1250
-6 -1: cp1251
-6 -1: cp1252
-13 -1: getZipMessage
-6 -1: cp1253
-28 -1: (J)Ljava/lang/ref/Reference;
-6 -1: cp1254
-54 -1: (ILjava/lang/String;)Ljava/lang/AbstractStringBuilder;
-6 -1: cp1257
-10 -1: deepEquals
-17 -1: WRITE_BUFFER_SIZE
-13 -1: copyFromArray
-40 -1: java/util/Collections$ReverseComparator2
-36 -1: sun/reflect/generics/visitor/Reifier
-19 -1: averageBytesPerChar
-13 -1: javaAWTAccess
-6 -1: cp5346
-61 -1: Ljava/util/Map<Ljava/lang/String;Ljava/nio/charset/Charset;>;
-6 -1: cp5347
-6 -1: cp5348
-6 -1: cp5349
-5 -1: field
-23 -1: ()Ljava/nio/LongBuffer;
-103 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/WrongMethodTypeException;
-37 -1: (I)Ljava/lang/Character$UnicodeBlock;
-11 -1: offsetAfter
-79 -1: Ljava/util/HashMap<Ljava/security/CodeSource;Ljava/security/ProtectionDomain;>;
-27 -1: invocationHandlerReturnType
-17 -1: POSITIVE_INFINITY
-11 -1: maybeRebind
-3 -1: str
-18 -1: setSecurityManager
-9 -1: signature
-18 -1: corrupted jar file
-89 -1: <E:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Collection<TE;>;Ljava/io/Serializable;
-87 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
-6 -1: CENATT
-6 -1: cp5350
-12 -1: AF_GETSTATIC
-38 -1: (TE;Ljava/util/LinkedList$Node<TE;>;)V
-8 -1: isLoaded
-6 -1: CENATX
-6 -1: cp5353
-18 -1: Africa/Addis_Ababa
-35 -1: sun/usagetracker/UsageTrackerClient
-11 -1: toUpperCase
-22 -1: java/util/zip/Inflater
-10 -1: iso_8859-1
-10 -1: iso_8859-2
-3 -1: sum
-7 -1: x-Johab
-10 -1: iso_8859-4
-10 -1: iso_8859-5
-85 -1: (Ljava/security/DomainCombiner;Ljava/lang/Class;)Ljava/security/AccessControlContext;
-11 -1: activeCount
-49 -1: (Ljava/lang/ClassLoader;Ljava/lang/ClassLoader;)Z
-51 -1: (Ljava/util/List;Ljava/lang/Class;)Ljava/util/List;
-10 -1: iso_8859-7
-19 -1: appendVmErgoMessage
-10 -1: iso_8859-9
-14 -1: getClassLoader
-6 -1: (CJJ)Z
-15 -1: Lsun/misc/Perf;
-7 -1: getTree
-27 -1: Ljava/text/Normalizer$Form;
-11 -1: ISO-2022-JP
-69 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Object;)Ljava/lang/Object;
-50 -1: java/lang/invoke/DirectMethodHandle$StaticAccessor
-15 -1: fxLauncherClass
-35 -1: (Ljava/net/URL;Ljava/lang/String;)V
-16 -1: getAndAccumulate
-35 -1: (Ljava/net/URL;Ljava/lang/String;)Z
-32 -1: Non-positive averageBytesPerChar
-35 -1: Ljava/lang/Class<Ljava/lang/Void;>;
-15 -1: CLASS_MODIFIERS
-12 -1: checkedQueue
-13 -1: enumConstants
-10 -1: getFactory
-95 -1: Ljava/util/concurrent/ConcurrentMap<TK;Lsun/util/locale/LocaleObjectCache$CacheEntry<TK;TV;>;>;
-13 -1: Africa/Harare
-57 -1: (JLjava/util/TimeZone;)Lsun/util/calendar/Gregorian$Date;
-11 -1: ISO-2022-KR
-19 -1: $assertionsDisabled
-13 -1: PROXY_PACKAGE
-17 -1: copyFromLongArray
-81 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/LinkedHashMap$Entry<TK;TV;>;
-11 -1: checkDelete
-38 -1: sun/management/ManagementFactoryHelper
-7 -1: UTC1900
-20 -1: getBootstrapResource
-23 -1: ()Ljava/lang/Throwable;
-16 -1: CALLER_SENSITIVE
-26 -1: checkSystemClipboardAccess
-32 -1: Can't set default locale to NULL
-16 -1: fxLauncherMethod
-4 -1: >=
-8 -1: provider
-9 -1: Finalizer
-78 -1: (Ljava/io/FileDescriptor;ZZZLjava/lang/Object;)Ljava/nio/channels/FileChannel;
-13 -1: emptyIterator
-15 -1: getZipFileCount
-21 -1: isJavaIdentifierStart
-9 -1: connected
-11 -1: (ITK;TV;I)V
-16 -1: America/Honolulu
-22 -1: SynchronizedCollection
-28 -1: java/util/zip/ZipConstants64
-29 -1: inheritedAccessControlContext
-29 -1: ()[Ljava/security/CodeSigner;
-85 -1: (JLjava/lang/String;Ljava/lang/String;Ljava/lang/String;Lcom/sun/management/GcInfo;)V
-25 -1: (Ljava/nio/CharBuffer;Z)V
-15 -1: java/io/Console
-101 -1: (Ljava/lang/Class<*>;Lsun/reflect/annotation/AnnotationType;Lsun/reflect/annotation/AnnotationType;)Z
-9 -1: | resolve
-81 -1: (BLjava/lang/invoke/MemberName;Ljava/lang/Class<*>;)Ljava/lang/invoke/MemberName;
-33 -1: (Ljava/nio/charset/Charset;FF[B)V
-49 -1: (Ljava/lang/Class;Z)Ljava/lang/invoke/MethodType;
-66 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/io/File;)Ljava/io/File;
-29 -1: ([Ljava/util/HashMap$Node;I)V
-13 -1: filterMethods
-4 -1: jcal
-61 -1: (Ljava/util/List<Ljava/lang/Class<*>;>;)[Ljava/lang/Class<*>;
-6 -1: which=
-46 -1: (Ljava/math/BigInteger;)Ljava/math/BigInteger;
-4 -1: date
-18 -1: internalMemberName
-6 -1: (JJI)Z
-30 -1: [Ljava/lang/invoke/LambdaForm;
-60 -1: <T:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/lang/Object;
-15 -1: ReservationNode
-42 -1: java/lang/ThreadLocal$ThreadLocalMap$Entry
-6 -1: setIn0
-4 -1: sort
-8 -1: ibm00858
-110 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;IILjava/security/ProtectionDomain;Ljava/lang/String;)Ljava/lang/Class;
-28 -1: Ljava/lang/ClassValue$Entry;
-22 -1: ensureExplicitCapacity
-6 -1: rotate
-14 -1: closeRequested
-30 -1: ([CII)Ljava/lang/StringBuffer;
-10 -1: LM_UNKNOWN
-15 -1: Comparable.java
-13 -1: getByteBuffer
-9 -1: getScheme
-15 -1: done with meta!
-17 -1: checkForTypeAlias
-7 -1: getKeys
-7 -1: SIG_DFL
-30 -1: Ljava/nio/charset/CoderResult;
-16 -1: returnTypesMatch
-19 -1: getClassAccessFlags
-18 -1: JavaNioAccess.java
-9 -1: setDouble
-23 -1: Ljava/util/zip/ZipFile;
-83 -1: (JLjava/util/function/ToIntFunction<-TK;>;ILjava/util/function/IntBinaryOperator;)I
-11 -1: ACCESS_READ
-15 -1: nativeByteOrder
-5 -1: hours
-7 -1: toArray
-7 -1: Encoder
-12 -1: resolveClass
-29 -1: (Ljava/io/FileDescriptor;JJ)V
-14 -1: redefinedCount
-8 -1: getTotal
-11 -1: iso_8859-13
-11 -1: iso_8859-15
-9 -1: expected
-18 -1: getDeclaredMethods
-11 -1: elementData
-6 -1: intern
-10 -1: countryKey
-6 -1: setInt
-39 -1: Could not create extension class loader
-24 -1: SELF_SUPPRESSION_MESSAGE
-14 -1: argToSlotTable
-42 -1: Ljava/util/HashMap<TE;Ljava/lang/Object;>;
-5 -1: \t\n\r\x0c
-4 -1: read
-12 -1: Objects.java
-7 -1: aliases
-29 -1: sun/reflect/LangReflectAccess
-6 -1: prefix
-15 -1: superInterfaces
-10 -1: getDoInput
-30 -1: java/nio/CharBufferSpliterator
-6 -1: KOI8_R
-12 -1: Asia/Kolkata
-6 -1: KOI8_U
-6 -1: LOCSIG
-15 -1: UA-Java-Version
-92 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/HashMap<TK;TV;>;Ljava/util/Map<TK;TV;>;
-14 -1: CertificateRep
-17 -1: getSystemResource
-85 -1: (JLjava/util/function/ToLongFunction<-TV;>;JLjava/util/function/LongBinaryOperator;)J
-27 -1: java/lang/reflect/Parameter
-5 -1: quote
-8 -1: not MH:
-46 -1: java/util/Collections$UnmodifiableCollection$1
-6 -1: putVal
-6 -1: LOCSIZ
-6 -1: Atomic
-3 -1: 737
-38 -1: java/lang/UnsupportedClassVersionError
-27 -1: ()Ljava/lang/StringBuilder;
-41 -1: sun/net/www/protocol/jar/JarURLConnection
-60 -1: (Ljava/lang/String;[Ljava/lang/Object;)Ljava/util/Formatter;
-59 -1: <T:Ljava/lang/Object;>(TT;TT;Ljava/util/Comparator<-TT;>;)I
-54 -1: java/util/concurrent/locks/AbstractOwnableSynchronizer
-7 -1: getHost
-36 -1: (F)Ljava/lang/AbstractStringBuilder;
-69 -1: <U:Ljava/lang/Object;>(Ljava/lang/Class<TU;>;)Ljava/lang/Class<+TU;>;
-4 -1: Form
-103 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/SortedMap<TK;+TV;>;)Ljava/util/SortedMap<TK;TV;>;
-6 -1: spread
-8 -1: addHours
-13 -1: contentEquals
-47 -1: (Ljava/lang/String;Ljava/security/Permission;)V
-12 -1: newCondition
-23 -1: (Ljava/lang/Object;IZ)V
-26 -1: (Ljava/util/LinkedList;I)V
-13 -1: ConstantValue
-18 -1: URLConnection.java
-12 -1: Boolean.java
-75 -1: ([Ljava/net/URL;Ljava/lang/ClassLoader;Ljava/net/URLStreamHandlerFactory;)V
-21 -1: EMPTY_THROWABLE_ARRAY
-153 -1: (Ljava/util/Map<Ljava/lang/Class<*>;[Ljava/lang/String;>;Ljava/lang/Class<*>;[Ljava/lang/String;)Ljava/util/Map<Ljava/lang/Class<*>;[Ljava/lang/String;>;
-18 -1: getUnresolvedCerts
-13 -1: Negative time
-28 -1: java/util/WeakHashMap$KeySet
-8 -1: slashify
-16 -1: isOtherLowercase
-17 -1: putObjectVolatile
-5 -1: ERASE
-12 -1: filterFields
-40 -1: Ljava/lang/ReflectiveOperationException;
-12 -1: VM settings:
-57 -1: (ILjava/lang/Object;)Ljava/util/HashMap$TreeNode<TK;TV;>;
-10 -1: access$600
-11 -1: ] return =>
-13 -1: user.timezone
-23 -1: USER_AGENT_JAVA_VERSION
-27 -1: (Ljava/util/HashMap$Node;)V
-19 -1: filterNTLMResponses
-28 -1: (Lsun/misc/VMNotification;)V
-37 -1: ()[[Ljava/lang/annotation/Annotation;
-45 -1: ()Lcom/sun/management/DiagnosticCommandMBean;
-3 -1: tan
-31 -1: getDirectlyAndIndirectlyPresent
-7 -1: prepend
-35 -1: (I)Lsun/util/calendar/CalendarDate;
-8 -1: val$dirs
-4 -1: test
-28 -1: Non-positive maxCharsPerByte
-83 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Map<TK;TV;>;
-12 -1: JAVA_VERSION
-24 -1: ([Ljava/lang/Thread;IZ)I
-70 -1: (Ljava/lang/invoke/LambdaForm$Name;)Ljava/lang/invoke/LambdaForm$Name;
-57 -1: <T:Ljava/lang/Object;>([TT;Ljava/util/Comparator<-TT;>;)V
-42 -1: (Ljava/lang/Class<*>;[I)Ljava/lang/Object;
-27 -1: java/lang/SecurityManager$1
-32 -1: java/security/SignatureException
-27 -1: java/lang/SecurityManager$2
-4 -1: .jar
-20 -1: parameterAnnotations
-31 -1: DIRECTIONALITY_BOUNDARY_NEUTRAL
-21 -1: hasClassPathAttribute
-17 -1: checkParentAccess
-35 -1: java/security/PermissionsEnumerator
-6 -1: FORMAT
-92 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<Ljava/util/Map$Entry<TK;TV;>;+TU;>;)TU;
-3 -1: 775
-11 -1: PROBE_LIMIT
-111 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/String;)Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater;
-11 -1: AF_PUTFIELD
-22 -1: (Ljava/lang/Object;Z)V
-20 -1: getGenericReturnType
-9 -1: val$extcl
-13 -1: inClassLoader
-37 -1: sun.urlClassLoader.readClassBytesTime
-35 -1: (JLjava/util/function/BiConsumer;)V
-28 -1: getContentHandlerPkgPrefixes
-10 -1: getChannel
-78 -1: <T:Ljava/lang/Object;>(Ljava/util/List<+TT;>;TT;Ljava/util/Comparator<-TT;>;)I
-16 -1: parseMemberValue
-4 -1: regn
-47 -1: ([Ljava/lang/Object;III)Ljava/util/Spliterator;
-11 -1: but found
-6 -1: adjust
-11 -1: isLowerCase
-29 -1: sun/reflect/ReflectionFactory
-98 -1: <E:Ljava/lang/Object;>(Ljava/util/SortedSet<TE;>;Ljava/lang/Class<TE;>;)Ljava/util/SortedSet<TE;>;
-18 -1: [Ljava/lang/Error;
-5 -1: entry
-14 -1: refreshVersion
-8 -1: (IIIII)V
-22 -1: unmodifiableCollection
-6 -1: putAll
-22 -1: offsetByCodePointsImpl
-26 -1: (Ljava/lang/String;[BII)[C
-46 -1: (Ljava/net/URLClassLoader;Ljava/lang/String;)V
-4 -1: /LF=
-9 -1: Bits.java
-30 -1: [Ljava/util/WeakHashMap$Entry;
-19 -1: getLastModifiedTime
-44 -1: [Ljava/lang/Thread$UncaughtExceptionHandler;
-11 -1: getZoneInfo
-6 -1: lookup
-19 -1: MapReduceValuesTask
-18 -1: isVarargsCollector
-38 -1: java/util/jar/JarFile$JarEntryIterator
-11 -1: getJarIndex
-9 -1: getByName
-42 -1: (Ljava/lang/Object;JLjava/lang/Object;JJ)V
-71 -1: (Ljava/lang/invoke/LambdaForm$Name;I)Ljava/lang/invoke/LambdaForm$Name;
-30 -1: java/net/ContentHandlerFactory
-54 -1: (Ljava/lang/Class<*>;I)Ljava/lang/invoke/MethodHandle;
-12 -1: getSignature
-9 -1: parseLong
-25 -1: DEBUG_METHOD_HANDLE_NAMES
-15 -1: runFinalization
-13 -1: 0000000000000
-28 -1: ()[Ljava/lang/reflect/Field;
-37 -1: ([Ljava/lang/ClassValue$Entry<*>;II)V
-13 -1: gcInfoBuilder
-64 -1: (JLjava/util/function/BiFunction;Ljava/util/function/Consumer;)V
-5 -1: cnfe1
-8 -1: setShort
-28 -1: (C)Ljava/lang/StringBuilder;
-44 -1: (Ljava/nio/LongBuffer;)Ljava/nio/LongBuffer;
-70 -1: (Ljava/lang/String;[BIILjava/security/CodeSource;)Ljava/lang/Class<*>;
-33 -1: java/lang/TypeNotPresentException
-5 -1: \n
-20 -1: acquireInterruptibly
-21 -1: (I)Ljava/lang/String;
-24 -1: (Ljava/io/PrintWriter;)V
-16 -1: convertArguments
-32 -1: Ljava/net/MalformedURLException;
-15 -1: linkToInterface
-39 -1: java/lang/Throwable$PrintStreamOrWriter
-10 -1: iso8859_13
-13 -1: hasPrimitives
-10 -1: iso8859_15
-145 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Class<*>;)Ljava/lang/invoke/CallSite;
-8 -1: equalPDs
-28 -1: (Ljava/io/FileDescriptor;J)V
-7 -1: newLine
-43 -1: (Ljava/lang/Class<*>;I)Ljava/lang/Class<*>;
-8 -1: addEntry
-30 -1: java/util/WeakHashMap$EntrySet
-14 -1: USE_OLDMAPPING
-39 -1: (Ljava/io/DataInput;)Ljava/lang/String;
-12 -1: LF_EX_LINKER
-27 -1: java/lang/invoke/MethodType
-23 -1: JavaSecurityAccess.java
-23 -1: isLocalOrAnonymousClass
-19 -1: Expanded arguments:
-18 -1: sun/nio/cs/Unicode
-40 -1: ()Ljava/nio/charset/spi/CharsetProvider;
-23 -1: ([BLjava/lang/String;)V
-7 -1: default
-13 -1: highestOneBit
-9 -1: isDefault
-28 -1: (IF)Ljava/lang/StringBuffer;
-31 -1: ()Ljava/util/ListIterator<TE;>;
-4 -1: base
-23 -1: newPermissionCollection
-7 -1: version
-15 -1: Permission.java
-41 -1: java/lang/invoke/LambdaForm$NamedFunction
-8 -1: isQueued
-24 -1: ([Ljava/lang/Class<*>;)I
-64 -1: java/util/concurrent/ConcurrentHashMap$MapReduceEntriesToIntTask
-16 -1: checkInitialized
-37 -1: java/lang/ClassLoader$ParallelLoaders
-5 -1: ([B)I
-23 -1: Lsun/misc/URLClassPath;
-9 -1: usr_paths
-10 -1: Queue.java
-43 -1: (Ljava/io/File;Ljava/nio/charset/Charset;)V
-64 -1: (Ljava/lang/invoke/MethodTypeForm;)Ljava/lang/invoke/MemberName;
-3 -1: tid
-23 -1: JarIndex-Version: 1.0\n\n
-33 -1: (I)Ljava/nio/charset/CoderResult;
-5 -1: ([B)V
-10 -1: isInstance
-25 -1: unmappableCharacterAction
-11 -1: queueLength
-5 -1: ([B)Z
-10 -1: freeMemory
-47 -1: java/util/ArrayPrefixHelpers$DoubleCumulateTask
-52 -1: (Ljava/util/Map;Ljava/lang/Class;Ljava/lang/Class;)V
-41 -1: Ljava/util/Collections$ReverseComparator;
-16 -1: copyToShortArray
-206 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>([Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;ILjava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;)Z
-38 -1: sun/launcher/LauncherHelper$SizePrefix
-17 -1: ACCESS_PERMISSION
-17 -1: ReverseComparator
-30 -1: ()Ljava/lang/ClassValue$Entry;
-17 -1: AF_PUTSTATIC_INIT
-6 -1: (IIB)I
-19 -1: java/nio/file/Files
-35 -1: (Z)[Ljava/lang/reflect/Constructor;
-20 -1: INVALID_FIELD_OFFSET
-17 -1: initializeHeaders
-10 -1: management
-10 -1: targetType
-61 -1: (Ljava/util/SortedSet;Ljava/lang/Class;)Ljava/util/SortedSet;
-5 -1: ascii
-8 -1: validate
-78 -1: Ljava/util/concurrent/ConcurrentHashMap<Ljava/lang/String;Ljava/lang/Object;>;
-25 -1: sun/nio/cs/UTF_16$Decoder
-36 -1: sun/management/DiagnosticCommandImpl
-24 -1: unmodifiableNavigableMap
-18 -1: canonicalizeScript
-29 -1: Lsun/misc/JavaSecurityAccess;
-74 -1: ([JLjava/util/function/IntToLongFunction;)Ljava/util/function/IntConsumer;
-38 -1: DIRECTIONALITY_LEFT_TO_RIGHT_EMBEDDING
-11 -1: languageTag
-33 -1: java/lang/invoke/VolatileCallSite
-18 -1: setRequestProperty
-6 -1: 0x%02X
-20 -1: (Ljava/lang/Float;)I
-35 -1: (Ljava/nio/charset/CoderResult$1;)V
-24 -1: (Ljava/lang/Object;JJB)V
-21 -1: synchronizedSortedSet
-59 -1: (Ljava/util/function/ToLongFunction;)Ljava/util/Comparator;
-30 -1: av.length == arity: av.length=
-7 -1: $VALUES
-27 -1: RandomNumberGeneratorHolder
-3 -1: tlr
-43 -1: java/util/ArraysParallelSortHelpers$FJFloat
-28 -1: ()[Ljava/io/File$PathStatus;
-26 -1: invalid extra field length
-13 -1: getExtensions
-7 -1: PARAMS0
-7 -1: PARAMS1
-30 -1: [Ljava/lang/invoke/MemberName;
-7 -1: PARAMS2
-31 -1: java/lang/AbstractStringBuilder
-161 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/BiFunction;Ljava/util/function/Consumer;)V
-4 -1: repl
-19 -1: ()Ljava/lang/Class;
-24 -1: BufferedInputStream.java
-9 -1: sizeCache
-8 -1: READLINK
-9 -1: metaIndex
-18 -1: getLocalizedObject
-6 -1: filter
-58 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;I)V
-140 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;[Ljava/lang/Object;)Ljava/lang/invoke/MemberName;
-24 -1: Ljava/util/HashMap$Node;
-35 -1: (Lsun/nio/cs/FastCharsetProvider;)V
-8 -1: dispatch
-19 -1: sun.stderr.encoding
-130 -1: (Ljava/util/List<Ljava/util/Locale$LanguageRange;>;Ljava/util/Collection<Ljava/lang/String;>;)Ljava/util/List<Ljava/lang/String;>;
-51 -1: Ljava/util/concurrent/ConcurrentHashMap$ValuesView;
-30 -1: sun.reflect.inflationThreshold
-20 -1: MutableCallSite.java
-26 -1: invokeWithArgumentsTracing
-7 -1: getters
-38 -1: ()[Ljava/lang/reflect/TypeVariable<*>;
-46 -1: ([DLjava/util/function/DoubleBinaryOperator;)V
-5 -1: klass
-13 -1: publicMethods
-37 -1: ()[Ljava/lang/reflect/Constructor<*>;
-126 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle;
-6 -1: FJLong
-20 -1: canBeStaticallyBound
-17 -1: getTimezoneOffset
-9 -1: ALL_TYPES
-3 -1: toV
-8 -1: packages
-15 -1: codePointBefore
-10 -1: getCountry
-13 -1: getDSTSavings
-100 -1: (Ljava/io/InputStream;Ljava/lang/Object;Ljava/nio/charset/CharsetDecoder;)Lsun/nio/cs/StreamDecoder;
-50 -1: java/util/ArraysParallelSortHelpers$FJFloat$Sorter
-20 -1: hasNonVoidPrimitives
-7 -1: syncAll
-41 -1: domain dump all domains in context
-59 -1: Ljava/util/Hashtable<Ljava/lang/Integer;Lsun/misc/Signal;>;
-16 -1: ForEachEntryTask
-18 -1: vminfoIsConsistent
-26 -1: (ZLjava/util/Comparator;)V
-9 -1: Lock.java
-31 -1: Lsun/reflect/ReflectionFactory;
-8 -1: (I[BII)I
-23 -1: doesExtendFXApplication
-87 -1: java/util/concurrent/atomic/AtomicReferenceFieldUpdater$AtomicReferenceFieldUpdaterImpl
-11 -1: windows-31j
-28 -1: sun/misc/URLClassPath$Loader
-17 -1: getEntryAfterMiss
-47 -1: ([Ljava/lang/reflect/Field;Ljava/lang/String;)J
-44 -1: Ljava/util/List<Ljava/security/Permission;>;
-10 -1: openStream
-31 -1: Ljava/net/UnknownHostException;
-19 -1: bad reference kind
-29 -1: ()Ljava/nio/MappedByteBuffer;
-9 -1: H_UPALPHA
-37 -1: (Ljava/util/function/UnaryOperator;)V
-25 -1: FAKE_METHOD_HANDLE_INVOKE
-4 -1: peek
-25 -1: java/util/Hashtable$Entry
-18 -1: getMemberRefInfoAt
-37 -1: Ljava/util/WeakHashMap$Entry<TK;TV;>;
-14 -1: resolvedHandle
-27 -1: ()Ljava/util/Iterator<TV;>;
-61 -1: Ljava/util/Map<Ljava/lang/String;Ljava/lang/reflect/Method;>;
-6 -1: static
-50 -1: (Ljava/net/URLClassLoader;)Lsun/misc/URLClassPath;
-38 -1: (Ljava/lang/Class;)[Ljava/lang/Object;
-41 -1: (Ljava/util/SortedSet;Ljava/lang/Class;)V
-41 -1: java/lang/invoke/WrongMethodTypeException
-5 -1: group
-10 -1: readObject
-13 -1: getParentFile
-14 -1: daylightSaving
-15 -1: eagerValidation
-36 -1: (Ljava/io/File;)Lsun/misc/MetaIndex;
-18 -1: reduceEntriesToInt
-15 -1: INITIAL_ENTRIES
-18 -1: AtomicInteger.java
-7 -1: .length
-128 -1: Ljava/nio/Buffer;Ljava/lang/Comparable<Ljava/nio/CharBuffer;>;Ljava/lang/Appendable;Ljava/lang/CharSequence;Ljava/lang/Readable;
-6 -1: asList
-21 -1: unmodifiableSortedSet
-22 -1: ([B)Ljava/util/BitSet;
-5 -1: check
-64 -1: (Ljava/util/jar/JarFile;Lsun/misc/MetaIndex;)Lsun/misc/JarIndex;
-35 -1: ()Ljava/nio/charset/CharsetEncoder;
-4 -1: oome
-25 -1: ()Lsun/misc/URLClassPath;
-27 -1: (Ljava/io/FilePermission;)V
-29 -1: IllegalArgumentException.java
-17 -1: jvmSpecialVersion
-21 -1: Ljava/util/ArrayList;
-13 -1: packagePrefix
-27 -1: (Ljava/io/FilePermission;)Z
-11 -1: canonicalID
-82 -1: Ljava/lang/Object;Ljava/util/Comparator<Ljava/lang/String;>;Ljava/io/Serializable;
-24 -1: java.launcher.opt.footer
-13 -1: NativeLibrary
-37 -1: (Ljava/lang/String;J)Ljava/lang/Long;
-16 -1: longBitsToDouble
-6 -1: getKey
-22 -1: (JLjava/lang/String;)V
-14 -1: ensureCapacity
-69 -1: (Ljava/lang/Object;Ljava/util/function/BiFunction;)Ljava/lang/Object;
-22 -1: java/lang/Thread$State
-50 -1: ()Ljava/util/Iterator<Ljava/nio/charset/Charset;>;
-4 -1: 7bit
-46 -1: (Ljava/lang/Class<+Ljava/lang/ClassLoader;>;)Z
-76 -1: (ILjava/util/List<Ljava/lang/Class<*>;>;)[Ljava/lang/invoke/LambdaForm$Name;
-3 -1: ttb
-12 -1: UTF_16LE_BOM
-9 -1: remainder
-40 -1: ()Lsun/reflect/generics/visitor/Reifier;
-22 -1: [Ljava/lang/Throwable;
-17 -1: EMPTY_ENUMERATION
-13 -1: erasedInvoker
-46 -1: Ljava/nio/charset/IllegalCharsetNameException;
-10 -1: UnicodeBig
-53 -1: ()Ljava/util/Map<Ljava/io/File;Lsun/misc/MetaIndex;>;
-12 -1: MAX_EXPONENT
-10 -1: Enumerator
-15 -1: charset decoder
-11 -1: AF_GETFIELD
-12 -1: | getInvoker
-74 -1: (Ljava/nio/ByteBuffer;Ljava/nio/CharBuffer;)Ljava/nio/charset/CoderResult;
-14 -1: toUnsignedLong
-46 -1: java/lang/invoke/MethodHandleNatives$Constants
-29 -1: java version "1.8.0-internal"
-21 -1: ([Ljava/lang/Class;)I
-16 -1: UPPERCASE_LETTER
-22 -1: newConstantPerfCounter
-6 -1: signum
-9 -1: getField0
-38 -1: java/nio/charset/CoderMalfunctionError
-21 -1: [Ljava/lang/Runnable;
-11 -1: putIfAbsent
-30 -1: java/util/Collections$EmptySet
-22 -1: (I)[Ljava/lang/String;
-34 -1: Ljava/security/SecurityPermission;
-49 -1: ([Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
-190 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$ReduceEntriesTask;Ljava/util/function/BiFunction;)V
-22 -1: Not an annotation type
-34 -1: java/io/ObjectInputStream$GetField
-50 -1: (Lsun/reflect/FieldInfo;)Ljava/lang/reflect/Field;
-32 -1: Ljava/lang/NoSuchFieldException;
-70 -1: (Ljava/lang/invoke/MethodHandle;[Ljava/lang/Object;)Ljava/lang/Object;
-9 -1: mergeSort
-77 -1: (ITK;TV;Ljava/util/HashMap$Node<TK;TV;>;)Ljava/util/HashMap$TreeNode<TK;TV;>;
-21 -1: sun/nio/cs/ISO_8859_1
-8 -1: DST_MASK
-21 -1: Ljava/lang/Throwable;
-108 -1: (Ljava/lang/ref/SoftReference<Ljava/lang/Class$ReflectionData<TT;>;>;I)Ljava/lang/Class$ReflectionData<TT;>;
-32 -1: java/util/Arrays$LegacyMergeSort
-59 -1: ()[Ljava/lang/reflect/TypeVariable<Ljava/lang/Class<TT;>;>;
-16 -1: parseUnsignedInt
-36 -1: ([D)Ljava/util/Spliterator$OfDouble;
-26 -1: SPECIFY_HANDLER_PERMISSION
-13 -1: primitiveType
-17 -1: threadStartFailed
-21 -1: (J)Ljava/lang/String;
-23 -1: setClassAssertionStatus
-28 -1: java/util/Hashtable$EntrySet
-28 -1: Non-positive maxBytesPerChar
-19 -1: getApplicationClass
-14 -1: SentinelHolder
-15 -1: staticFieldBase
-25 -1: setDefaultRequestProperty
-66 -1: java/util/concurrent/ConcurrentHashMap$ForEachTransformedValueTask
-8 -1: threadID
-9 -1: getFields
-15 -1: LineNumberTable
-38 -1: java/util/Collections$CheckedSortedSet
-14 -1: jdkBuildNumber
-6 -1: divide
-46 -1: (Ljava/io/BufferedWriter;Ljava/lang/String;Z)V
-20 -1: java/lang/Terminator
-92 -1: (Lsun/misc/URLClassPath$JarLoader;Ljava/lang/String;Ljava/net/URL;Ljava/util/jar/JarEntry;)V
-6 -1: force0
-10 -1: getThreads
-34 -1: java/util/IllformedLocaleException
-115 -1: (Ljava/lang/String;Lsun/reflect/generics/factory/GenericsFactory;)Lsun/reflect/generics/repository/FieldRepository;
-9 -1: testFlags
-11 -1: getLanguage
-36 -1: java/util/function/IntBinaryOperator
-12 -1: Suppressed:
-10 -1: isMandated
-23 -1: MethodAccessorImpl.java
-28 -1: (Ljava/util/zip/ZipEntry;)[B
-27 -1: Ljava/util/Hashtable$Entry;
-5 -1: table
-10 -1: Short.java
-19 -1: ReferenceQueue.java
-8 -1: setTabAt
-26 -1: ()Lsun/invoke/empty/Empty;
-53 -1: (Ljava/lang/Class;Ljava/lang/String;)Ljava/lang/Enum;
-74 -1: (ILjava/lang/Object;)Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
-19 -1: changeParameterType
-61 -1: Ljava/util/Map<Ljava/lang/String;Ljava/security/Permission;>;
-23 -1: (Ljava/lang/Object;IF)V
-32 -1: (I)Ljava/util/ListIterator<TE;>;
-6 -1: unread
-12 -1: isSubclassOf
-6 -1: (JJJ)V
-3 -1: Key
-105 -1: (Ljava/util/HashMap<TK;TV;>;[Ljava/util/HashMap$Node<TK;TV;>;ITK;TV;)Ljava/util/HashMap$TreeNode<TK;TV;>;
-14 -1: x-utf-16le-bom
-22 -1: ()Ljava/nio/IntBuffer;
-104 -1: (Ljava/lang/Class;ILjava/lang/Class;Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle;
-21 -1: removeFirstOccurrence
-21 -1: sun/misc/DoubleConsts
-23 -1: ()Ljava/util/SortedSet;
-11 -1: getManEntry
-23 -1: URI is not hierarchical
-7 -1: replace
-16 -1: getDisplayScript
-11 -1: ISO_8859-15
-16 -1: permuteArguments
-5 -1: (JI)C
-41 -1: Error decoding percent encoded characters
-22 -1: ([I)Ljava/lang/String;
-31 -1: java/lang/management/ThreadInfo
-9 -1: useCaches
-22 -1: withInternalMemberName
-5 -1: (JI)I
-5 -1: (JI)J
-67 -1: <E:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Collection<TE;>;
-95 -1: (Ljava/util/jar/JarFile;[Ljava/security/CodeSource;)Ljava/util/Enumeration<Ljava/lang/String;>;
-7 -1: release
-56 -1: (Ljava/lang/Object;Ljava/lang/String;)Ljava/lang/String;
-5 -1: (JI)V
-46 -1: (Ljava/util/Iterator;I)Ljava/util/Spliterator;
-18 -1: verifyMemberAccess
-9 -1: warning:
-23 -1: java/lang/reflect/Field
-67 -1: (Ljava/lang/String;Lsun/reflect/generics/factory/GenericsFactory;)V
-10 -1: SizePrefix
-15 -1: setJavaIOAccess
-6 -1: (JI)[B
-10 -1: ST_FLUSHED
-10 -1: resolution
-9 -1: ST_CODING
-16 -1: sun/misc/Cleaner
-21 -1: (Ljava/lang/Class;)[B
-18 -1: WeakReference.java
-41 -1: (Ljava/util/List;Ljava/util/Comparator;)V
-18 -1: printPropertyValue
-3 -1: 813
-22 -1: setRunFinalizersOnExit
-4 -1: init
-44 -1: ()Ljava/util/Iterator<Ljava/nio/file/Path;>;
-3 -1: 819
-12 -1: listIterator
-8 -1: , arity=
-24 -1: (Ljava/util/ArrayList;)I
-49 -1: (IJLjava/io/FileDescriptor;Ljava/lang/Runnable;)V
-10 -1: principals
-17 -1: x-ISO-2022-CN-CNS
-22 -1: (Ljava/lang/Object;F)V
-14 -1: setReadTimeout
-19 -1: getProtectionDomain
-13 -1: pathSeparator
-12 -1: getAndSetInt
-58 -1: (Ljava/util/List;Ljava/util/Collection;)Ljava/util/Locale;
-11 -1: setWritable
-4 -1: perf
-50 -1: ()Ljava/util/concurrent/ConcurrentHashMap<TK;TV;>;
-6 -1: LOCTIM
-6 -1: status
-11 -1: replaceName
-52 -1: (Ljava/lang/CharSequence;II)Ljava/lang/StringBuffer;
-9 -1: nextToken
-13 -1: dropArguments
-20 -1: RECOGNIZED_MODIFIERS
-14 -1: getInputStream
-9 -1: readFully
-25 -1: (CLjava/nio/CharBuffer;)I
-24 -1: sun/misc/PathPermissions
-10 -1: malformedN
-9 -1: n is null
-19 -1: instanceof Double:
-13 -1: markSupported
-26 -1: fromMethodDescriptorString
-43 -1: [Ljava/util/concurrent/locks/ReentrantLock;
-17 -1: parseUnsignedLong
-33 -1: Lsun/misc/URLClassPath$JarLoader;
-26 -1: (Ljava/io/OutputStream;I)V
-6 -1: L_DASH
-17 -1: EmptyNavigableMap
-19 -1: CharsetDecoder.java
-18 -1: makeDynamicInvoker
-12 -1: URLUtil.java
-27 -1: ()Ljava/util/Iterator<TT;>;
-9 -1: initTable
-11 -1: getFragment
-7 -1: isLower
-20 -1: getMethodOrFieldType
-29 -1: java/util/function/BiFunction
-10 -1: access$700
-3 -1: 850
-7 -1: UTC2037
-43 -1: java/util/ArraysParallelSortHelpers$FJShort
-9 -1: toSTZTime
-10 -1: access$702
-3 -1: 852
-8 -1: hashCode
-3 -1: 855
-44 -1: (Ljava/lang/ThreadLocal;Ljava/lang/Object;)V
-3 -1: 857
-3 -1: 858
-5 -1: erase
-55 -1: ()Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;
-47 -1: (Ljava/util/Iterator;JI)Ljava/util/Spliterator;
-38 -1: Ljava/nio/charset/spi/CharsetProvider;
-22 -1: can't deserialize enum
-13 -1: LF_EX_INVOKER
-18 -1: java/text/Collator
-18 -1: Zero length string
-49 -1: <T:Ljava/lang/Object;>()Ljava/util/Iterator<TT;>;
-5 -1: amd64
-12 -1: getNameCount
-7 -1: inCheck
-52 -1: (Ljava/util/concurrent/ConcurrentHashMap$TreeNode;)V
-53 -1: (ILjava/lang/CharSequence;II)Ljava/lang/StringBuffer;
-21 -1: java/util/WeakHashMap
-8 -1: throws
-52 -1: (Ljava/util/concurrent/ConcurrentHashMap$TreeNode;)Z
-55 -1: Ljava/lang/ref/SoftReference<Ljava/util/jar/Manifest;>;
-16 -1: emptyEnumeration
-3 -1: 862
-89 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Object;ILjava/lang/Class;)Ljava/util/List;
-3 -1: 866
-55 -1: Lsun/reflect/generics/repository/ConstructorRepository;
-35 -1: (Ljava/lang/ref/ReferenceQueue$1;)V
-33 -1: java/util/Collections$CheckedList
-18 -1: prefetchReadStatic
-7 -1: (JI[I)I
-78 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;)Ljava/lang/ThreadLocal$ThreadLocalMap;
-7 -1: ordinal
-22 -1: FilterInputStream.java
-26 -1: java/util/zip/ZipConstants
-28 -1: JVM cannot find invoker for
-43 -1: sun/reflect/generics/parser/SignatureParser
-51 -1: (Ljava/lang/invoke/MethodType;[Ljava/lang/Object;)V
-73 -1: (Ljava/util/function/ToIntFunction;Ljava/lang/Object;Ljava/lang/Object;)I
-17 -1: StringBuffer.java
-62 -1: ([Ljava/lang/Object;Ljava/lang/StringBuilder;Ljava/util/Set;)V
-6 -1: equals
-9 -1: formatter
-3 -1: 874
-35 -1: newGetShortIllegalArgumentException
-74 -1: (Ljava/nio/CharBuffer;Ljava/nio/ByteBuffer;)Ljava/nio/charset/CoderResult;
-3 -1: ucp
-60 -1: ([Ljava/lang/ClassValue$Entry;I)Ljava/lang/ClassValue$Entry;
-6 -1: create
-17 -1: makeReinvokerForm
-18 -1: csisolatincyrillic
-15 -1: incrementAndGet
-24 -1: maybeInstantiateVerifier
-33 -1: ()Ljava/nio/channels/FileChannel;
-6 -1: class
-16 -1: getAnnotatedType
-43 -1: (Ljava/lang/reflect/Type;)Ljava/lang/Class;
-9 -1: HASH_BITS
-12 -1: placeInCache
-38 -1: java/util/Collections$SynchronizedList
-89 -1: (Ljava/net/URL;Ljava/util/jar/JarFile;Ljava/util/jar/JarEntry;)Ljava/security/CodeSource;
-22 -1: (Ljava/lang/String;I)B
-20 -1: Ljava/util/TimeZone;
-16 -1: sun.java.command
-28 -1: java/util/WeakHashMap$Values
-10 -1: X-UTF-16BE
-22 -1: (Ljava/lang/String;I)I
-26 -1: java/nio/DirectCharBufferS
-99 -1: (Ljava/lang/String;[BIILjava/lang/ClassLoader;Ljava/security/ProtectionDomain;)Ljava/lang/Class<*>;
-22 -1: (Ljava/lang/String;I)J
-26 -1: java/nio/DirectCharBufferU
-54 -1: (Ljava/util/function/Supplier;)Ljava/lang/ThreadLocal;
-21 -1: java/util/AbstractSet
-37 -1: (Ljava/lang/String;)Ljava/lang/Short;
-36 -1: Ljava/nio/charset/CoderResult$Cache;
-22 -1: (Ljava/lang/String;I)S
-15 -1: Ljava/util/Map;
-59 -1: (Ljava/lang/reflect/Type;)Ljava/lang/reflect/AnnotatedType;
-22 -1: (Ljava/lang/String;I)V
-10 -1: getAddress
-25 -1: java/nio/DirectIntBufferS
-11 -1: IMPL_LOOKUP
-3 -1: uee
-7 -1: addTime
-37 -1: sun/security/action/GetPropertyAction
-25 -1: java/nio/DirectIntBufferU
-21 -1: javaUtilZipFileAccess
-34 -1: java/util/Collections$CheckedQueue
-11 -1: readResolve
-22 -1: (Ljava/lang/String;I)Z
-11 -1: findVirtual
-63 -1: (Ljava/lang/String;Ljava/lang/String;)Lsun/security/util/Debug;
-22 -1: getDeclaredAnnotations
-16 -1: Collections.java
-18 -1: invalid entry size
-49 -1: java/util/concurrent/ConcurrentHashMap$TableStack
-32 -1: java/util/AbstractSequentialList
-4 -1: int0
-16 -1: MAXIMUM_CAPACITY
-53 -1: ()Ljava/util/concurrent/ConcurrentHashMap$KeySetView;
-4 -1: int1
-4 -1: int2
-4 -1: int3
-119 -1: (Ljava/lang/Class;Ljava/lang/String;[Ljava/lang/Class;Ljava/lang/Class;[Ljava/lang/Class;I)Lsun/reflect/MethodAccessor;
-7 -1: variant
-39 -1: Lsun/reflect/annotation/AnnotationType;
-11 -1: arrayOffset
-24 -1: ()Ljava/util/LinkedList;
-31 -1: java/lang/ClassCircularityError
-17 -1: java/lang/Package
-10 -1: ccsid00858
-27 -1: java/io/ExpiringCache$Entry
-16 -1: newFieldAccessor
-67 -1: (Ljava/lang/Object;Ljava/util/function/Function;)Ljava/lang/Object;
-99 -1: Lsun/reflect/generics/repository/GenericDeclRepository<Lsun/reflect/generics/tree/ClassSignature;>;
-53 -1: (Ljava/lang/invoke/MethodHandle;[Ljava/lang/Object;)V
-53 -1: Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
-58 -1: <T:Ljava/lang/Object;>([TT;)Ljava/util/stream/Stream<TT;>;
-54 -1: (Ljava/lang/CharSequence;Ljava/text/Normalizer$Form;)Z
-8 -1: Kerberos
-29 -1: ()Ljava/nio/channels/Channel;
-12 -1: java_version
-45 -1: (Lsun/reflect/DelegatingMethodAccessorImpl;)V
-10 -1: canConvert
-136 -1: (Ljava/lang/StringBuffer;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;)V
-26 -1: getDayOfWeekDateOnOrBefore
-7 -1: INVALID
-10 -1: TERMINATED
-41 -1: Ljava/security/cert/CertificateException;
-74 -1: (Ljava/lang/String;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/String;
-30 -1: [Ljava/lang/invoke/MethodType;
-13 -1: getMethodName
-7 -1: Factory
-34 -1: (Ljava/util/function/BiConsumer;)V
-11 -1: unlinkFirst
-37 -1: lambda$getDeclaredAnnotationsByType$0
-77 -1: (Ljava/nio/ByteBuffer;ILjava/nio/CharBuffer;II)Ljava/nio/charset/CoderResult;
-20 -1: java/util/ArrayDeque
-65 -1: (Ljava/lang/ThreadGroup;Ljava/lang/Runnable;Ljava/lang/String;J)V
-49 -1: (Ljava/util/ArrayDeque;Ljava/util/ArrayDeque$1;)V
-22 -1: (J)Ljava/time/Instant;
-17 -1: URLClassPath.java
-6 -1: 8859_1
-25 -1: stopRemoteManagementAgent
-6 -1: 8859_2
-17 -1: containsNullValue
-6 -1: 8859_4
-6 -1: 8859_5
-26 -1: (Ljava/nio/ByteBuffer;IC)V
-76 -1: (Ljava/lang/Runnable;Ljava/security/AccessControlContext;)Ljava/lang/Thread;
-6 -1: 8859_7
-6 -1: 8859_9
-8 -1: setHours
-9 -1: File.java
-21 -1: isIdentifierIgnorable
-5 -1: ([C)I
-4 -1: (B)I
-10 -1: codesource
-77 -1: ([Ljava/net/URL;Ljava/lang/ClassLoader;Ljava/security/AccessControlContext;)V
-4 -1: (B)J
-6 -1: isFair
-30 -1: java/lang/NullPointerException
-10 -1: IMPL_NAMES
-13 -1: Runnable.java
-26 -1: Ill-formed extension key:
-17 -1: ()[Ljava/io/File;
-18 -1: javaSecurityAccess
-16 -1: equalsIgnoreCase
-4 -1: (B)V
-5 -1: ([C)V
-25 -1: Ljava/io/FileInputStream;
-14 -1: trackJavaUsage
-20 -1: Ljava/io/FileSystem;
-10 -1: iso_8859_1
-4 -1: (B)Z
-30 -1: java/lang/NoClassDefFoundError
-152 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/HashMap$TreeNode<TK;TV;>;Ljava/util/HashMap$TreeNode<TK;TV;>;)Ljava/util/HashMap$TreeNode<TK;TV;>;
-19 -1: java/lang/Cloneable
-55 -1: ([Ljava/lang/Object;Ljava/util/function/IntFunction;I)V
-27 -1: (Ljava/nio/ByteBuffer;IJZ)V
-21 -1: ()Lsun/misc/JarIndex;
-72 -1: ([Ljava/security/CodeSource;)Ljava/util/Enumeration<Ljava/lang/String;>;
-64 -1: (Ljava/util/Collection;Ljava/util/Comparator;)Ljava/lang/Object;
-20 -1: invalid entry crc-32
-9 -1: BASECOUNT
-29 -1: java/security/BasicPermission
-52 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/io/File;
-7 -1: ([B[B)Z
-17 -1: EMPTY_ELEMENTDATA
-61 -1: (Ljava/security/PrivilegedExceptionAction;)Ljava/lang/Object;
-49 -1: (ILjava/lang/Class;)Ljava/lang/invoke/MethodType;
-29 -1: sun/reflect/MagicAccessorImpl
-121 -1: (Ljava/lang/String;Lsun/reflect/generics/factory/GenericsFactory;)Lsun/reflect/generics/repository/ConstructorRepository;
-6 -1: ([II)I
-40 -1: (Ljava/lang/String;I)Ljava/lang/Integer;
-25 -1: java.content.handler.pkgs
-63 -1: ()Ljava/util/Set<Ljava/util/Map$Entry<Ljava/lang/String;TV;>;>;
-13 -1: parameterList
-6 -1: rebind
-16 -1: isSuperInterface
-6 -1: ([II)V
-14 -1: currentRuntime
-9 -1: BA_EXISTS
-15 -1: END_PUNCTUATION
-15 -1: no such method
-19 -1: getAndVerifyPackage
-4 -1: wrap
-24 -1: checkAwtEventQueueAccess
-7 -1: ibm-437
-4 -1: open
-47 -1: (Ljava/nio/ByteBuffer;[BI)Ljava/nio/ByteBuffer;
-21 -1: ADDRESS_BITS_PER_WORD
-13 -1: isConstructor
-12 -1: getUseCaches
-27 -1: sun/util/locale/LocaleUtils
-4 -1: koi8
-23 -1: getParameterAnnotations
-9 -1: providers
-57 -1: ([Ljava/lang/Object;Ljava/util/function/BinaryOperator;)V
-24 -1: Lsun/misc/JavaNetAccess;
-22 -1: ([J)Ljava/lang/String;
-7 -1: p-1022$
-6 -1: isType
-63 -1: Ljava/util/Map<Ljava/lang/String;Lsun/util/calendar/ZoneInfo;>;
-21 -1: pageAlignDirectMemory
-18 -1: getManifestDigests
-37 -1: [Ljava/lang/reflect/AccessibleObject;
-7 -1: decrypt
-54 -1: (Lsun/misc/URLClassPath$JarLoader;)Ljava/util/HashMap;
-32 -1: lambda$comparingByKey$bbdbfea9$1
-21 -1: hasGenericInformation
-31 -1: java/nio/charset/CharsetEncoder
-15 -1: setTargetNormal
-3 -1: ulp
-18 -1: argumentTypesMatch
-12 -1: getDayOfYear
-8 -1: closeAll
-76 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/lang/ref/SoftReference<TV;>;
-6 -1: concat
-9 -1: getLongAt
-16 -1: hasBeenFinalized
-32 -1: [Ljava/util/Hashtable$Entry<**>;
-23 -1: CheckedRandomAccessList
-106 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)Ljava/net/URI;
-21 -1: defineClassInPackage.
-11 -1: ([III[III)V
-8 -1: toZoneId
-34 -1: SUBCLASS_IMPLEMENTATION_PERMISSION
-55 -1: java/util/concurrent/atomic/AtomicReferenceFieldUpdater
-8 -1: isDirect
-10 -1: ALL_ACCESS
-12 -1: isRegistered
-29 -1: ForEachTransformedMappingTask
-5 -1: LIJFD
-23 -1: (Ljava/util/TimeZone;)V
-23 -1: (Ljava/util/TimeZone;)Z
-20 -1: java/lang/Appendable
-29 -1: Lsun/util/calendar/Gregorian;
-9 -1: charValue
-8 -1: ONE_HOUR
-38 -1: (Ljava/util/Locale;)Ljava/lang/String;
-7 -1: script=
-10 -1: X-UTF-16LE
-7 -1: ENTRIES
-6 -1: detach
-38 -1: certpath PKIX CertPathBuilder and
-14 -1: setLanguageTag
-13 -1: isAlphaString
-13 -1: interpretName
-9 -1: dayOfWeek
-88 -1: (Ljava/lang/Class;ZLjava/lang/String;Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/List;
-91 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;)Ljava/lang/invoke/MethodHandle;
-13 -1: addTypeString
-17 -1: VectorSpliterator
-12 -1: MILLISECONDS
-6 -1: CENCOM
-10 -1: KeySetView
-18 -1: getTargetException
-7 -1: H_ALPHA
-32 -1: sun/util/locale/BaseLocale$Cache
-25 -1: [Ljava/lang/CharSequence;
-7 -1: Builder
-4 -1: left
-19 -1: BootClassPathHolder
-12 -1: publicFields
-11 -1: windows-437
-9 -1: EMPTY_SET
-26 -1: GET_STACK_TRACE_PERMISSION
-6 -1: copyOf
-14 -1: aliases_IBM737
-9 -1: writeLong
-35 -1: (JLjava/util/concurrent/TimeUnit;)Z
-70 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction<Ljava/lang/String;>;
-22 -1: getAnnotatedReturnType
-41 -1: (Ljava/lang/String;[BII)Ljava/lang/Class;
-8 -1: ,maxpri=
-29 -1: handleParameterNumberMismatch
-26 -1: ts timestamping
-11 -1: checkListen
-10 -1: SourceFile
-44 -1: (Ljava/lang/String;)Ljava/util/jar/JarEntry;
-17 -1: weakCompareAndSet
-9 -1: timestamp
-21 -1: (Z)Ljava/lang/String;
-12 -1: doneWithMeta
-20 -1: makeCollectArguments
-52 -1: (JLjava/util/function/BiFunction;)Ljava/lang/Object;
-10 -1: searchKeys
-48 -1: sun/reflect/SerializationConstructorAccessorImpl
-69 -1: (Ljava/lang/reflect/Constructor<*>;)Lsun/reflect/ConstructorAccessor;
-19 -1: ()Lsun/misc/Unsafe;
-11 -1: deepEquals0
-7 -1: GB18030
-13 -1: ValueIterator
-75 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)V
-28 -1: java/util/PropertyPermission
-6 -1: CENCRC
-3 -1: url
-3 -1: L_L
-19 -1: Certificate too big
-33 -1: sun/reflect/DelegatingClassLoader
-16 -1: lambda$stream$57
-11 -1: BitSet.java
-13 -1: sun/misc/Perf
-26 -1: Ljava/util/SimpleTimeZone;
-7 -1: (BBBB)I
-24 -1: sun/misc/FloatingDecimal
-21 -1: sun/util/PreHashedMap
-8 -1: utf-16be
-11 -1: isInherited
-83 -1: (Ljava/util/Properties;Ljava/io/OutputStream;Ljava/lang/String;Ljava/lang/String;)V
-52 -1: (Ljava/lang/Class;Ljava/security/ProtectionDomain;)V
-11 -1: getDoOutput
-18 -1: asVarargsCollector
-22 -1: NoSuchMethodError.java
-18 -1: getStackTraceDepth
-30 -1: (Ljava/io/File;)Ljava/net/URL;
-15 -1: CURRENCY_SYMBOL
-24 -1: Lsun/misc/JavaNioAccess;
-6 -1: NATIVE
-22 -1: Lsun/misc/PerfCounter;
-63 -1: java/util/concurrent/ConcurrentHashMap$MapReduceValuesToIntTask
-30 -1: less than Character.MIN_RADIX
-17 -1: isCallerSensitive
-8 -1: shutdown
-11 -1: STATE_GREEN
-4 -1: next
-10 -1: tryPresize
-16 -1: CONSTRUCTOR_NAME
-3 -1: MAY
-21 -1: java.security.manager
-20 -1: Lsun/misc/Contended;
-16 -1: DISPLAY_LANGUAGE
-6 -1: KeySet
-9 -1: getScript
-3 -1: utc
-17 -1: TRACE_INTERPRETER
-39 -1: (Ljava/lang/Object;I)Ljava/lang/String;
-19 -1: getFieldAtIfLoaded0
-15 -1: methodFilterMap
-54 -1: Ljava/util/Map<Ljava/lang/String;Ljava/lang/Boolean;>;
-45 -1: java/security/cert/Certificate$CertificateRep
-43 -1: (Ljava/lang/String;)Lsun/util/calendar/Era;
-34 -1: java/security/cert/X509Certificate
-19 -1: versionsInitialized
-11 -1: isDirectory
-14 -1: aliases_IBM775
-38 -1: (Ljava/util/function/Consumer<-TE;>;)V
-38 -1: (Ljava/lang/String;)Ljava/util/Locale;
-40 -1: (Ljava/lang/String;Z)Lsun/misc/Resource;
-14 -1: setDefaultZone
-14 -1: highResCounter
-78 -1: (Ljava/lang/ClassValue$Version;Ljava/lang/Object;)Ljava/lang/ClassValue$Entry;
-16 -1: defaultUseCaches
-40 -1: (Ljava/util/zip/ZipFile;)Ljava/util/Map;
-24 -1: isSupplementaryCodePoint
-15 -1: ISO_8859_1.java
-13 -1: multiplyExact
-126 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Lsun/util/locale/LocaleExtensions;)Ljava/util/Locale;
-8 -1: classMap
-8 -1: wildcard
-19 -1: getSimpleBinaryName
-17 -1: illegal signature
-14 -1: == basicType(
-17 -1: ZipConstants.java
-32 -1: [Ljava/lang/VirtualMachineError;
-27 -1: ()Ljava/util/stream/Stream;
-24 -1: (Ljava/lang/Exception;)V
-21 -1: java/util/Enumeration
-13 -1: newSetFromMap
-8 -1: getenv.*
-20 -1: sun/management/Agent
-21 -1: sun/nio/cs/US_ASCII$1
-7 -1: comment
-15 -1: appendAuthority
-11 -1: hasWrappers
-10 -1: dstOffset
-24 -1: sun/reflect/ConstantPool
-75 -1: (Ljava/util/jar/JarFile;[Ljava/security/CodeSource;)Ljava/util/Enumeration;
-52 -1: (Ljava/util/jar/JarFile;)Ljava/util/jar/JarVerifier;
-70 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction<Ljava/lang/Object;>;
-14 -1: previousSetBit
-17 -1: AF_GETSTATIC_INIT
-15 -1: ArrayDeque.java
-7 -1: boolean
-25 -1: (I)Ljava/math/BigInteger;
-146 -1: (Ljava/lang/ref/ReferenceQueue<Ljava/lang/Class<*>;>;Ljava/util/concurrent/ConcurrentMap<+Ljava/lang/ref/WeakReference<Ljava/lang/Class<*>;>;*>;)V
-8 -1: getClass
-8 -1: user.dir
-6 -1: VALUES
-5 -1: raise
-39 -1: (JLjava/util/function/Consumer<-TV;>;)V
-107 -1: <T:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater<TT;TV;>;
-5 -1: print
-8 -1: readChar
-55 -1: (JLjava/util/TimeZone;)Lsun/util/calendar/CalendarDate;
-56 -1: java/util/concurrent/ConcurrentHashMap$MapReduceKeysTask
-60 -1: Ljava/lang/Number;Ljava/lang/Comparable<Ljava/lang/Double;>;
-102 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/SortedMap<TK;TV;>;)Ljava/util/SortedMap<TK;TV;>;
-23 -1: printModifiersIfNonzero
-14 -1: getterFunction
-15 -1: ISO-10646-UCS-2
-14 -1: canonizeString
-13 -1: getTotalSpace
-24 -1: synchronizedNavigableSet
-100 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedAction<TT;>;Ljava/security/AccessControlContext;)TT;
-4 -1: ioex
-24 -1: ()Ljava/nio/FloatBuffer;
-14 -1: toBinaryString
-7 -1: Segment
-34 -1: ()Lsun/misc/JavaUtilZipFileAccess;
-17 -1: setTargetVolatile
-22 -1: (Ljava/util/List<*>;)V
-51 -1: (ILjava/lang/CharSequence;)Ljava/lang/StringBuffer;
-22 -1: (Ljava/util/List<*>;)Z
-5 -1: (FI)F
-11 -1: parseMethod
-8 -1: Compiled
-19 -1: java/util/SortedMap
-7 -1: setByte
-12 -1: getFieldType
-8 -1: pageSize
-14 -1: getCallerClass
-9 -1: ensureObj
-18 -1: refKindHasReceiver
-10 -1: getZoneIds
-24 -1: (Ljava/nio/CharBuffer;)I
-47 -1: ()Lsun/reflect/generics/parser/SignatureParser;
-8 -1: getIndex
-24 -1: (Ljava/lang/Thread;TT;)V
-18 -1: (Ljava/util/Map;)V
-18 -1: (Ljava/util/Map;)Z
-6 -1: random
-10 -1: putAddress
-64 -1: (Ljava/util/function/Consumer<-Ljava/util/Map$Entry<TK;TV;>;>;)V
-24 -1: (Ljava/nio/CharBuffer;)V
-8 -1: canCache
-24 -1: (Ljava/nio/CharBuffer;)Z
-9 -1: getIntAt0
-4 -1: sqrt
-8 -1: makeLong
-54 -1: ([Ljava/lang/Object;Ljava/util/function/IntFunction;)V
-5 -1: (JJ)I
-26 -1: javaIOFileDescriptorAccess
-5 -1: (JJ)J
-15 -1: != basicType:
-36 -1: Ljava/lang/ref/ReferenceQueue<-TT;>;
-5 -1: words
-16 -1: sun.jnu.encoding
-32 -1: (Ljava/lang/invoke/LambdaForm;)V
-22 -1: ensureClassInitialized
-16 -1: Ljava/util/List;
-14 -1: varargsInvoker
-5 -1: (JJ)V
-20 -1: java/util/Properties
-12 -1: getImplClass
-21 -1: argumentTypesToString
-5 -1: (JJ)Z
-50 -1: java/util/Collections$SynchronizedRandomAccessList
-17 -1: makeWrappedMember
-21 -1: UnmodifiableSortedSet
-22 -1: (ILjava/lang/Class;Z)V
-3 -1: MIT
-13 -1: bootClassPath
-50 -1: (JLjava/util/function/Function;)Ljava/lang/Object;
-74 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/HashMap$Node<TK;TV;>;
-45 -1: (Ljava/util/Map$Entry;Ljava/util/Map$Entry;)I
-12 -1: advanceProbe
-10 -1: encoderFor
-14 -1: DataInput.java
-16 -1: java/lang/Double
-3 -1: 912
-3 -1: 914
-3 -1: abs
-3 -1: 915
-13 -1: currentThread
-17 -1: ClassDefiner.java
-32 -1: sun/misc/Launcher$ExtClassLoader
-16 -1: Current state =
-12 -1: elementCount
-10 -1: unmaskNull
-8 -1: csibm857
-32 -1: java/net/UnknownServiceException
-10 -1: x-utf-16be
-3 -1: acc
-37 -1: Ljava/util/List<Ljava/io/Closeable;>;
-23 -1: ([Ljava/lang/Thread;Z)I
-17 -1: impliesIgnoreMask
-23 -1: getGenericComponentType
-51 -1: ()Lsun/reflect/generics/repository/ClassRepository;
-34 -1: " not found. Will use interpreter.
-38 -1: ()Ljava/security/AccessControlContext;
-6 -1: final
-8 -1: utf-16le
-3 -1: 920
-3 -1: 923
-5 -1: (I)[C
-43 -1: (Ljava/nio/ByteOrder;)Ljava/nio/ByteBuffer;
-8 -1: csibm862
-34 -1: (Ljava/lang/ref/Reference<+TT;>;)Z
-8 -1: csibm866
-20 -1: getParameterizedType
-7 -1: (II[C)V
-20 -1: [Ljava/lang/Package;
-84 -1: (Ljava/lang/String;Ljava/security/ProtectionDomain;)Ljava/security/ProtectionDomain;
-28 -1: SynchronizedRandomAccessList
-18 -1: sun/misc/VMSupport
-61 -1: java/lang/invoke/MethodType$ConcurrentWeakInternSet$WeakEntry
-3 -1: add
-16 -1: ZipEntryIterator
-11 -1: next_target
-87 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;Ljava/security/CodeSource;)Ljava/lang/Class<*>;
-4 -1: amod
-12 -1: markedSkipLF
-55 -1: java/util/concurrent/ConcurrentHashMap$EntrySpliterator
-5 -1: lim=
-29 -1: java/security/PermissionsHash
-50 -1: (Ljava/lang/CharSequence;II)Ljava/lang/Appendable;
-19 -1: makePairwiseConvert
-58 -1: <T:Ljava/lang/Object;>(Ljava/lang/ClassValue$Entry<TT;>;)V
-8 -1: contents
-11 -1: user.region
-17 -1: RandomAccess.java
-13 -1: singletonList
-13 -1: policy,access
-64 -1: Ljava/util/Map<Ljava/lang/String;Ljava/io/ExpiringCache$Entry;>;
-25 -1: (Ljava/lang/Appendable;)V
-19 -1: (Ljava/util/List;)V
-43 -1: (Ljava/lang/ClassLoader;Ljava/lang/Class;)V
-19 -1: (Ljava/util/List;)Z
-15 -1: America/Chicago
-25 -1: (II)Ljava/nio/CharBuffer;
-12 -1: getDayOfWeek
-8 -1: ([BIIZ)V
-28 -1: (Ljava/lang/reflect/Field;)I
-28 -1: (Ljava/lang/reflect/Field;)J
-18 -1: getDeclaringClass0
-11 -1: counterTime
-30 -1: (Ljava/util/Collection<TE;>;)V
-28 -1: (Ljava/lang/reflect/Field;)V
-31 -1: (IIIILjava/io/FileDescriptor;)V
-25 -1: java/net/SocketPermission
-20 -1: bad parameter count
-18 -1: getHeaderFieldLong
-26 -1: GetReflectionFactoryAction
-19 -1: MIN_TRANSFER_STRIDE
-17 -1: java/nio/Bits$1$1
-7 -1: getSize
-33 -1: java/util/function/ToLongFunction
-46 -1: (IILjava/lang/String;)Ljava/lang/StringBuffer;
-10 -1: access$800
-65 -1: sun/misc/JavaSecurityProtectionDomainAccess$ProtectionDomainCache
-26 -1: (Ljava/lang/ClassLoader;)V
-25 -1: java/util/IdentityHashMap
-26 -1: (Ljava/lang/ClassLoader;)Z
-91 -1: <T:Ljava/lang/Object;>(Ljava/util/function/ToIntFunction<-TT;>;)Ljava/util/Comparator<TT;>;
-26 -1: ([CIILjava/lang/String;I)I
-12 -1: canonicalize
-3 -1: val
-8 -1: putCharB
-12 -1: UTF_32LE_BOM
-60 -1: (Ljava/security/CodeSource;)Ljava/security/ProtectionDomain;
-44 -1: (Lsun/misc/SignalHandler;Lsun/misc/Signal;)V
-26 -1: (Ljava/util/Enumeration;)V
-11 -1: INVALIDATED
-8 -1: putCharL
-22 -1: (II)Ljava/lang/String;
-7 -1: hasNext
-5 -1: WRITE
-20 -1: MIN_INITIAL_CAPACITY
-13 -1: propertyNames
-9 -1: Gregorian
-13 -1: getExpiration
-7 -1: minutes
-7 -1: ostream
-9 -1: java.lang
-17 -1: forceStandardTime
-9 -1: initWords
-41 -1: java/lang/Thread$UncaughtExceptionHandler
-9 -1: theUnsafe
-27 -1: ForEachTransformedEntryTask
-10 -1: forEncoder
-31 -1: needsClassLoaderPermissionCheck
-5 -1: ctime
-25 -1: ()Ljava/nio/DoubleBuffer;
-8 -1: getValue
-66 -1: (Lsun/util/locale/BaseLocale$Key;)Lsun/util/locale/BaseLocale$Key;
-42 -1: (Ljava/io/InputStream;Ljava/lang/String;)V
-6 -1: august
-14 -1: compileClasses
-13 -1: javaNetAccess
-22 -1: interpretWithArguments
-4 -1: url:
-14 -1: EMPTY_ITERATOR
-60 -1: Ljava/util/WeakHashMap<Ljava/io/Closeable;Ljava/lang/Void;>;
-24 -1: java/util/jar/Attributes
-12 -1: getOrDefault
-19 -1: Pacific/Guadalcanal
-33 -1: ()Ljava/lang/reflect/Constructor;
-38 -1: java/util/Collections$UnmodifiableList
-13 -1: basicTypeChar
-22 -1: (Ljava/lang/String;J)J
-14 -1: memberDefaults
-42 -1: (Ljava/lang/Class<*>;[Ljava/lang/String;)V
-38 -1: (Ljava/util/function/Consumer<-TK;>;)V
-16 -1: LF_NEWINVSPECIAL
-10 -1: classDepth
-28 -1: [Ljava/io/ObjectStreamField;
-46 -1: (Ljava/util/Collection;)Ljava/util/Collection;
-91 -1: ([Ljava/lang/reflect/Method;Ljava/lang/String;[Ljava/lang/Class;)Ljava/lang/reflect/Method;
-11 -1: getLocation
-39 -1: (Ljava/lang/Class;[Ljava/lang/Class;Z)V
-9 -1: loadTable
-55 -1: Directory separator should not appear in library name:
-7 -1: setTime
-14 -1: getConstructor
-4 -1: urls
-25 -1: dispatchUncaughtException
-77 -1: (ILjava/lang/Object;Ljava/lang/Class<*>;)Ljava/util/HashMap$TreeNode<TK;TV;>;
-8 -1: modCount
-8 -1: Opening
-6 -1: ENDHDR
-4 -1: cnfe
-34 -1: DIRECTIONALITY_PARAGRAPH_SEPARATOR
-10 -1: Asia/Amman
-3 -1: MST
-28 -1: DIRECTIONALITY_ARABIC_NUMBER
-3 -1: all
-4 -1: enum
-8 -1: copyWith
-12 -1: ([JI[IIJII)I
-29 -1: Ljava/lang/annotation/Target;
-7 -1: Thread-
-14 -1: x-utf-32le-bom
-38 -1: (ILjava/lang/management/MemoryUsage;)V
-33 -1: Signal already used by VM or OS:
-27 -1: (I)Ljava/lang/StringBuffer;
-25 -1: java/text/Normalizer$Form
-10 -1: x-utf-16le
-34 -1: can not access a member of class
-27 -1: (Ljava/nio/ByteBuffer;IFZ)V
-28 -1: (Ljava/lang/ClassValue<*>;)V
-16 -1: INITIAL_CAPACITY
-23 -1: DirectMethodHandle.java
-18 -1: reduceValuesToLong
-41 -1: (Ljava/lang/String;Ljava/lang/Class<*>;)V
-6 -1: unwrap
-12 -1: threadStatus
-5 -1: (DI)D
-11 -1: fieldOffset
-52 -1: java/util/concurrent/ConcurrentHashMap$EntryIterator
-14 -1: ACCESS_EXECUTE
-44 -1: (Ljava/nio/ByteBuffer;)Ljava/nio/CharBuffer;
-29 -1: ([Ljava/lang/ThreadGroup;IZ)I
-18 -1: LocalVariableTable
-17 -1: ConstantPool.java
-26 -1: (Ljava/nio/ByteBuffer;ID)V
-4 -1: (C)B
-3 -1: and
-4 -1: head
-126 -1: (Ljava/lang/reflect/GenericDeclaration;Lsun/reflect/generics/scope/Scope;)Lsun/reflect/generics/factory/CoreReflectionFactory;
-4 -1: (C)C
-16 -1: Pacific/Auckland
-7 -1: Thread[
-5 -1: ([D)I
-4 -1: (C)I
-98 -1: <U:Ljava/lang/Object;>([Ljava/lang/reflect/Constructor<TU;>;)[Ljava/lang/reflect/Constructor<TU;>;
-11 -1: fileHandler
-30 -1: DIRECTIONALITY_NONSPACING_MARK
-10 -1: (this Map)
-14 -1: malformedCache
-5 -1: ([D)V
-4 -1: (C)V
-26 -1: getUnicodeLocaleAttributes
-4 -1: (C)Z
-81 -1: (JLjava/util/function/ToLongBiFunction;JLjava/util/function/LongBinaryOperator;)J
-46 -1: [Ljava/util/concurrent/ConcurrentHashMap$Node;
-20 -1: Max. Heap Size:
-24 -1: Ljava/lang/reflect/Type;
-13 -1: EmptyIterator
-8 -1: allocate
-7 -1: FLUSHED
-8 -1: exitVM.*
-59 -1: (Ljava/lang/String;)Lsun/util/locale/InternalLocaleBuilder;
-19 -1: reduceEntriesToLong
-15 -1: getISOLanguages
-13 -1: CONSTANT_ZERO
-23 -1: (I)Ljava/util/Iterator;
-96 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/AbstractMap<TK;TV;>;Ljava/util/Map<TK;TV;>;
-11 -1: isSynthetic
-7 -1: lineBuf
-30 -1: java/lang/annotation/Inherited
-65 -1: <E:Ljava/lang/Object;>Ljava/lang/Object;Ljava/lang/Iterable<TE;>;
-35 -1: (Ljava/lang/String;)[Ljava/io/File;
-27 -1: java/security/cert/CertPath
-26 -1: startRemoteManagementAgent
-9 -1: shiftLeft
-5 -1: stack
-42 -1: (Ljava/lang/Class<*>;[Ljava/lang/Object;)V
-11 -1: CheckedList
-10 -1: replaceAll
-86 -1: (Ljava/util/HashMap$TreeNode;Ljava/util/HashMap$TreeNode;)Ljava/util/HashMap$TreeNode;
-24 -1: (I)Ljava/nio/CharBuffer;
-13 -1: image/vnd.fpx
-15 -1: iso_8859-1:1987
-19 -1: (Ljava/lang/Long;)I
-22 -1: sun/misc/SignalHandler
-15 -1: ifModifiedSince
-42 -1: (Ljava/lang/Class;)Ljava/lang/ClassLoader;
-105 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/String;ILjava/lang/Class;I[Ljava/lang/invoke/MemberName;)I
-22 -1: Negative timeout value
-38 -1: Ljava/io/UnsupportedEncodingException;
-11 -1: removeRange
-13 -1: Compiler.java
-6 -1: Sorter
-8 -1: aliasSet
-10 -1: UNASSIGNED
-34 -1: lambda$comparingByValue$1065357e$1
-34 -1: ()Ljava/lang/Class$AnnotationData;
-25 -1: sun/misc/Launcher$Factory
-15 -1: getLongVolatile
-8 -1: vmloader
-10 -1: unicodebig
-10 -1: closeables
-31 -1: JavaIOFileDescriptorAccess.java
-7 -1: static
-3 -1: arg
-21 -1: library can't be null
-42 -1: java/util/ArraysParallelSortHelpers$FJByte
-22 -1: getDeclaringExecutable
-19 -1: runFinalizersOnExit
-20 -1: simpleTimeZoneParams
-13 -1: Modifier.java
-14 -1: pkcs11keystore
-6 -1: shared
-30 -1: java/net/MalformedURLException
-26 -1: ()[Lsun/util/calendar/Era;
-13 -1: x-MS950-HKSCS
-10 -1: relativize
-40 -1: (Ljava/lang/String;JJ)Ljava/lang/String;
-31 -1: java/util/HashMap$ValueIterator
-29 -1: MODIFY_THREADGROUP_PERMISSION
-38 -1: (Ljava/lang/String;)Ljava/lang/Object;
-7 -1: destroy
-37 -1: (Ljava/util/List;)[Ljava/lang/String;
-18 -1: (Ljava/io/File;Z)V
-32 -1: Ljava/util/HashMap$Node<TK;TV;>;
-18 -1: interfaceModifiers
-34 -1: java/util/LinkedList$LLSpliterator
-7 -1: REF_???
-23 -1: java/net/ContentHandler
-20 -1: <compiledLambdaForm>
-17 -1: [Ljava/lang/Byte;
-6 -1: exitVM
-3 -1: att
-27 -1: sun/nio/cs/UTF_16BE$Encoder
-6 -1: exists
-28 -1: Ljava/util/Collection<+TE;>;
-48 -1: (Ljava/lang/CharSequence;)Ljava/lang/Appendable;
-6 -1: getMap
-52 -1: ([Ljava/lang/Class;I)Ljava/lang/reflect/Constructor;
-11 -1: stackTrace[
-21 -1: slowCheckMemberAccess
-33 -1: ReflectiveOperationException.java
-9 -1: versionId
-56 -1: Wrong number of parameters in MethodParameters attribute
-14 -1: isLowSurrogate
-8 -1: csPCp852
-16 -1: copyConstructors
-25 -1: ()Ljava/util/Spliterator;
-9 -1: closeLock
-17 -1: readUnsignedShort
-7 -1: 8859_13
-7 -1: 8859_15
-13 -1: TARGET_OFFSET
-26 -1: (Ljava/util/Hashtable;IZ)V
-44 -1: (Ljava/nio/CharBuffer;)Ljava/nio/CharBuffer;
-46 -1: (Ljava/lang/reflect/Type;)Ljava/lang/Class<*>;
-25 -1: DEFAULT_CONCURRENCY_LEVEL
-36 -1: Ljava/util/List<Ljava/lang/String;>;
-29 -1: sun.nio.PageAlignDirectMemory
-37 -1: (Ljava/lang/Class;I)Ljava/lang/Class;
-12 -1: encryptBlock
-8 -1: parentOf
-5 -1: H_HEX
-11 -1: getFloatAt0
-24 -1: VirtualMachineError.java
-18 -1: getDeclaredClasses
-59 -1: (Ljava/lang/AbstractStringBuilder;)Ljava/lang/StringBuffer;
-42 -1: (Ljava/util/List<Ljava/lang/Class<*>;>;)[C
-37 -1: (Ljava/lang/String;)Ljava/lang/Float;
-13 -1: Iterator.java
-25 -1: (Ljava/io/PrintStream;I)V
-9 -1: getObject
-19 -1: [Ljava/lang/String;
-7 -1: SIZECTL
-11 -1: isUnderflow
-27 -1: sun.nio.MaxDirectMemorySize
-21 -1: isNonPublicProxyClass
-13 -1: toCalendarDOW
-9 -1: Type.java
-14 -1: aliases_IBM850
-17 -1: emptyNavigableMap
-14 -1: aliases_IBM852
-14 -1: aliases_IBM855
-14 -1: aliases_IBM857
-14 -1: aliases_IBM858
-15 -1: iso_8859-4:1988
-13 -1: UnicodeScript
-8 -1: getCharB
-17 -1: constructorMethod
-27 -1: java/util/function/Function
-20 -1: getProtectionDomain0
-8 -1: getCharL
-32 -1: ([Ljava/io/File;)[Ljava/net/URL;
-51 -1: (Ljava/lang/Class;Z)Ljava/lang/invoke/MethodHandle;
-7 -1: getenv.
-5 -1: stale
-14 -1: aliases_IBM862
-32 -1: java/util/spi/LocaleNameProvider
-14 -1: aliases_IBM866
-51 -1: ([Ljava/lang/Class;)Ljava/lang/reflect/Constructor;
-6 -1: CENDSK
-36 -1: java/util/Comparators$NullComparator
-34 -1: UnsafeStaticFieldAccessorImpl.java
-17 -1: staticFieldOffset
-12 -1: prefetchRead
-4 -1: help
-34 -1: (Ljava/util/concurrent/TimeUnit;)J
-8 -1: getChars
-19 -1: java/lang/Throwable
-34 -1: Annotation Type:\n Member types:
-55 -1: (Ljava/lang/Class<*>;Ljava/security/ProtectionDomain;)V
-14 -1: aliases_IBM874
-17 -1: getDisplayVariant
-24 -1: Ljava/net/NetPermission;
-15 -1: jvmMinorVersion
-11 -1: subSequence
-3 -1: x86
-6 -1: double
-14 -1: checkSlotCount
-20 -1: java/net/InetAddress
-14 -1: Principal.java
-8 -1: $,;:@&=+
-17 -1: ByteBuffered.java
-21 -1: sun.misc.Perf.getPerf
-11 -1: finishEntry
-27 -1: sun.timezone.ids.oldmapping
-26 -1: (ZLjava/io/OutputStream;)V
-41 -1: (Ljava/lang/String;Z)Ljava/lang/Class<*>;
-32 -1: generateSerializationConstructor
-6 -1: Value
-40 -1: (Ljava/lang/String;Ljava/lang/String;Z)V
-16 -1: previousClearBit
-7 -1: theProp
-51 -1: (Ljava/io/OutputStream;Ljava/nio/charset/Charset;)V
-39 -1: com.sun.javafx.application.LauncherImpl
-21 -1: URLStreamHandler.java
-4 -1: in
-14 -1: BIT_INDEX_MASK
-125 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/Comparator<-TK;>;)Ljava/util/Comparator<Ljava/util/Map$Entry<TK;TV;>;>;
-49 -1: (Ljava/util/Set;Ljava/lang/Class;)Ljava/util/Set;
-10 -1: scaleValue
-27 -1: (Ljava/nio/ByteBuffer;IDZ)V
-78 -1: (Ljava/util/Collection<Ljava/lang/reflect/Field;>;[Ljava/lang/reflect/Field;)V
-53 -1: <T:Ljava/lang/Object;>(I)Ljava/util/Enumeration<TT;>;
-38 -1: java/lang/IncompatibleClassChangeError
-60 -1: java/util/concurrent/ConcurrentHashMap$MapReduceMappingsTask
-23 -1: not a method or field:
-35 -1: Ljava/nio/BufferUnderflowException;
-4 -1: i386
-13 -1: US_ASCII.java
-80 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/Class;)Ljava/lang/reflect/AnnotatedType;
-21 -1: initializeSystemClass
-6 -1: ([CI)I
-18 -1: getBooleanProperty
-35 -1: java/util/function/ToDoubleFunction
-37 -1: (Ljava/lang/String;)Ljava/lang/Class;
-28 -1: MapReduceEntriesToDoubleTask
-38 -1: java/util/LinkedHashMap$LinkedEntrySet
-8 -1: copySign
-6 -1: ([CI)V
-55 -1: sun/util/calendar/ZoneInfoFile$ZoneOffsetTransitionRule
-12 -1: parseBoolean
-3 -1: NET
-3 -1: NEW
-6 -1: Values
-17 -1: getJavaLangAccess
-9 -1: LocaleKey
-3 -1: :-1
-30 -1: (Ljava/io/ObjectInputStream;)V
-3 -1: NFC
-3 -1: NFD
-18 -1: SIMPLIFIED_CHINESE
-28 -1: ()Ljava/lang/reflect/Method;
-9 -1: localInit
-37 -1: sun/util/locale/LocaleSyntaxException
-15 -1: LambdaForm.java
-5 -1: rtype
-8 -1: field "
-50 -1: (Ljava/lang/Class;Ljava/lang/ref/ReferenceQueue;)V
-80 -1: (Ljava/lang/Class;[Ljava/lang/Class;[Ljava/lang/Class;IILjava/lang/String;[B[B)V
-36 -1: java/lang/invoke/MethodHandleNatives
-22 -1: (Ljava/util/Map<**>;)Z
-22 -1: Ljava/lang/Class<TV;>;
-7 -1: SubList
-14 -1: connect,accept
-19 -1: declaredAnnotations
-38 -1: Ljava/lang/ThreadLocal$ThreadLocalMap;
-11 -1: isSpaceChar
-10 -1: offerFirst
-20 -1: sun/nio/ByteBuffered
-17 -1: packageDefinition
-7 -1: trigger
-35 -1: [Ljava/lang/invoke/LambdaForm$Name;
-19 -1: sun.stdout.encoding
-5 -1: start
-26 -1: (Ljava/util/HashMap;IIII)V
-65 -1: (JLjava/util/function/Consumer<-Ljava/util/Map$Entry<TK;TV;>;>;)V
-6 -1: LOCVER
-3 -1: ://
-42 -1: (CLjava/lang/Class<*>;Ljava/lang/Object;)Z
-6 -1: friday
-45 -1: sun/reflect/DelegatingConstructorAccessorImpl
-15 -1: iso_8859-7:1987
-15 -1: newCalendarDate
-24 -1: getAnnotatedReceiverType
-32 -1: java/util/NoSuchElementException
-50 -1: (Ljava/util/NavigableSet;)Ljava/util/NavigableSet;
-26 -1: java/text/SimpleDateFormat
-16 -1: threadInitNumber
-55 -1: <T:Ljava/lang/Object;>(TT;)Ljava/util/Spliterator<TT;>;
-23 -1: (Ljava/lang/Object;)TT;
-3 1: bar
-37 -1: getFunctionalInterfaceMethodSignature
-5 -1: state
-39 -1: [Ljava/lang/reflect/GenericDeclaration;
-22 -1: sun/net/ProgressSource
-13 -1: LLSpliterator
-93 -1: <T:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Enumeration<TT;>;Ljava/util/Iterator<TT;>;
-5 -1: JAPAN
-11 -1: SPACE_TOTAL
-20 -1: CharsetProvider.java
-12 -1: CR_UNDERFLOW
-7 -1: ITALIAN
-11 -1: getCallerPD
-13 -1: isMemberClass
-38 -1: (Ljava/util/function/Consumer<-TT;>;)V
-18 -1: malformedForLength
-14 -1: ReflectionData
-34 -1: (BZI)Ljava/lang/invoke/LambdaForm;
-16 -1: forPrimitiveType
-31 -1: field found in java.lang.Class
-60 -1: (Ljava/lang/Void;Ljava/lang/ThreadGroup;Ljava/lang/String;)V
-18 -1: DescendingIterator
-25 -1: (IZLjava/lang/Runnable;)V
-35 -1: ()[Ljava/lang/reflect/TypeVariable;
-3 -1: bcp
-23 -1: (Ljava/lang/Object;)TV;
-25 -1: setDefaultAssertionStatus
-10 -1: ([BIIIII)V
-150 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;)Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
-14 -1: Inherited:
-17 -1: fileTimeToWinTime
-7 -1: ([BI)[B
-26 -1: java/io/OutputStreamWriter
-58 -1: <T:Ljava/lang/Object;>(Ljava/util/ListIterator<+TT;>;I)TT;
-39 -1: sun/reflect/annotation/AnnotationParser
-71 -1: (Ljava/nio/file/Path;Ljava/lang/String;)Ljava/nio/file/DirectoryStream;
-47 -1: Ljava/util/concurrent/locks/ReentrantLock$Sync;
-44 -1: (Ljava/util/Collection;[Ljava/lang/Object;)Z
-43 -1: ([ILjava/util/function/IntBinaryOperator;)V
-29 -1: reverseAllValidSurrogatePairs
-20 -1: Ljava/nio/file/Path;
-20 -1: getGenericSignature0
-42 -1: (Ljava/lang/String;Ljava/lang/Class<*>;Z)V
-8 -1: manEntry
-64 -1: (Ljava/lang/String;)Ljava/util/Enumeration<Lsun/misc/Resource;>;
-36 -1: newGetDoubleIllegalArgumentException
-63 -1: (Ljava/util/Collection;Ljava/lang/Class;)Ljava/util/Collection;
-30 -1: Ergonomics Machine Class:
-40 -1: ()Ljava/util/Map<Ljava/lang/String;TT;>;
-50 -1: (Ljava/lang/StringBuffer;)Ljava/lang/StringBuffer;
-30 -1: CHECK_MEMBER_ACCESS_PERMISSION
-22 -1: (Ljava/lang/Boolean;)I
-10 -1: V_Variable
-68 -1: java/util/concurrent/ConcurrentHashMap$ForEachTransformedMappingTask
-61 -1: (Ljava/lang/String;IILjava/lang/String;)Ljava/nio/ByteBuffer;
-21 -1: accessClassInPackage.
-44 -1: java/util/WeakHashMap$WeakHashMapSpliterator
-11 -1: nextElement
-9 -1: separator
-48 -1: java/util/zip/ZipFile$ZipFileInflaterInputStream
-44 -1: java/security/UnresolvedPermissionCollection
-10 -1: access$900
-44 -1: java/util/ArraysParallelSortHelpers$FJDouble
-84 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodHandle;
-52 -1: (Ljava/lang/ref/Finalizer;)Ljava/lang/ref/Finalizer;
-19 -1: getDeclaredMethods0
-29 -1: (IJ)Ljava/lang/StringBuilder;
-11 -1: Member.java
-61 -1: (Ljava/lang/String;ZJJ)Ljava/lang/management/MemoryPoolMBean;
-35 -1: java/lang/AssertionStatusDirectives
-23 -1: Declaring class is null
-56 -1: (Ljava/lang/Class;Ljava/lang/Object;Ljava/lang/Object;)I
-12 -1: java/io/File
-41 -1: java/util/ConcurrentModificationException
-47 -1: (Ljava/lang/CharSequence;)Ljava/nio/CharBuffer;
-19 -1: parameterClassCache
-8 -1: US_ASCII
-15 -1: tryMonitorEnter
-22 -1: Ljava/util/Collection;
-67 -1: (Lsun/misc/Signal;Lsun/misc/SignalHandler;)Lsun/misc/SignalHandler;
-27 -1: (Lsun/misc/JavaNioAccess;)V
-9 -1: DigitOnes
-5 -1: write
-31 -1: NF_internalMemberNameEnsureInit
-18 -1: comparableClassFor
-20 -1: defineAnonymousClass
-49 -1: (Ljava/io/InputStream;Lsun/net/ProgressSource;J)V
-31 -1: java/lang/NumberFormatException
-17 -1: remainderUnsigned
-62 -1: <T::Ljava/lang/Comparable<-TT;>;>()Ljava/util/Comparator<TT;>;
-4 -1: Kind
-20 -1: (Ljava/lang/Short;)I
-8 -1: OfDouble
-51 -1: ([Ljava/lang/Object;Ljava/lang/invoke/MethodType;)Z
-22 -1: [Ljava/util/Map$Entry;
-13 -1: instanceClass
-29 -1: ()Ljava/lang/SecurityManager;
-12 -1: isUnmappable
-17 -1: getAllStackTraces
-19 -1: LinkedValueIterator
-7 -1: isDigit
-10 -1: rangeCheck
-89 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;)Ljava/util/List<Ljava/lang/invoke/MemberName;>;
-13 -1: getMethodType
-21 -1: FileOutputStream.java
-22 -1: ()Ljava/text/Collator;
-64 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedAction<TT;>;)TT;
-15 -1: defaultTimeZone
-14 -1: emptySortedMap
-35 -1: (Ljava/util/function/IntConsumer;)V
-45 -1: java/util/Collections$CheckedRandomAccessList
-11 -1: getPriority
-7 -1: signals
-6 -1: Subset
-15 -1: invokeInterface
-16 -1: nameRefsAreLegal
-38 -1: (Ljava/lang/Object;)Ljava/lang/Object;
-37 -1: Ljava/util/Collections$EmptyIterator;
-9 -1: Perf.java
-20 -1: java/math/BigInteger
-38 -1: java/util/WeakHashMap$ValueSpliterator
-71 -1: (Ljava/nio/charset/CodingErrorAction;)Ljava/nio/charset/CharsetEncoder;
-50 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Object;)V
-21 -1: [Ljava/lang/Class<*>;
-13 -1: getProperties
-63 -1: (Ljava/lang/Class<*>;[B[Ljava/lang/Object;)Ljava/lang/Class<*>;
-65 -1: (Ljava/util/Set<Ljava/lang/Class<*>;>;)[Ljava/lang/reflect/Field;
-21 -1: sun/util/calendar/Era
-21 -1: Ljava/nio/CharBuffer;
-23 -1: (Ljava/lang/Object;JS)V
-24 -1: oracle/jrockit/jfr/VMJFR
-15 -1: access allowed
-34 -1: ()Lsun/util/calendar/CalendarDate;
-97 -1: (Ljava/security/PrivilegedExceptionAction;Ljava/security/AccessControlContext;)Ljava/lang/Object;
-44 -1: ([Ljava/lang/Object;[Ljava/lang/Object;III)V
-48 -1: (Ljava/util/Collection;I)Ljava/util/Spliterator;
-11 -1: SimpleEntry
-63 -1: (Ljava/net/URL;Ljava/net/URLStreamHandler;Ljava/util/HashMap;)V
-8 -1: putFloat
-20 -1: linkToCallSiteMethod
-8 -1: invokers
-35 -1: (J)Lsun/util/calendar/BaseCalendar;
-6 -1: FRENCH
-26 -1: getRawParameterAnnotations
-9 -1: wordIndex
-29 -1: JNI_COPY_FROM_ARRAY_THRESHOLD
-20 -1: sun/nio/cs/Surrogate
-48 -1: (Lsun/misc/JavaSecurityProtectionDomainAccess;)V
-45 -1: (Ljava/lang/ThreadLocal;Ljava/lang/Object;I)V
-3 -1: NST
-14 -1: getHeaderField
-27 -1: (Ljava/util/jar/JarFile;Z)V
-10 -1: findNative
-38 -1: The following can be used with access:
-29 -1: convertCertArrayToSignerArray
-4 -1: .DSA
-12 -1: dependencies
-12 -1: SYNCHRONIZED
-14 -1: x-euc-jp-linux
-28 -1: URLStreamHandlerFactory.java
-11 -1: checkPtypes
-68 -1: (Ljava/io/InputStream;Ljava/lang/Object;Ljava/nio/charset/Charset;)V
-13 -1: addDayOfMonth
-10 -1: isAncestor
-16 -1: entryDislocation
-12 -1: tableSizeFor
-29 -1: (ID)Ljava/lang/StringBuilder;
-19 -1: getLastRuleInstance
-24 -1: getGenericParameterTypes
-8 -1: ,offset=
-37 -1: (Ljava/net/URL;Ljava/lang/String;II)V
-13 -1: UTF_16LE.java
-12 -1: setTimestamp
-31 -1: AtomicReferenceFieldUpdaterImpl
-6 -1: L_URIC
-4 -1: (D)D
-14 -1: DeqSpliterator
-13 -1: LF_INVVIRTUAL
-171 -1: <U:Ljava/lang/Object;W:Ljava/lang/Object;>(Ljava/lang/Class<TU;>;Ljava/lang/Class<TW;>;Ljava/lang/String;)Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater<TU;TW;>;
-4 -1: (D)I
-22 -1: Ljava/lang/Class<TT;>;
-4 -1: (D)J
-196 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
-13 -1: ,transitions=
-30 -1: (Lsun/net/www/MessageHeader;)I
-4 -1: (D)V
-12 -1: segmentShift
-4 -1: (D)Z
-14 -1: Reference.java
-26 -1: [Ljava/lang/reflect/Field;
-26 -1: java/nio/DirectByteBufferR
-31 -1: lambda$thenComparing$36697e65$1
-30 -1: (Lsun/net/www/MessageHeader;)V
-55 -1: No java.nio.charset.StandardCharsets instances for you!
-59 -1: (Ljava/lang/Class<*>;Ljava/lang/Object;Ljava/lang/Object;)I
-19 -1: thenComparingDouble
-31 -1: ()Ljava/lang/invoke/LambdaForm;
-9 -1: getMillis
-21 -1: StandardCharsets.java
-15 -1: postDefineClass
-8 -1: getExtra
-3 -1: box
-10 -1: nextSetBit
-27 -1: java/util/ArrayList$SubList
-43 -1: (Ljava/util/concurrent/ConcurrentHashMap;)V
-52 -1: (Lsun/misc/URLClassPath;)Ljava/net/URLStreamHandler;
-7 -1: putLong
-40 -1: <T::Ljava/lang/Comparable<-TT;>;>([TT;)V
-8 -1: ([DII)[D
-8 -1: ([SIIS)I
-8 -1: argument
-12 -1: linkCallSite
-56 -1: <T:Ljava/lang/Object;>Ljava/lang/ref/WeakReference<TT;>;
-15 -1: returnSlotCount
-68 -1: (Ljava/lang/String;[Ljava/lang/Class<*>;Z)Ljava/lang/reflect/Method;
-20 -1: defaultDisplayLocale
-21 -1: (Ljava/util/Vector;)V
-49 -1: (Lsun/reflect/generics/visitor/TypeTreeVisitor;)V
-12 -1: isAlphabetic
-5 -1: perms
-13 -1: dosToJavaTime
-8 -1: ([SIIS)V
-7 -1: valueOf
-27 -1: Ljava/util/LinkedList$Node;
-41 -1: (Ljava/lang/String;I)Ljava/lang/Class<*>;
-38 -1: ()Ljava/nio/charset/CodingErrorAction;
-4 -1: MASK
-5 -1: Field
-101 -1: (Ljava/lang/Class;Ljava/nio/ByteBuffer;Lsun/reflect/ConstantPool;Ljava/lang/Class;)Ljava/lang/Object;
-56 -1: (Ljava/lang/String;Lsun/misc/Resource;)Ljava/lang/Class;
-9 -1: SURROGATE
-72 -1: (Ljava/lang/invoke/DirectMethodHandle$StaticAccessor;)Ljava/lang/Object;
-19 -1: PARAMETER_MODIFIERS
-48 -1: ([Ljava/lang/Object;II)Ljava/util/stream/Stream;
-56 -1: (TK;TV;Ljava/util/function/BiFunction<-TV;-TV;+TV;>;)TV;
-118 -1: <U:Ljava/lang/Object;>(JLjava/util/function/BiFunction<-TK;-TV;+TU;>;Ljava/util/function/BiFunction<-TU;-TU;+TU;>;)TU;
-29 -1: (Lsun/nio/ch/Interruptible;)V
-45 -1: Ljava/lang/ref/Reference<Ljava/lang/Object;>;
-17 -1: isHeldExclusively
-3 -1: NYI
-15 -1: getByteVolatile
-20 -1: compareAndSwapObject
-29 -1: (Z)[Ljava/lang/reflect/Field;
-7 -1: ([SII)V
-13 -1: toLanguageTag
-18 -1: StreamEncoder.java
-25 -1: (IF)Ljava/nio/ByteBuffer;
-18 -1: afterNodeInsertion
-11 -1: accessOrder
-60 -1: Lsun/reflect/annotation/TypeAnnotation$TypeAnnotationTarget;
-20 -1: META-INF/MANIFEST.MF
-18 -1: getSuperInterfaces
-26 -1: (Ljava/nio/ByteBuffer;IZ)C
-26 -1: (Ljava/nio/ByteBuffer;IZ)D
-9 -1: PROTECTED
-18 -1: not visible from
-26 -1: java/lang/RuntimeException
-26 -1: (Ljava/nio/ByteBuffer;IZ)F
-20 -1: java/net/FileNameMap
-15 -1: insertArguments
-8 -1: diagprop
-26 -1: (Ljava/nio/ByteBuffer;IZ)I
-26 -1: (Ljava/nio/ByteBuffer;IZ)J
-20 -1: createContentHandler
-11 -1: getProtocol
-26 -1: (Ljava/nio/ByteBuffer;IZ)S
-33 -1: Ljava/lang/NoSuchMethodException;
-19 -1: entry name too long
-40 -1: java/util/jar/JarVerifier$VerifierStream
-6 -1: server
-7 -1: OCTOBER
-26 -1: sun/invoke/util/VerifyType
-6 -1: domain
-9 -1: getUnsafe
-5 -1: ([Z)I
-4 -1: cons
-42 -1: ()Ljava/lang/ReflectiveOperationException;
-4 -1: byte
-29 -1: java/util/function/BiConsumer
-24 -1: getJavaUtilZipFileAccess
-37 -1: ([Ljava/lang/Object;)Ljava/util/List;
-27 -1: timeout can not be negative
-62 -1: Ljava/util/Map<Ljava/io/InputStream;Ljava/util/zip/Inflater;>;
-16 -1: getOurStackTrace
-34 -1: (J)Ljava/lang/ref/Reference<+TT;>;
-50 -1: Lsun/reflect/generics/repository/MethodRepository;
-20 -1: MIN_BYTE_BUFFER_SIZE
-3 -1: buf
-13 -1: getAttributes
-6 -1: GERMAN
-38 -1: java/security/NoSuchAlgorithmException
-20 -1: Direct buffer memory
-6 -1: (IIZ)V
-27 -1: JVMTI_THREAD_STATE_RUNNABLE
-26 -1: [Ljava/io/File$PathStatus;
-36 -1: (Ljava/util/List;Ljava/lang/Class;)V
-13 -1: JarIndex.java
-34 -1: java/lang/Character$CharacterCache
-8 -1: csIBM857
-10 -1: LineReader
-28 -1: Ljava/lang/RuntimeException;
-30 -1: ()Ljava/util/Enumeration<TV;>;
-12 -1: getSeparator
-124 -1: (Ljava/security/PrivilegedAction;Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;)Ljava/lang/Object;
-97 -1: Ljava/util/Map<Ljava/lang/Integer;Ljava/lang/ref/WeakReference<Ljava/nio/charset/CoderResult;>;>;
-21 -1: ConstantCallSite.java
-40 -1: sun/util/locale/provider/LocaleResources
-101 -1: <U::Ljava/lang/Comparable<-TU;>;>(Ljava/util/function/Function<-TT;+TU;>;)Ljava/util/Comparator<TT;>;
-4 -1: copy
-23 -1: sun/security/util/Debug
-10 -1: isAbsolute
-34 -1: (Ljava/lang/invoke/MethodHandle;)V
-34 -1: (Ljava/lang/invoke/MethodHandle;)Z
-48 -1: ()[Ljava/util/concurrent/ConcurrentHashMap$Node;
-34 -1: (Lsun/reflect/LangReflectAccess;)V
-8 -1: csIBM862
-8 -1: csIBM866
-64 -1: java/util/concurrent/ConcurrentHashMap$MapReduceKeysToDoubleTask
-39 -1: No java.util.Objects instances for you!
-68 -1: (Ljava/util/PrimitiveIterator$OfInt;JI)Ljava/util/Spliterator$OfInt;
-19 -1: Illegal class name
-24 -1: uncaughtExceptionHandler
-12 -1: runFinalizer
-23 -1: java/io/FileInputStream
-41 -1: (Ljava/lang/Class<*>;Ljava/lang/String;)V
-98 -1: (Ljava/util/HashMap$Node<TK;TV;>;Ljava/util/HashMap$Node<TK;TV;>;)Ljava/util/HashMap$Node<TK;TV;>;
-30 -1: java/nio/charset/CoderResult$1
-20 -1: SourceDebugExtension
-30 -1: java/nio/charset/CoderResult$2
-69 -1: ([Ljava/security/ProtectionDomain;[Ljava/security/ProtectionDomain;)Z
-14 -1: 1.8.0-internal
-16 -1: ReduceValuesTask
-13 -1: toLowerString
-14 -1: newPrintStream
-13 -1: unicodelittle
-19 -1: getClassLoadingLock
-9 -1: DigitTens
-80 -1: (Ljava/lang/Class<*>;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodType;
-12 -1: sun_eu_greek
-21 -1: getBootstrapClassPath
-9 -1: volatile
-15 -1: UnmodifiableMap
-21 -1: enumConstantDirectory
-10 -1: getContent
-4 -1: cosh
-74 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)Ljava/util/Locale;
-11 -1: ([JII[JII)V
-28 -1: java/lang/reflect/Executable
-17 -1: MapReduceKeysTask
-6 -1: isOpen
-17 -1: AnnotationDefault
-17 -1: Already connected
-27 -1: (Lsun/misc/JavaNetAccess;)V
-34 -1: ([BILjava/nio/charset/Charset;Z)[B
-55 -1: Ljava/lang/invoke/DirectMethodHandle$EnsureInitialized;
-8 -1: Set.java
-10 -1: DEAD_ENTRY
-7 -1: nextInt
-3 -1: wtb
-23 -1: java/util/Collections$1
-86 -1: (Lsun/reflect/generics/factory/GenericsFactory;)Lsun/reflect/generics/visitor/Reifier;
-23 -1: java/util/Collections$2
-23 -1: java/util/Collections$3
-18 -1: DoubleCumulateTask
-22 -1: skip value is negative
-85 -1: (Ljava/io/InputStream;Ljava/lang/Object;Ljava/lang/String;)Lsun/nio/cs/StreamDecoder;
-5 -1: \\[\\]$
-34 -1: Ljava/util/NoSuchElementException;
-3 -1: NaN
-30 -1: sun/util/calendar/CalendarDate
-10 -1: V_Constant
-20 -1: java/lang/Comparable
-9 -1: text/html
-20 -1: -9223372036854775808
-20 -1: DataInputStream.java
-20 -1: Member defaults:
-35 -1: Ljava/lang/ref/ReferenceQueue$Lock;
-8 -1: getBytes
-17 -1: CodePointIterator
-11 -1: Signal.java
-19 -1: javaHomePrefixCache
-12 -1: replaceFirst
-37 -1: Ljava/lang/IndexOutOfBoundsException;
-39 -1: (Ljava/lang/String;ZI)Ljava/lang/Class;
-21 -1: initSystemClassLoader
-28 -1: America/Indiana/Indianapolis
-47 -1: (Ljava/security/Permission;Ljava/lang/Object;)V
-27 -1: java/net/URISyntaxException
-21 -1: createSecurityManager
-7 -1: suspend
-12 -1: L_UNRESERVED
-17 -1: checkMemberAccess
-12 -1: CoreCounters
-19 -1: java/net/HttpCookie
-8 -1: isGetter
-17 -1: setDaylightSaving
-27 -1: java.launcher.javafx.error1
-53 -1: java/util/concurrent/ConcurrentHashMap$CollectionView
-16 -1: readUnsignedByte
-47 -1: (Ljava/lang/String;)Ljava/net/URLStreamHandler;
-40 -1: (Z)[Ljava/lang/reflect/Constructor<TT;>;
-14 -1: javaLangAccess
-5 -1: apply
-8 -1: getFloat
-15 -1: getD3DAvailable
-25 -1: startLocalManagementAgent
-7 -1: RUNTIME
-22 -1: LocalVariableTypeTable
-8 -1: doOutput
-16 -1: CheckedSortedSet
-10 -1: zoneOffset
-64 -1: (Ljava/security/Permission;)Ljava/security/PermissionCollection;
-13 -1: hasUnresolved
-13 -1: user.language
-11 -1: getDoubleAt
-14 -1: getQueueLength
-37 -1: java/nio/DirectByteBuffer$Deallocator
-6 -1: ASHIFT
-9 -1: checkPath
-80 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;Ljava/lang/Class;)V
-6 -1: CENEXT
-16 -1: doubleToLongBits
-11 -1: copyToArray
-9 -1: copyField
-36 -1: ()Lsun/util/calendar/Gregorian$Date;
-53 -1: (ILjava/lang/Object;)Ljava/util/HashMap$Node<TK;TV;>;
-44 -1: (TK;TV;Ljava/lang/ref/ReferenceQueue<TV;>;)V
-35 -1: java/util/Collections$EmptyIterator
-38 -1: sealing violation: can't seal package
-37 -1: (Ljava/util/Queue;Ljava/lang/Class;)V
-129 -1: (Ljava/lang/Class<*>;Ljava/lang/String;[Ljava/lang/Class<*>;Ljava/lang/Class<*>;[Ljava/lang/Class<*>;IILjava/lang/String;[B[B[B)V
-18 -1: HashMapSpliterator
-8 -1: putShort
-23 -1: (Ljava/lang/Object;II)V
-7 -1: GERMANY
-13 -1: toTitleString
-102 -1: (Ljava/util/ArrayPrefixHelpers$CumulateTask;Ljava/util/function/BinaryOperator;[Ljava/lang/Object;II)V
-44 -1: ([Ljava/lang/Object;)Ljava/util/Spliterator;
-6 -1: unused
-25 -1: java/net/URLClassLoader$1
-25 -1: java/net/URLClassLoader$2
-25 -1: java/net/URLClassLoader$3
-25 -1: java/net/URLClassLoader$4
-12 -1: getFixedDate
-25 -1: java/net/URLClassLoader$5
-4 -1: time
-25 -1: java/net/URLClassLoader$6
-25 -1: java/net/URLClassLoader$7
-14 -1: historicalName
-12 -1: normalizeKey
-13 -1: MIN_SURROGATE
-41 -1: java/nio/charset/CharacterCodingException
-18 -1: java/lang/Iterable
-8 -1: ([JII)[J
-103 -1: Ljava/util/Map<Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;Ljava/lang/annotation/Annotation;>;
-18 -1: putBooleanVolatile
-5 -1: Entry
-11 -1: CounterCell
-12 -1: monitorEnter
-10 -1: skipBuffer
-15 -1: hasMoreElements
-24 -1: newIllegalStateException
-24 -1: Ljava/lang/LinkageError;
-12 -1: getEntryFlag
-44 -1: (Ljava/lang/Throwable$PrintStreamOrWriter;)V
-18 -1: java/nio/IntBuffer
-17 -1: jdk_minor_version
-28 -1: DIRECTIONALITY_RIGHT_TO_LEFT
-15 -1: getAndSetObject
-7 -1: sizeCtl
-15 -1: Ljava/util/Set;
-32 -1: (I)Ljava/lang/invoke/LambdaForm;
-16 -1: runFinalization0
-30 -1: Ljava/lang/reflect/Executable;
-15 -1: compareUnsigned
-5 -1: nkeys
-31 -1: Ljava/nio/channels/FileChannel;
-40 -1: sun/reflect/generics/tree/ClassSignature
-22 -1: (Ljava/lang/Object;I)B
-22 -1: (Ljava/lang/Object;I)C
-22 -1: (Ljava/lang/Object;I)D
-7 -1: JANUARY
-30 -1: newGetIllegalArgumentException
-22 -1: (Ljava/lang/Object;I)F
-22 -1: (Ljava/lang/Object;I)I
-22 -1: (Ljava/lang/Object;I)J
-28 -1: generateNamedFunctionInvoker
-38 -1: (Ljava/lang/String;)Ljava/time/ZoneId;
-19 -1: lambda$codePoints$2
-4 -1: Null
-7 -1: setEras
-15 -1: lambda$chars$15
-14 -1: CollectionView
-24 -1: (C)Ljava/io/PrintStream;
-22 -1: (Ljava/lang/Object;I)S
-96 -1: (Ljava/security/AccessControlContext;Lsun/security/util/Debug;Ljava/security/ProtectionDomain;)V
-17 -1: getJulianCalendar
-22 -1: (Ljava/lang/Object;I)V
-17 -1: getMethodAccessor
-9 -1: not owner
-35 -1: java/lang/reflect/ParameterizedType
-15 -1: ValueCollection
-22 -1: (Ljava/lang/Object;I)Z
-4 -1: utf8
-5 -1: CHINA
-9 -1: sprintf0d
-18 -1: java/nio/file/Path
-35 -1: DIRECTIONALITY_RIGHT_TO_LEFT_ARABIC
-30 -1: URI has an authority component
-43 -1: (Ljava/lang/Object;)Ljava/util/Spliterator;
-15 -1: <no principals>
-62 -1: (Lsun/util/locale/BaseLocale$Key;)Lsun/util/locale/BaseLocale;
-6 -1: ([ZZ)V
-10 -1: getContext
-12 -1: content-type
-99 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/ref/ReferenceQueue;ILjava/util/WeakHashMap$Entry;)V
-51 -1: (Ljava/util/concurrent/ConcurrentHashMap<TK;TV;>;)V
-27 -1: Invalid constant pool index
-20 -1: getUnicodeLocaleType
-43 -1: Ljava/nio/charset/CharacterCodingException;
-113 -1: (Ljava/net/URL;Ljava/net/URLStreamHandler;Ljava/util/HashMap<Ljava/lang/String;Lsun/misc/URLClassPath$Loader;>;)V
-56 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/util/Locale;
-24 -1: Lsun/misc/SignalHandler;
-8 -1: readlink
-125 -1: (Ljava/nio/file/WatchService;[Ljava/nio/file/WatchEvent$Kind<*>;[Ljava/nio/file/WatchEvent$Modifier;)Ljava/nio/file/WatchKey;
-11 -1: initStatics
-15 -1: unmappableCache
-13 -1: fixMethodType
-25 -1: sun/net/www/MessageHeader
-3 -1: cdt
-27 -1: Ljava/util/Locale$Category;
-59 -1: (ILjava/lang/Object;Ljava/lang/Object;ZZ)Ljava/lang/Object;
-8 -1: Accessor
-14 -1: mapLibraryName
-54 -1: (Lsun/misc/URLClassPath$JarLoader;)Lsun/misc/JarIndex;
-24 -1: ZoneOffsetTransitionRule
-7 -1: getChar
-3 -1: cee
-25 -1: MapReduceValuesToLongTask
-20 -1: declaredPublicFields
-44 -1: (Ljava/lang/ClassLoader;Ljava/lang/String;)J
-13 -1: removeElement
-20 -1: Ljava/nio/ByteOrder;
-8 -1: parallel
-67 -1: (Ljava/lang/reflect/Constructor;Lsun/reflect/ConstructorAccessor;)V
-22 -1: java/util/zip/ZipCoder
-8 -1: ([ZIIZ)V
-45 -1: (Ljava/lang/String;Ljava/lang/CharSequence;)Z
-8 -1: february
-40 -1: java/util/zip/ZipFile$ZipFileInputStream
-47 -1: java/nio/charset/Charset$ExtendedProviderHolder
-13 -1: IEEEremainder
-15 -1: sun/misc/Perf$1
-9 -1: abstract
-20 -1: ()Ljava/time/ZoneId;
-7 -1: ONE_DAY
-92 -1: (Ljava/util/concurrent/ConcurrentHashMap$Node;)Ljava/util/concurrent/ConcurrentHashMap$Node;
-45 -1: (Ljava/util/ListIterator;I)Ljava/lang/Object;
-16 -1: Buffer size <= 0
-9 -1: checkName
-11 -1: getJarEntry
-20 -1: Replacement too long
-53 -1: (Ljava/lang/String;)Ljava/nio/charset/CharsetDecoder;
-12 -1: isWhitespace
-15 -1: csISOLatinGreek
-70 -1: (Ljava/lang/reflect/Constructor<*>;Lsun/reflect/ConstructorAccessor;)V
-20 -1: TypeAnnotationTarget
-3 -1: No
-27 -1: Lsun/reflect/FieldAccessor;
-12 -1: doPrivileged
-83 -1: (JLjava/util/function/ToIntFunction<-TV;>;ILjava/util/function/IntBinaryOperator;)I
-60 -1: (Ljava/nio/file/attribute/FileTime;)Ljava/util/zip/ZipEntry;
-11 -1: changeEntry
-18 -1: MessageHeader.java
-51 -1: ([Ljava/lang/String;Ljava/util/Map;)Ljava/util/Map;
-9 -1: castEntry
-16 -1: ACCESS_MODIFIERS
-11 -1: newInstance
-24 -1: lastIndexOfSupplementary
-13 -1: JZENTRY_EXTRA
-5 -1: LONGS
-7 -1: domain
-16 -1: protocolPathProp
-21 -1: java/util/Hashtable$1
-10 -1: isSameDate
-23 -1: (I)Ljava/nio/file/Path;
-33 -1: java/util/PrimitiveIterator$OfInt
-7 -1: ([II)[I
-8 -1: variant=
-29 -1: (Ljava/util/Collection<*>;Z)Z
-38 -1: already loaded in another classloader
-10 -1: setSeconds
-9 -1: makeShort
-59 -1: ClassLoader.findLibrary failed to return an absolute path:
-26 -1: java/util/jar/JarException
-9 -1: setCharAt
-13 -1: initCauseFrom
-13 -1: val$fieldName
-18 -1: MIN_HIGH_SURROGATE
-60 -1: (Lsun/util/calendar/ZoneInfoFile$ZoneOffsetTransitionRule;)B
-25 -1: getDayOfWeekFromFixedDate
-10 -1: maybeReBox
-9 -1: getHandle
-60 -1: (Lsun/util/calendar/ZoneInfoFile$ZoneOffsetTransitionRule;)I
-59 -1: ([Ljava/lang/Class<*>;)Ljava/lang/reflect/Constructor<TT;>;
-3 -1: cis
-11 -1: getIssuerDN
-9 -1: codebase=
-80 -1: (ILjava/lang/invoke/BoundMethodHandle$SpeciesData;)Ljava/lang/invoke/LambdaForm;
-29 -1: addThreadDumpForSynchronizers
-6 -1: FRANCE
-77 -1: <T:Ljava/lang/Object;U:Ljava/lang/Object;>([TU;ILjava/lang/Class<+[TT;>;)[TT;
-45 -1: <T:Ljava/lang/Object;>()Ljava/util/List<TT;>;
-16 -1: putFloatVolatile
-34 -1: (Ljava/lang/Class;)Ljava/util/Map;
-28 -1: ()Ljava/security/Permission;
-28 -1: (Ljava/lang/CharSequence;I)I
-51 -1: ()Ljava/util/Enumeration<Ljava/util/jar/JarEntry;>;
-25 -1: (II)Ljava/nio/ByteBuffer;
-20 -1: BasicPermission.java
-5 -1: isNaN
-48 -1: (Ljava/lang/Throwable;)Ljava/lang/InternalError;
-10 -1: ONE_MINUTE
-55 -1: (Ljava/lang/invoke/DirectMethodHandle$StaticAccessor;)J
-13 -1: DAYS_IN_MONTH
-7 -1: domains
-10 -1: isUnshared
-58 -1: Ljava/lang/Number;Ljava/lang/Comparable<Ljava/lang/Long;>;
-47 -1: (Ljava/util/List;)Ljava/security/cert/CertPath;
-28 -1: ()Ljava/util/Enumeration<*>;
-34 -1: sun/misc/Launcher$ExtClassLoader$1
-22 -1: (CLjava/lang/Object;)Z
-64 -1: Ljava/lang/ref/WeakReference<Ljava/nio/charset/CharsetDecoder;>;
-7 -1: ENGLISH
-27 -1: (Ljava/util/zip/Inflater;)V
-24 -1: makeArrayElementAccessor
-72 -1: (Ljava/lang/Class<*>;[Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
-48 -1: (Ljava/util/jar/JarFile;)Ljava/util/Enumeration;
-48 -1: (Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
-15 -1: getNthDayOfWeek
-16 -1: printHelpMessage
-15 -1: getAbsoluteFile
-9 -1: OPEN_READ
-19 -1: willGMTOffsetChange
-28 -1: (Ljava/util/LinkedHashMap;)V
-37 -1: java/security/AllPermissionCollection
-5 -1: [id="
-34 -1: java/lang/invoke/BoundMethodHandle
-31 -1: ()Ljava/security/cert/CertPath;
-50 -1: java/util/ArraysParallelSortHelpers$FJShort$Sorter
-14 -1: StaticAccessor
-22 -1: synchronizedCollection
-53 -1: ([Ljava/io/File;)Ljava/security/AccessControlContext;
-37 -1: (Ljava/lang/Class;Ljava/lang/Class;)Z
-14 -1: codePointCount
-13 -1: is param at
-37 -1: Ljava/lang/invoke/MemberName$Factory;
-20 -1: annotationDataOffset
-31 -1: protocol doesn't support output
-11 -1: hostAddress
-12 -1: ,dstSavings=
-35 -1: java.lang.Integer.IntegerCache.high
-15 -1: ParallelLoaders
-48 -1: (Ljava/util/Locale;)Lsun/util/locale/BaseLocale;
-8 -1: getSize0
-22 -1: checkCreateClassLoader
-8 -1: transfer
-32 -1: (Lsun/misc/JavaSecurityAccess;)V
-26 -1: ()Ljava/net/URLConnection;
-3 -1: cmp
-9 -1: setMillis
-34 -1: sun/util/calendar/AbstractCalendar
-19 -1: getDirectBufferPool
-7 -1: ([FII)V
-28 -1: ([C)Ljava/lang/StringBuffer;
-54 -1: (Ljava/lang/Class<*>;)Ljava/security/ProtectionDomain;
-26 -1: (Ljava/nio/ByteBuffer;IF)V
-11 -1: discardMark
-71 -1: (Ljava/lang/Class;)Lsun/util/locale/provider/LocaleServiceProviderPool;
-30 -1: java/io/UTFDataFormatException
-53 -1: (Ljava/nio/CharBuffer;)Ljava/nio/charset/CoderResult;
-48 -1: java/util/concurrent/ConcurrentHashMap$Traverser
-5 -1: ([F)I
-37 -1: (IC)Ljava/lang/AbstractStringBuilder;
-27 -1: Ljava/util/jar/JarVerifier;
-22 -1: java/util/Spliterators
-32 -1: java/lang/invoke/MutableCallSite
-20 -1: java/io/Serializable
-5 -1: ([F)V
-35 -1: (Ljava/security/ProtectionDomain;)V
-33 -1: ()Ljava/lang/ref/Reference<+TT;>;
-10 -1: unlinkLast
-6 -1: (JSZ)V
-8 -1: isStatic
-14 -1: subclassAudits
-23 -1: (Ljava/lang/String;)TT;
-17 -1: java.awt.headless
-9 -1: <Unknown>
-39 -1: Lsun/util/locale/LocaleSyntaxException;
-8 -1: location
-3 -1: cos
-27 -1: createGarbageCollectorMBean
-20 -1: MAX_MH_INVOKER_ARITY
-75 -1: (Ljava/nio/ByteBuffer;Ljava/nio/CharBuffer;Z)Ljava/nio/charset/CoderResult;
-14 -1: Cloneable.java
-50 -1: (Lsun/reflect/DelegatingConstructorAccessorImpl;)V
-26 -1: sun/nio/ch/FileChannelImpl
-51 -1: (Ljava/lang/Class;Ljava/lang/reflect/Constructor;)V
-18 -1: Unknown byte order
-28 -1: ()[Lsun/invoke/util/Wrapper;
-21 -1: getReadClassBytesTime
-64 -1: (Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodTypeForm;
-11 -1: setDelegate
-20 -1: (Ljava/util/List;)[C
-7 -1: usemmap
-22 -1: (CC)Ljava/lang/String;
-34 -1: sun/invoke/util/BytecodeDescriptor
-21 -1: getJavaSecurityAccess
-53 -1: (Ljava/nio/ByteBuffer;)Ljava/nio/charset/CoderResult;
-7 -1: ibm-737
-19 -1: (Ljava/lang/Enum;)I
-4 -1: rint
-11 -1: Constructor
-9 -1: arraycopy
-35 -1: ([D)Ljava/util/stream/DoubleStream;
-13 -1: comparingLong
-40 -1: <T:Ljava/lang/Object;>Ljava/lang/Object;
-23 -1: OutputStreamWriter.java
-8 -1: getShort
-17 -1: CLASSPATH_LASTOCC
-13 -1: createNewFile
-14 -1: internalValues
-34 -1: Ljava/lang/IllegalAccessException;
-23 -1: (JILjava/lang/Object;)V
-27 -1: sun.misc.URLClassPath.debug
-45 -1: [Ljava/lang/ThreadLocal$ThreadLocalMap$Entry;
-35 -1: ()Lsun/reflect/ConstructorAccessor;
-12 -1: classEnabled
-23 -1: cachedFixedDateNextJan1
-48 -1: (Ljava/util/Locale$LocaleKey;)Ljava/util/Locale;
-26 -1: (Ljava/lang/ThreadGroup;)V
-7 -1: setErr0
-6 -1: CENFLG
-26 -1: (Ljava/lang/ThreadGroup;)Z
-18 -1: sun/misc/MetaIndex
-3 -1: crc
-34 -1: (Z)Ljava/lang/invoke/MethodHandle;
-12 -1: replaceNames
-15 -1: java/util/Stack
-57 -1: Ljava/util/Vector<Ljava/lang/ClassLoader$NativeLibrary;>;
-89 -1: (JLjava/util/function/ToDoubleFunction<-TV;>;DLjava/util/function/DoubleBinaryOperator;)D
-24 -1: permission can't be null
-22 -1: Unable to connect to:
-44 -1: (Ljava/nio/ByteBuffer;)Ljava/nio/ByteBuffer;
-14 -1: floatToIntBits
-11 -1: getLastRule
-6 -1: EXTCRC
-26 -1: java/net/InetSocketAddress
-36 -1: (Lsun/misc/URLClassPath$JarLoader;)V
-27 3: sun/launcher/LauncherHelper
-8 -1: ecma-118
-49 -1: (Ljava/net/URL;Ljava/lang/String;)[Ljava/net/URL;
-13 -1: hashCodeValue
-5 -1: CESU8
-21 -1: appendVmSelectMessage
-13 -1: bindImmediate
-12 -1: closeLoaders
-16 -1: emptySpliterator
-28 -1: (J)Ljava/time/LocalDateTime;
-22 -1: [Ljava/lang/Character;
-5 -1: certs
-6 -1: (null)
-25 -1: java/io/ObjectInputStream
-27 -1: ([Ljava/lang/ThreadGroup;)I
-3 -1: cst
-3 -1: csu
-20 -1: java/nio/ShortBuffer
-53 -1: (Ljava/lang/ClassValue;Ljava/lang/ClassValue$Entry;)V
-4 -1: (Z)I
-24 -1: Ljava/io/FileDescriptor;
-6 -1: cclass
-10 -1: , profile
-39 -1: (Ljava/lang/String;)Ljava/lang/Process;
-4 -1: (Z)V
-5 -1: toURI
-24 -1: ConstructorAccessor.java
-5 -1: toURL
-18 -1: addAllIfNotPresent
-4 -1: (Z)Z
-5 -1: parse
-11 -1: isPrimitive
-42 -1: (Ljava/io/File;)Ljava/lang/ProcessBuilder;
-36 -1: (Ljava/util/Date;)Ljava/lang/String;
-23 -1: getFormalTypeParameters
-13 -1: Resource.java
-7 -1: ibm-775
-6 -1: isEnum
-24 -1: setJavaUtilZipFileAccess
-21 -1: \t[CIRCULAR REFERENCE:
-51 -1: (Ljava/lang/CharSequence;)Ljava/util/regex/Matcher;
-24 -1: (I)Ljava/nio/ByteBuffer;
-53 -1: sun/reflect/generics/repository/GenericDeclRepository
-3 -1: xor
-17 -1: invokeBasicMethod
-27 -1: java/lang/invoke/LambdaForm
-99 -1: (Ljava/util/jar/Manifest;Ljava/util/jar/JarEntry;Ljava/io/InputStream;Ljava/util/jar/JarVerifier;)V
-46 -1: Lsun/reflect/generics/factory/GenericsFactory;
-37 -1: sun/misc/Launcher$BootClassPathHolder
-10 -1: BindCaller
-24 -1: java/lang/reflect/Member
-32 -1: java/lang/management/ThreadState
-5 -1: (IB)V
-21 -1: RuntimeException.java
-5 -1: ended
-17 -1: java/util/TreeSet
-7 -1: : no !/
-16 -1: java/util/Vector
-9 -1: nextAfter
-22 -1: Ljava/lang/Deprecated;
-20 -1: requestedCharsetName
-37 -1: ([JIII)Ljava/util/Spliterator$OfLong;
-14 -1: internArgument
-11 -1: getTimeZone
-10 -1: isValidKey
-11 -1: LAST_RESULT
-43 -1: sun/reflect/annotation/TypeAnnotationParser
-13 -1: encodedInPath
-52 -1: (Ljava/security/PrivilegedAction;)Ljava/lang/Object;
-4 -1: LL_L
-34 -1: java/nio/charset/CodingErrorAction
-10 -1: copyFields
-11 -1: getConstant
-9 -1: threshold
-13 -1: aliases_UTF_8
-27 -1: (Ljava/util/ArrayDeque;II)V
-29 -1: Ljava/lang/ref/SoftReference;
-19 -1: indexedBinarySearch
-11 -1: containsKey
-81 -1: ([Ljava/lang/ClassValue$Entry;Ljava/lang/ClassValue;)Ljava/lang/ClassValue$Entry;
-86 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class<*>;II)Ljava/lang/invoke/MethodHandle;
-15 -1: cannot convert
-25 -1: getSystemResourceAsStream
-46 -1: (Ljava/util/Properties;)Ljava/util/Properties;
-12 -1: reverseOrder
-16 -1: getSystemPackage
-8 -1: ([SII)[S
-19 -1: makeAccessException
-100 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<-TK;+TU;>;Ljava/util/function/Consumer<-TU;>;)V
-39 -1: ([Ljava/lang/Class;I)[Ljava/lang/Class;
-19 -1: Ljava/lang/Boolean;
-6 -1: Hidden
-47 -1: java/lang/invoke/MethodHandleImpl$ArrayAccessor
-5 -1: APRIL
-8 -1: emptySet
-11 -1: getCombiner
-58 -1: (Ljava/lang/String;I[Ljava/lang/invoke/LambdaForm$Name;I)V
-24 -1: java.system.class.loader
-14 -1: Can't handle:
-16 -1: isNullConversion
-38 -1: ()Ljava/util/HashMap$TreeNode<TK;TV;>;
-29 -1: referenceKindIsConsistentWith
-11 -1: flushBuffer
-8 -1: putField
-27 -1: ()Ljava/security/PublicKey;
-53 -1: ()Ljava/util/stream/Stream<Ljava/util/jar/JarEntry;>;
-10 -1: pathToURLs
-26 -1: throwIllegalStateException
-10 -1: markedChar
-14 -1: isNativeMethod
-36 -1: (I)Ljava/lang/AbstractStringBuilder;
-54 -1: java/util/concurrent/ConcurrentHashMap$ReservationNode
-45 -1: Lsun/misc/JavaSecurityProtectionDomainAccess;
-62 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;Ljava/lang/Object;I)V
-7 -1: subList
-8 -1: UTF_32BE
-6 -1: U_None
-50 -1: sun/reflect/generics/repository/AbstractRepository
-62 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;Ljava/lang/Object;I)Z
-43 -1: sun/net/www/protocol/file/FileURLConnection
-13 -1: setZoneOffset
-43 -1: Underlying input stream returned zero bytes
-54 -1: [a-zA-Z_$][a-zA-Z0-9_$]*([.][a-zA-Z_$][a-zA-Z0-9_$]*)*
-13 -1: containsValue
-44 -1: (Ljava/nio/CharBuffer;)Ljava/nio/ByteBuffer;
-25 -1: isNullReferenceConversion
-38 -1: Ljava/util/Vector<Ljava/lang/String;>;
-6 -1: toFile
-7 -1: getSlot
-17 -1: (Ljava/net/URI;)V
-32 -1: java.security.cert.Certificate:
-24 -1: ()Lsun/misc/PerfCounter;
-11 -1: Asia/Hebron
-16 -1: createMemoryPool
-10 -1: addToCache
-29 -1: Ljava/lang/invoke/DontInline;
-39 -1: java/lang/ref/Finalizer$FinalizerThread
-58 -1: (Ljava/lang/Class;)Lsun/reflect/generics/scope/ClassScope;
-20 -1: getBooleanAttributes
-15 -1: parallelLockMap
-34 -1: java/util/Vector$VectorSpliterator
-21 -1: createMemoryPoolMBean
-15 -1: no content-type
-41 -1: Couldn't find 3-letter language code for
-5 -1: slash
-34 -1: Ljava/lang/annotation/ElementType;
-8 -1: isSetter
-26 -1: (ZLjava/lang/String;JJJZ)V
-6 -1: GMT_ID
-73 -1: ()[Ljava/lang/reflect/TypeVariable<Ljava/lang/reflect/Constructor<TT;>;>;
-56 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/lang/Object;
-32 -1: (Ljava/util/Set;)Ljava/util/Set;
-4 -1: stop
-62 -1: (Ljava/lang/String;IILjava/lang/String;I)Ljava/nio/ByteBuffer;
-11 -1: genericInfo
-11 -1: listToArray
-26 -1: ()Ljava/util/jar/Manifest;
-13 -1: putOrderedInt
-5 -1: flush
-13 -1: ArrayAccessor
-4 -1: Name
-95 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;[Ljava/util/concurrent/ConcurrentHashMap$Node;)V
-68 -1: (Ljava/lang/Class;Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle;
-23 -1: java/lang/ref/Reference
-37 -1: (Ljava/nio/file/attribute/FileTime;)J
-14 -1: MIN_CODE_POINT
-9 -1: ISO8859-1
-9 -1: ISO8859-2
-9 -1: ISO8859-5
-34 -1: ([CILjava/nio/charset/Charset;Z)[C
-9 -1: ISO8859-9
-9 -1: getUTF8At
-12 -1: java/net/URI
-67 -1: (Ljava/io/DataInput;Ljava/lang/String;)Lsun/util/calendar/ZoneInfo;
-22 -1: ListCompositionPattern
-67 -1: (Ljava/lang/String;[BIILjava/security/CodeSource;)Ljava/lang/Class;
-3 1: xxx
-12 -1: java/net/URL
-27 -1: Can't overwrite cause with
-30 -1: sun/util/locale/BaseLocale$Key
-22 -1: forkSecondaryFinalizer
-23 -1: java/security/Principal
-8 -1: makeSite
-17 -1: NEGATIVE_INFINITY
-12 -1: addUnstarted
-12 -1: internalForm
-9 -1: cellsBusy
-23 -1: (Ljava/lang/Object;IJ)V
-13 -1: getParameters
-6 -1: H_PATH
-10 -1: L_REG_NAME
-139 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/AbstractMap<TK;TV;>;Ljava/util/Map<TK;TV;>;Ljava/lang/Cloneable;Ljava/io/Serializable;
-6 -1: latin0
-10 -1: addSeconds
-6 -1: latin1
-6 -1: latin2
-6 -1: latin4
-6 -1: latin5
-17 -1: getWaitingThreads
-6 -1: latin9
-21 -1: java/util/Comparators
-10 -1: trimToSize
-96 -1: <T:Ljava/lang/Object;>(Ljava/util/Collection<TT;>;Ljava/lang/Object;)Ljava/util/Collection<TT;>;
-43 -1: ([JLjava/util/function/IntToLongFunction;)V
-23 -1: GET_COMBINER_PERMISSION
-20 -1: lambda$replaceAll$14
-5 -1: KOREA
-20 -1: getJvmSpecialVersion
-9 -1: dumpStack
-16 -1: CACHE_LOAD_LIMIT
-43 -1: GSS LoginConfigImpl debugging
-26 -1: (DLjava/lang/Appendable;)V
-8 -1: forName0
-35 -1: java/lang/ClassLoader$NativeLibrary
-46 -1: java/util/concurrent/ConcurrentHashMap$Segment
-24 -1: getDeclaredAnnotationMap
-89 -1: java/util/concurrent/atomic/AtomicReferenceFieldUpdater$AtomicReferenceFieldUpdaterImpl$1
-20 -1: java_runtime_version
-26 -1: java/util/stream/IntStream
-16 -1: Ljava/io/Writer;
-69 -1: ()Ljava/util/SortedMap<Ljava/lang/String;Ljava/nio/charset/Charset;>;
-15 -1: getClassLoader0
-6 -1: x86_64
-11 -1: isInterface
-15 -1: MODIFIER_SYMBOL
-44 -1: Note: Separate multiple options with a comma
-9 -1: recursive
-19 -1: java/nio/CharBuffer
-8 -1: capacity
-17 -1: validateMainClass
-50 -1: (Ljava/util/Set;Ljava/lang/Object;)Ljava/util/Set;
-22 -1: (Ljava/lang/Object;J)B
-22 -1: (Ljava/lang/Object;J)C
-22 -1: (Ljava/lang/Object;J)D
-17 -1: not a method type
-22 -1: (Ljava/lang/Object;J)F
-5 -1: count
-32 -1: AtomicReferenceFieldUpdater.java
-22 -1: (Ljava/lang/Object;J)I
-14 -1: methodAccessor
-22 -1: (Ljava/lang/Object;J)J
-7 -1: isError
-51 -1: (Ljava/nio/Buffer;II)Ljava/nio/charset/CoderResult;
-53 -1: (BZLjava/lang/Class<*>;)Ljava/lang/invoke/LambdaForm;
-25 -1: <no signer certificates>
-5 -1: [pos=
-14 -1: lambda$chars$1
-9 -1: CELLVALUE
-16 -1: haveLeftoverChar
-22 -1: ([Ljava/lang/String;)V
-32 -1: java/lang/InstantiationException
-7 -1: SIG_IGN
-13 -1: ZipUtils.java
-50 -1: Ljava/lang/ref/ReferenceQueue<Ljava/lang/Object;>;
-22 -1: (Ljava/lang/Object;J)S
-69 -1: Ljava/util/HashMap<Ljava/lang/String;Lsun/misc/URLClassPath$Loader;>;
-16 -1: newInternalError
-22 -1: (Ljava/lang/Object;J)V
-9 -1: ABBR_MASK
-5 -1: array
-22 -1: (Ljava/lang/Object;J)Z
-13 -1: FilteringMode
-30 -1: java/util/stream/StreamSupport
-19 -1: retrieveDisplayName
-56 -1: (Ljava/util/TimeZone;)Lsun/util/calendar/Gregorian$Date;
-10 -1: val$values
-9 -1: normalize
-28 -1: (II)Ljava/lang/CharSequence;
-16 -1: serialVersionUID
-7 -1: getPath
-25 -1: (ILjava/lang/Class<*>;Z)V
-13 -1: thenComparing
-51 -1: (Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle;
-36 -1: ()[Ljava/lang/annotation/Annotation;
-14 -1: MetaIndex.java
-8 -1: identity
-15 -1: findSystemClass
-24 -1: privateGetDeclaredFields
-27 -1: java/lang/ref/SoftReference
-19 -1: useCanonPrefixCache
-3 -1: dec
-3 -1: PLT
-8 -1: UTF_32LE
-17 -1: java/util/HashMap
-12 -1: toEpochMilli
-9 -1: intStream
-11 -1: Caused by:
-31 -1: java/nio/charset/CharsetDecoder
-30 -1: is being checked
-11 -1: parseHeader
-25 -1: ACCUMULATED_DAYS_IN_MONTH
-34 -1: newGetByteIllegalArgumentException
-21 -1: checkPropertiesAccess
-13 -1: StackMapTable
-8 -1: addCount
-51 -1: (Ljava/lang/invoke/MethodHandle;)Ljava/lang/String;
-9 -1: authority
-15 -1: iso-10646-ucs-2
-6 -1: SUNDAY
-22 -1: LocalGregorianCalendar
-9 -1: listRoots
-32 -1: Lsun/reflect/generics/tree/Tree;
-38 -1: [Ljava/util/WeakHashMap$Entry<TK;TV;>;
-11 -1: nativeOrder
-5 -1: long0
-5 -1: long1
-5 -1: long2
-5 -1: long3
-17 -1: capacityIncrement
-5 -1: long4
-97 -1: (Ljava/lang/String;Ljava/lang/invoke/MethodType;[Ljava/lang/Object;)Ljava/lang/invoke/MemberName;
-31 -1: Ljava/lang/CharacterDataLatin1;
-5 -1: long5
-5 -1: long6
-5 -1: long7
-17 -1: reduceValuesToInt
-13 -1: package2certs
-13 -1: isTypeVisible
-30 -1: java/lang/ref/PhantomReference
-47 -1: ()Ljava/util/stream/Stream<Ljava/lang/String;>;
-9 -1: longValue
-3 -1: PNT
-10 -1: storeToXML
-10 -1: getMethod0
-12 -1: constantZero
-7 -1: promise
-116 -1: (Ljava/lang/String;Lsun/reflect/generics/factory/GenericsFactory;)Lsun/reflect/generics/repository/MethodRepository;
-32 -1: DIRECTIONALITY_SEGMENT_SEPARATOR
-9 -1: byteOrder
-9 -1: isPromise
-4 -1: isOn
-6 -1: LOCCRC
-10 -1: setDefault
-9 -1: setHandle
-15 -1: java/nio/Buffer
-37 -1: (Ljava/lang/String;I)Ljava/lang/Long;
-10 -1: Float.java
-12 -1: showSettings
-27 -1: (Ljava/io/FileDescriptor;)I
-27 -1: (Ljava/io/FileDescriptor;)J
-21 -1: java/util/Spliterator
-22 -1: CodingErrorAction.java
-11 -1: isMalformed
-27 -1: java/util/PrimitiveIterator
-15 -1: THROW_EXCEPTION
-15 -1: copyToCharArray
-26 -1: ()Ljava/util/jar/JarEntry;
-27 -1: (Ljava/io/FileDescriptor;)V
-11 -1: getEncoding
-48 -1: (Ljava/lang/ThreadLocal<*>;Ljava/lang/Object;I)V
-17 -1: java.runtime.name
-28 -1: (Lsun/invoke/util/Wrapper;)Z
-20 -1: annotationTypeOffset
-27 -1: (J)Ljava/lang/StringBuffer;
-15 -1: METHOD_RECEIVER
-10 -1: startEntry
-29 -1: (I)Ljava/lang/reflect/Member;
-7 -1: setOut0
-10 -1: getMethods
-26 -1: ()Lsun/misc/JavaNioAccess;
-18 -1: linkToTargetMethod
-8 -1: INSTANCE
-3 -1: dir
-41 -1: ([Ljava/net/URL;Ljava/lang/ClassLoader;)V
-9 -1: unboxCast
-58 -1: <T:Ljava/lang/Throwable;>(TT;)Lsun/invoke/empty/Empty;^TT;
-12 -1: java.version
-50 -1: (Ljava/io/InputStream;Ljava/nio/charset/Charset;)V
-32 2: sun/net/www/protocol/jar/Handler
-20 -1: java/lang/Compiler$1
-9 -1: LongCache
-14 -1: FILL_THRESHOLD
-22 -1: getRawClassAnnotations
-9 -1: (JI[CII)I
-13 -1: hasMoreTokens
-13 -1: getSuperclass
-3 -1: PRC
-12 -1: MAX_PRIORITY
-14 -1: checkCacheLoad
-7 -1: lowMask
-8 -1: LM_CLASS
-7 -1: initIDs
-27 -1: Ljava/util/Collection<TV;>;
-3 -1: yes
-3 -1: PRT
-91 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/LambdaForm;
-27 -1: ()Lsun/security/util/Debug;
-8 -1: VM start
-9 -1: setMemory
-7 -1: getName
-10 -1: findSignal
-19 -1: startsWithLocHeader
-37 -1: java/util/Collections$SynchronizedMap
-51 -1: (ICLjava/lang/Object;)Ljava/lang/invoke/LambdaForm;
-62 -1: (Ljava/util/Locale;)Lsun/util/locale/provider/LocaleResources;
-17 -1: lastParameterType
-9 -1: NO_PTYPES
-116 -1: <T:Ljava/lang/Object;>([Ljava/lang/ClassValue$Entry<*>;Ljava/lang/ClassValue<TT;>;)Ljava/lang/ClassValue$Entry<TT;>;
-18 -1: DisplayNamePattern
-8 -1: getField
-5 -1: flags
-3 -1: PST
-17 -1: annotationDefault
-18 -1: java/nio/ByteOrder
-8 -1: highMask
-6 -1: ascii7
-29 -1: getGregorianYearFromFixedDate
-125 -1: (Ljava/lang/String;[Ljava/lang/invoke/LambdaForm$Name;[Ljava/lang/invoke/LambdaForm$Name;Ljava/lang/invoke/LambdaForm$Name;)V
-8 -1: =Lambda(
-29 -1: Ljava/util/WeakHashMap$Entry;
-18 -1: multiValueIterator
-74 -1: Ljava/util/LinkedHashMap<Ljava/lang/String;Ljava/io/ExpiringCache$Entry;>;
-13 -1: CONV_OP_LIMIT
-6 -1: sclSet
-81 -1: (Lsun/misc/URLClassPath$JarLoader;Ljava/util/jar/JarFile;)Ljava/util/jar/JarFile;
-14 -1: appendFragment
-46 -1: java/util/Collections$SynchronizedNavigableMap
-36 -1: application/x-java-serialized-object
-13 -1: setNativeName
-53 -1: java/util/concurrent/ConcurrentHashMap$ForwardingNode
-16 -1: setJavaAWTAccess
-30 -1: methodHandleInvokeLinkerMethod
-15 -1: reduceKeysToInt
-20 -1: ensureCapacityHelper
-23 -1: createFileURLConnection
-12 -1: d3dAvailable
-69 -1: (Ljava/lang/Object;Ljava/lang/invoke/MethodHandle;)Ljava/lang/String;
-49 -1: java/util/ArraysParallelSortHelpers$FJLong$Sorter
-21 -1: explicitCastArguments
-24 -1: JAVAFX_LAUNCH_MODE_CLASS
-9 -1: invoke_MT
-18 -1: ensureMemberAccess
-74 -1: (Ljava/util/concurrent/locks/AbstractQueuedSynchronizer$ConditionObject;)I
-36 -1: java/nio/charset/spi/CharsetProvider
-23 -1: (Ljava/lang/String;II)V
-14 -1: initProperties
-4 -1: (F)F
-35 -1: [[Ljava/lang/annotation/Annotation;
-4 -1: (F)I
-106 -1: Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/Comparable<Ljava/lang/String;>;Ljava/lang/CharSequence;
-46 -1: java/lang/invoke/BoundMethodHandle$SpeciesData
-74 -1: (Ljava/util/concurrent/locks/AbstractQueuedSynchronizer$ConditionObject;)Z
-24 -1: java.launcher.opt.header
-37 -1: ([Ljava/security/ProtectionDomain;Z)V
-10 -1: lineBuffer
-7 -1: ibm-813
-9 -1: isBuiltin
-4 -1: (F)V
-7 -1: ibm-819
-9 -1: H_ESCAPED
-4 -1: (F)Z
-20 -1: suppressedExceptions
-12 -1: UTF-32LE-BOM
-19 -1: CalendarSystem.java
-8 -1: readOnly
-81 -1: (JLjava/util/function/Function;Ljava/util/function/BiFunction;)Ljava/lang/Object;
-32 -1: sun/misc/Launcher$AppClassLoader
-78 -1: Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/Comparable<Ljava/io/File;>;
-17 -1: [Ljava/lang/Enum;
-41 -1: java/util/Collections$CheckedNavigableSet
-8 -1: asSetter
-3 -1: dom
-41 -1: (I)[Ljava/util/WeakHashMap$Entry<TK;TV;>;
-16 -1: localeExtensions
-21 -1: sun/net/www/ParseUtil
-21 -1: Ljava/nio/ByteBuffer;
-29 -1: java/util/concurrent/TimeUnit
-25 -1: java/lang/CharacterData00
-15 -1: sun/misc/Unsafe
-28 -1: java/io/ByteArrayInputStream
-3 -1: dow
-25 -1: java/lang/CharacterData01
-25 -1: java/lang/CharacterData02
-6 -1: STORED
-11 -1: isTransient
-8 -1: function
-16 -1: getCanonicalFile
-13 -1: ,useDaylight=
-24 -1: domain (context is null)
-12 -1: Cleaner.java
-17 -1: CalendarDate.java
-49 -1: Lsun/reflect/generics/repository/FieldRepository;
-14 -1: forInputString
-25 -1: java/lang/CharacterData0E
-67 -1: (Ljava/lang/Object;Ljava/util/function/Supplier;)Ljava/lang/Object;
-19 -1: codePointBeforeImpl
-6 -1: script
-21 -1: systemNativeLibraries
-38 -1: ([Ljava/lang/Class;)Ljava/lang/String;
-14 -1: CONTENT_LENGTH
-19 -1: HeapCharBuffer.java
-22 -1: ExtendedProviderHolder
-41 -1: java/lang/invoke/InvokerBytecodeGenerator
-12 -1: basicInvoker
-26 -1: ([Ljava/lang/Comparable;)V
-10 -1: val$tclass
-47 -1: (Ljava/lang/Throwable;)Lsun/invoke/empty/Empty;
-18 -1: isLegalReplacement
-22 -1: spliteratorUnknownSize
-15 -1: SynchronizedSet
-16 -1: MethodParameters
-22 -1: desiredAssertionStatus
-29 -1: ()Ljava/util/ArrayDeque<TE;>;
-36 -1: ()Ljava/lang/reflect/Constructor<*>;
-66 -1: ()Ljava/util/Map<Ljava/lang/String;Ljava/lang/invoke/LambdaForm;>;
-58 -1: (Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;)V
-50 -1: (Ljava/util/concurrent/CountedCompleter;[J[JIIII)V
-14 -1: requireNonNull
-21 -1: java/lang/ThreadGroup
-95 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;ILjava/util/concurrent/ConcurrentHashMap$Node;)V
-76 -1: (Ljava/nio/channels/WritableByteChannel;Ljava/nio/charset/CharsetEncoder;I)V
-14 -1: reflectionData
-33 -1: Ljava/lang/invoke/MethodTypeForm;
-7 -1: tuesday
-31 -1: ()Lsun/misc/JavaSecurityAccess;
-14 -1: fieldFilterMap
-28 -1: ([Ljava/lang/ThreadGroup;Z)I
-7 -1: ibm-850
-83 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/lang/management/GarbageCollectorMXBean;
-7 -1: ibm-852
-5 -1: cesu8
-14 -1: ForwardingNode
-29 -1: (Ljava/nio/ByteBuffer;IIIII)V
-7 -1: ibm-855
-12 -1: SingletonSet
-16 -1: isOtherUppercase
-15 -1: FIELD_UNDEFINED
-9 -1: makeEntry
-7 -1: ibm-857
-10 -1: extensions
-10 -1: longStream
-19 -1: getGenericSignature
-7 -1: newNode
-8 -1: jarNames
-25 -1: java/util/jar/JarVerifier
-49 -1: ()[Lsun/reflect/generics/tree/ClassTypeSignature;
-4 -1: wait
-115 -1: (Ljava/lang/String;Lsun/reflect/generics/factory/GenericsFactory;)Lsun/reflect/generics/repository/ClassRepository;
-56 -1: (Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/Object;
-65 -1: (Lsun/util/locale/BaseLocale;Lsun/util/locale/LocaleExtensions;)V
-7 -1: ibm-862
-9 -1: ISO646-US
-7 -1: ibm-866
-16 -1: extendedProvider
-7 -1: ([C[C)Z
-93 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodHandle;
-8 -1: getHours
-21 -1: ()[Ljava/lang/String;
-187 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$ReduceKeysTask;Ljava/util/function/BiFunction;)V
-106 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/concurrent/locks/ReentrantLock;Ljava/io/Serializable;
-24 -1: java/nio/file/FileSystem
-14 -1: ForEachKeyTask
-13 -1: defaultLocale
-20 -1: constructorModifiers
-13 -1: asWrapperType
-42 -1: (Ljava/lang/String;ZI)Ljava/lang/Class<*>;
-17 -1: BaseCalendar.java
-76 -1: (Ljava/util/jar/JarFile;Ljava/util/jar/JarEntry;)[Ljava/security/CodeSigner;
-14 -1: isSynchronized
-27 -1: java/nio/DirectByteBuffer$1
-3 -1: ()B
-7 -1: ibm-874
-12 -1: exactInvoker
-3 -1: ()C
-39 -1: (Ljava/lang/Thread;Ljava/lang/Object;)V
-3 -1: ()D
-3 -1: ()F
-27 -1: [Ljava/lang/reflect/Method;
-10 -1: floatValue
-3 -1: ()I
-3 -1: ()J
-18 -1: getLocaleResources
-59 -1: java/util/concurrent/ConcurrentHashMap$MapReduceEntriesTask
-67 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/Hashtable$Entry;)V
-11 -1: maxPriority
-11 -1: getStringAt
-60 -1: (Ljava/lang/ClassValue$Version;)Ljava/lang/ClassValue$Entry;
-3 -1: ()S
-49 -1: (Ljava/lang/String;)Ljava/io/ExpiringCache$Entry;
-42 -1: (III)Lsun/util/calendar/BaseCalendar$Date;
-82 -1: <T:Ljava/lang/Object;>(Ljava/util/Set<TT;>;Ljava/lang/Object;)Ljava/util/Set<TT;>;
-62 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/Class;)Ljava/util/Map;
-3 -1: ()V
-24 -1: ()Ljava/nio/ShortBuffer;
-29 -1: file descriptor can't be null
-3 -1: ()Z
-7 -1: matcher
-66 -1: (Ljava/lang/reflect/Constructor;)Lsun/reflect/ConstructorAccessor;
-7 -1: matches
-12 -1: getAuthority
-16 -1: java/lang/Object
-5 -1: (IC)V
-17 -1: EmptyListIterator
-8 -1: charsets
-8 -1: sameFile
-47 -1: (TT;Ljava/util/function/UnaryOperator<TV;>;)TV;
-16 -1: overwrittenEntry
-15 -1: reinvokerTarget
-11 -1: isUpperCase
-5 -1: toUri
-9 -1: GMT+00:00
-33 -1: java/util/concurrent/ForkJoinPool
-10 -1: parseFloat
-53 -1: java/util/concurrent/ConcurrentHashMap$SearchKeysTask
-48 -1: (Ljava/lang/Object;Ljava/util/LinkedList$Node;)V
-82 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;Ljava/lang/Object;ILjava/lang/Class<*>;)V
-15 -1: reduceCacheLoad
-76 -1: (Ljava/lang/Class<*>;[Ljava/lang/reflect/Method;)[Ljava/lang/reflect/Method;
-20 -1: singletonSpliterator
-24 -1: getTransitionEpochSecond
-24 -1: MapReduceValuesToIntTask
-13 -1: ALLOWED_FLAGS
-55 -1: (Ljava/lang/reflect/Field;Z)Lsun/reflect/FieldAccessor;
-34 -1: [Ljava/lang/annotation/Annotation;
-10 -1: readBuffer
-21 -1: Illegal month value:
-31 -1: java/security/SecureClassLoader
-12 -1: reinitialize
-5 -1: limit
-4 -1: grow
-15 -1: getCreationTime
-7 -1: , from
-25 -1: (Ljava/lang/ClassValue;)V
-13 -1: java.compiler
-37 -1: ()Ljava/util/Set<Ljava/lang/String;>;
-6 -1: FJChar
-16 -1: getFieldAccessor
-4 -1: eras
-11 -1: isSupported
-24 -1: ()Ljava/text/DateFormat;
-32 -1: java/util/Collections$CopiesList
-32 -1: java/io/NotSerializableException
-15 -1: typeAnnotations
-27 -1: defaultAllowUserInteraction
-57 -1: (Ljava/lang/String;I[Ljava/lang/invoke/LambdaForm$Name;)V
-18 -1: checkArgumentTypes
-71 -1: (Lsun/util/calendar/BaseCalendar$Date;)Lsun/util/calendar/BaseCalendar;
-10 -1: isMirrored
-27 -1: (I)Ljava/lang/Thread$State;
-26 -1: (Ljava/util/Collection;Z)Z
-6 -1: ibm367
-16 -1: isAssignableFrom
-7 -1: readUTF
-35 -1: Ljava/lang/ref/ReferenceQueue<TV;>;
-56 -1: ([Ljava/util/HashMap$Node;Ljava/util/HashMap$TreeNode;)V
-8 -1: MANDATED
-18 -1: canonicalizeRegion
-11 -1: checkAccept
-44 -1: (Ljava/net/Proxy;)Lsun/net/ApplicationProxy;
-8 -1: ECMA-118
-22 -1: ReflectPermission.java
-4 -1: _put
-41 -1: java.lang.invoke.MethodHandle.DEBUG_NAMES
-47 -1: java/util/concurrent/ConcurrentHashMap$TreeNode
-44 -1: (Ljava/net/URL;[Ljava/security/CodeSigner;)V
-5 -1: april
-44 -1: ([Ljava/lang/Class<*>;Ljava/lang/Class<*>;)V
-150 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/concurrent/ConcurrentHashMap$CollectionView<TK;TV;TK;>;Ljava/util/Set<TK;>;Ljava/io/Serializable;
-91 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/HashMap$Node;)Ljava/util/HashMap$TreeNode;
-26 -1: sun/net/util/IPAddressUtil
-8 -1: Modifier
-9 -1: isVarargs
-24 -1: -- listing properties --
-16 -1: hasAllPermission
-27 -1: MapReduceMappingsToLongTask
-29 -1: sharedGetParameterAnnotations
-9 -1: argCounts
-11 -1: toLocalTime
-89 -1: (Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MemberName;
-4 -1: ROOT
-20 -1: sun.reflect.noCaches
-18 -1: UnicodeBigUnmarked
-4 -1: Lazy
-35 -1: java/lang/invoke/SimpleMethodHandle
-20 -1: (I)Ljava/nio/Buffer;
-48 -1: ()Lsun/reflect/generics/tree/ClassTypeSignature;
-31 -1: (I[CII)Ljava/lang/StringBuffer;
-17 -1: America/Anchorage
-7 -1: markpos
-9 -1: enumerate
-11 -1: parseLocale
-24 -1: java.launcher.cls.error1
-46 -1: (ILjava/lang/Object;)Ljava/lang/StringBuilder;
-24 -1: java.launcher.cls.error2
-24 -1: java.launcher.cls.error3
-24 -1: java.launcher.cls.error4
-21 -1: java/util/ArrayList$1
-17 -1: getExceptionTypes
-24 -1: java.launcher.cls.error5
-30 -1: java/util/Spliterator$OfDouble
-10 -1: forDecoder
-8 -1: getEntry
-10 -1: checkGuard
-12 -1: checkInitted
-34 -1: Lsun/util/locale/LocaleExtensions;
-41 -1: java/util/ArraysParallelSortHelpers$FJInt
-10 -1: findStatic
-22 -1: setConstructorAccessor
-34 -1: Lsun/misc/URLClassPath$FileLoader;
-20 -1: not a reinvoker MH:
-16 -1: LongCumulateTask
-11 -1: checkAccess
-14 -1: SearchKeysTask
-36 -1: ()[Ljava/lang/reflect/AnnotatedType;
-11 -1: initDefault
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/cds/appcds/FieldLayoutFlags.java Fri Nov 08 20:41:14 2019 -0500
@@ -0,0 +1,127 @@
+/*
+ * Copyright (c) 2019, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary VM should work even if different field layout options are chosen between dump time and run time.
+ * @bug 8233086
+ * @requires vm.cds
+ * @modules java.base/jdk.internal.misc
+ * @modules java.base/jdk.internal.vm.annotation
+ * @library /test/lib /test/hotspot/jtreg/runtime/cds/appcds /test/hotspot/jtreg/runtime/cds/appcds/test-classes
+ * @build FieldLayoutApp
+ * @run driver ClassFileInstaller -jar field_layout.jar
+ * FieldLayoutApp
+ * FieldLayoutApp$TestObject
+ * FieldLayoutApp$Base1
+ * FieldLayoutApp$Base2
+ * FieldLayoutApp$Child1
+ * FieldLayoutApp$Child2
+ * @run driver FieldLayoutFlags
+ */
+
+import jdk.test.lib.Platform;
+
+public class FieldLayoutFlags {
+ static final String[][] flags = {
+ // Dump time // Run time
+ {}, {}, // All defaults. Ensure that the test itself is correct.
+ {"-XX:FieldsAllocationStyle=0"}, {"-XX:FieldsAllocationStyle=1"},
+ {"-XX:FieldsAllocationStyle=0"}, {"-XX:FieldsAllocationStyle=2"},
+ {"-XX:FieldsAllocationStyle=1"}, {"-XX:FieldsAllocationStyle=0"},
+ {"-XX:FieldsAllocationStyle=1"}, {"-XX:FieldsAllocationStyle=2"},
+ {"-XX:FieldsAllocationStyle=2"}, {"-XX:FieldsAllocationStyle=0"},
+ {"-XX:FieldsAllocationStyle=2"}, {"-XX:FieldsAllocationStyle=1"},
+
+ {"-XX:+CompactFields"}, {"-XX:-CompactFields"},
+ {"-XX:-CompactFields"}, {"-XX:+CompactFields"},
+
+ {"-XX:+EnableContended"}, {"-XX:-EnableContended"},
+ {"-XX:-EnableContended"}, {"-XX:+EnableContended"},
+
+ {"-XX:ContendedPaddingWidth=128"}, {"-XX:ContendedPaddingWidth=256"},
+ {"-XX:ContendedPaddingWidth=256"}, {"-XX:ContendedPaddingWidth=128"},
+ };
+
+ static final String appJar = ClassFileInstaller.getJarPath("field_layout.jar");
+
+ public static void main(String[] args) throws Exception {
+ for (int i = 0; i < flags.length; i += 2) {
+ String[] dumpFlags = flags[i+0];
+ String[] runFlags = flags[i+1];
+
+ System.out.println("====================================================== Cases " + i + " and " + (i + 1));
+ logFlags("Dump:", dumpFlags);
+ logFlags("Run :", runFlags);
+
+ testDump(dontRestrict(dumpFlags));
+ testRun (dontRestrict(runFlags));
+ }
+ }
+
+ static void logFlags(String which, String[] flags) {
+ System.out.print(which);
+ String prefix = " ";
+ for (String s : flags) {
+ System.out.print(prefix);
+ System.out.print(s);
+ prefix = ", ";
+ }
+ System.out.println();
+ }
+
+ // Don't restrict @Contended to trusted classes, so we can use it in FieldLayoutApp
+ static String[] dontRestrict(String args[]) {
+ return TestCommon.concat("-XX:-RestrictContended", args);
+ }
+
+ static void testDump(String[] dumpFlags) throws Exception {
+ String classlist[] = new String[] {
+ "FieldLayoutApp",
+ "FieldLayoutApp$TestObject",
+ "FieldLayoutApp$Base1",
+ "FieldLayoutApp$Base2",
+
+ /*
+ * Note, the following classes are not archived, and will be loaded
+ * dynamically at run time. We check that their field layout is compatible with
+ * their super classes, which are archived.
+ */
+ // "FieldLayoutApp$Child1",
+ // "FieldLayoutApp$Child2",
+ };
+
+ TestCommon.testDump(appJar, classlist, dumpFlags);
+ }
+
+ static void testRun(String[] runFlags) throws Exception {
+ String[] cmds = TestCommon.concat(runFlags, "-cp", appJar);
+ if (Platform.isDebugBuild()) {
+ cmds = TestCommon.concat(cmds, "-XX:+PrintFieldLayout");
+ }
+ cmds = TestCommon.concat(cmds, "FieldLayoutApp");
+
+ TestCommon.run(cmds).assertNormalExit();
+ }
+}
--- a/test/hotspot/jtreg/runtime/cds/appcds/TestCommon.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/runtime/cds/appcds/TestCommon.java Fri Nov 08 20:41:14 2019 -0500
@@ -343,6 +343,7 @@
newFile.renameTo(oldFile);
System.out.println("firstJar = " + firstJar + " Modified");
} else {
+ zipFile.close();
System.out.println("firstJar = " + firstJar);
}
}
--- a/test/hotspot/jtreg/runtime/cds/appcds/sharedStrings/FlagCombo.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/hotspot/jtreg/runtime/cds/appcds/sharedStrings/FlagCombo.java Fri Nov 08 20:41:14 2019 -0500
@@ -38,6 +38,7 @@
* @comment A special test excluding the case that requires JFR
* @requires vm.cds.archived.java.heap & !vm.hasJFR
* @library /test/lib /test/hotspot/jtreg/runtime/cds/appcds
+ * @modules jdk.jartool/sun.tools.jar
* @build HelloString
* @run driver FlagCombo noJfr
*/
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/cds/appcds/test-classes/FieldLayoutApp.java Fri Nov 08 20:41:14 2019 -0500
@@ -0,0 +1,254 @@
+/*
+ * Copyright (c) 2019, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.util.ArrayList;
+import jdk.internal.vm.annotation.Contended;
+
+public class FieldLayoutApp {
+ public static void main(String args[]) {
+ ArrayList<TestObject> list = new ArrayList<>();
+
+ for (int i=0; i<400; i++) {
+ list.add(new Base1());
+ list.add(new Child1());
+ list.add(new Base2());
+ list.add(new Child2());
+ }
+
+ verifyAll(list);
+
+ // Make sure the oopmaps are laid out correctly.
+ System.gc();
+ verifyAll(list);
+ }
+
+ static void verifyAll(ArrayList<TestObject> list) {
+ for (TestObject obj : list) {
+ obj.verify();
+ }
+ }
+
+ static long lastUID = 0;
+ synchronized static long makeUID() {
+ return ++lastUID;
+ }
+
+ synchronized static void verifyUID(long uid) {
+ if (uid <= 0 || uid > lastUID) {
+ error("Unexpected UID " + uid + ", must be > 0 and <= " + lastUID);
+ }
+ }
+
+ static void error(String s) {
+ throw new RuntimeException(s);
+ }
+
+ static void ensure(boolean b) {
+ if (!b) {
+ error("Assertion failed");
+ }
+ }
+
+ static String makeString(long n) {
+ return Long.toString(n);
+ }
+
+ static class TestObject {
+ void verify() {}
+ }
+
+ static class Base1 extends TestObject {
+ byte b1, b2;
+ String s1;
+ byte b3, b4;
+ String s2;
+ long uid;
+ long l1;
+ int i1;
+ long l2;
+ int i2;
+
+ Base1() {
+ uid = makeUID();
+ b1 = 1;
+ b2 = 2;
+ b3 = 3;
+ b4 = 4;
+ s1 = makeString(uid + 1);
+ s2 = makeString(uid + 2);
+ i1 = 101;
+ i2 = 102;
+ l1 = 1001;
+ l2 = 1002;
+ }
+
+ void verify() {
+ super.verify();
+ ensure(b1 == 1);
+ ensure(b2 == 2);
+ ensure(b3 == 3);
+ ensure(b4 == 4);
+ verifyUID(uid);
+ ensure(s1.equals(makeString(uid + 1)));
+ ensure(s2.equals(makeString(uid + 2)));
+ ensure(i1 == 101);
+ ensure(i2 == 102);
+ ensure(l1 == 1001);
+ ensure(l2 == 1002);
+ }
+ }
+
+ // Base1 is archived but Child1 is loaded dynamically at runtime. Base1 may be
+ // archived with different field layout options that those used during runtime.
+ static class Child1 extends Base1 {
+ byte cb1, cb2;
+ String cs1;
+ byte cb3, cb4;
+ String cs2;
+ long cuid;
+ long cl1;
+ int ci1;
+ long cl2;
+ int ci2;
+
+ Child1() {
+ cuid = makeUID();
+ cb1 = 1;
+ cb2 = 2;
+ cb3 = 3;
+ cb4 = 4;
+ cs1 = makeString(cuid + 1);
+ cs2 = makeString(cuid + 2);
+ ci1 = 101;
+ ci2 = 102;
+ cl1 = 1001;
+ cl2 = 1002;
+ }
+
+ void verify() {
+ super.verify();
+ ensure(cb1 == 1);
+ ensure(cb2 == 2);
+ ensure(cb3 == 3);
+ ensure(cb4 == 4);
+ verifyUID(uid);
+ ensure(cs1.equals(makeString(cuid + 1)));
+ ensure(cs2.equals(makeString(cuid + 2)));
+ ensure(ci1 == 101);
+ ensure(ci2 == 102);
+ ensure(cl1 == 1001);
+ ensure(cl2 == 1002);
+
+ // Check the fields declared by the super class:
+ ensure(b1 == 1); // javac should generate a FieldRef of FieldLayoutApp$Child1.b1:B,
+ // even though b1 is declared in the super class.
+ ensure(b2 == 2);
+ ensure(b3 == 3);
+ ensure(b4 == 4);
+ verifyUID(uid);
+ ensure(s1.equals(makeString(uid + 1)));
+ ensure(s2.equals(makeString(uid + 2)));
+
+ ensure(i1 == 101);
+ ensure(i2 == 102);
+ ensure(l1 == 1001);
+ ensure(l2 == 1002);
+ }
+ }
+
+ // Same as Base1 - minus the i1, i2, l1, l2 fields, plus some @Contended annotations
+ static class Base2 extends TestObject {
+ byte b1, b2;
+ String s1;
+ @Contended byte b3, b4;
+ @Contended String s2;
+ long uid;
+
+ Base2() {
+ uid = makeUID();
+ b1 = 1;
+ b2 = 2;
+ b3 = 3;
+ b4 = 4;
+ s1 = makeString(uid + 1);
+ s2 = makeString(uid + 2);
+ }
+
+ void verify() {
+ super.verify();
+ ensure(b1 == 1);
+ ensure(b2 == 2);
+ ensure(b3 == 3);
+ ensure(b4 == 4);
+ verifyUID(uid);
+ ensure(s1.equals(makeString(uid + 1)));
+ ensure(s2.equals(makeString(uid + 2)));
+ }
+ }
+
+ // Same as Child2 - minus the ci1, ci2, cl1, cl2 fields, plus some @Contended annotations
+ //
+ // Base2 is archived but Child2 is loaded dynamically at runtime. Base2 may be
+ // archived with different field layout options that those used during runtime.
+ static class Child2 extends Base2 {
+ byte cb1, cb2;
+ @Contended String cs1;
+ byte cb3, cb4;
+ String cs2;
+ @Contended long cuid;
+
+ Child2() {
+ cuid = makeUID();
+ cb1 = 1;
+ cb2 = 2;
+ cb3 = 3;
+ cb4 = 4;
+ cs1 = makeString(cuid + 1);
+ cs2 = makeString(cuid + 2);
+ }
+
+ void verify() {
+ super.verify();
+ ensure(cb1 == 1);
+ ensure(cb2 == 2);
+ ensure(cb3 == 3);
+ ensure(cb4 == 4);
+ verifyUID(uid);
+ ensure(cs1.equals(makeString(cuid + 1)));
+ ensure(cs2.equals(makeString(cuid + 2)));
+
+ // Check the fields declared by the super class:
+ ensure(b1 == 1); // javac should generate a FieldRef of FieldLayoutApp$Child2.b1:B,
+ // even though b1 is declared in the super class.
+ ensure(b2 == 2);
+ ensure(b3 == 3);
+ ensure(b4 == 4);
+ verifyUID(uid);
+ ensure(s1.equals(makeString(uid + 1)));
+ ensure(s2.equals(makeString(uid + 2)));
+ }
+ }
+}
+
+
--- a/test/hotspot/jtreg/serviceability/jvmti/ClassStatus/ClassStatus.java Fri Nov 08 16:48:20 2019 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,92 +0,0 @@
-/*
- * Copyright (c) 2019, Oracle and/or its affiliates. All rights reserved.
- * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
- *
- * This code is free software; you can redistribute it and/or modify it
- * under the terms of the GNU General Public License version 2 only, as
- * published by the Free Software Foundation.
- *
- * This code is distributed in the hope that it will be useful, but WITHOUT
- * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
- * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
- * version 2 for more details (a copy is included in the LICENSE file that
- * accompanied this code).
- *
- * You should have received a copy of the GNU General Public License version
- * 2 along with this work; if not, write to the Free Software Foundation,
- * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
- *
- * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
- * or visit www.oracle.com if you need additional information or have any
- * questions.
- */
-
-/**
- * @test
- * @bug 8212117
- * @summary Verify JVMTI GetClassStatus returns CLASS_PREPARE after call to Class.forName()
- * @run main/othervm/native -agentlib:ClassStatus ClassStatus
- */
-
-
-public class ClassStatus {
- static {
- try {
- System.out.println("ClassStatus static block");
- System.loadLibrary("ClassStatus");
- } catch (UnsatisfiedLinkError ule) {
- System.err.println("Could not load ClassStatus library");
- System.err.println("java.library.path: "
- + System.getProperty("java.library.path"));
- throw ule;
- }
- }
-
- static native int check(Class klass);
-
- public static void main(String[] args) throws ClassNotFoundException {
- ClassLoader loader = ClassStatus.class.getClassLoader();
- Module module = loader.getUnnamedModule();
-
- // Load class, but don't initialize it
- Class foo2 = Class.forName(module, "Foo2");
- Class foo3 = Class.forName("Foo3", false, loader);
-
- System.out.println("Loaded: " + foo2);
- System.out.println("Loaded: " + foo3);
-
- int status2 = check(foo2);
- int status3 = check(foo3);
-
- new Foo2().bar();
- new Foo3().bar();
-
- if (status2 != 0) {
- System.out.println("The agent returned non-zero exit status for Foo2: " + status2);
- }
- if (status3 != 0) {
- System.out.println("The agent returned non-zero exit status for Foo3: " + status3);
- }
- if (status2 != 0 || status3 != 0) {
- throw new RuntimeException("Non-zero status returned from the agent");
- }
- }
-}
-
-class Foo2 {
- static {
- System.out.println("Foo2 is initialized");
- }
- void bar() {
- System.out.println("Foo2.bar() is called");
- }
-}
-
-class Foo3 {
- static {
- System.out.println("Foo3 is initialized");
- }
- void bar() {
- System.out.println("Foo3.bar() is called");
- }
-}
--- a/test/hotspot/jtreg/serviceability/jvmti/ClassStatus/libClassStatus.c Fri Nov 08 16:48:20 2019 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,173 +0,0 @@
-/*
- * Copyright (c) 2019, Oracle and/or its affiliates. All rights reserved.
- * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
- *
- * This code is free software; you can redistribute it and/or modify it
- * under the terms of the GNU General Public License version 2 only, as
- * published by the Free Software Foundation.
- *
- * This code is distributed in the hope that it will be useful, but WITHOUT
- * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
- * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
- * version 2 for more details (a copy is included in the LICENSE file that
- * accompanied this code).
- *
- * You should have received a copy of the GNU General Public License version
- * 2 along with this work; if not, write to the Free Software Foundation,
- * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
- *
- * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
- * or visit www.oracle.com if you need additional information or have any
- * questions.
- */
-
-#include <stdint.h>
-#include <stdio.h>
-#include <stdlib.h>
-#include <string.h>
-#include "jvmti.h"
-
-#ifdef __cplusplus
-extern "C" {
-#endif
-
-#ifndef JNI_ENV_ARG
-
-#ifdef __cplusplus
-#define JNI_ENV_ARG(x, y) y
-#define JNI_ENV_PTR(x) x
-#else
-#define JNI_ENV_ARG(x,y) x, y
-#define JNI_ENV_PTR(x) (*x)
-#endif
-
-#endif
-
-#define PASSED 0
-#define FAILED 2
-
-static jvmtiEnv* jvmti = NULL;
-
-static jint Agent_Initialize(JavaVM *jvm, char *options, void *reserved);
-
-JNIEXPORT jint JNICALL
-Agent_OnLoad(JavaVM *jvm, char *options, void *reserved) {
- return Agent_Initialize(jvm, options, reserved);
-}
-
-JNIEXPORT jint JNICALL
-Agent_OnAttach(JavaVM *jvm, char *options, void *reserved) {
- return Agent_Initialize(jvm, options, reserved);
-}
-
-JNIEXPORT jint JNICALL
-JNI_OnLoad(JavaVM *jvm, void *reserved) {
- return JNI_VERSION_9;
-}
-
-static void
-check_jvmti_error(jvmtiEnv *jvmti, char* fname, jvmtiError err) {
- if (err != JVMTI_ERROR_NONE) {
- printf(" ## %s error: %d\n", fname, err);
- fflush(0);
- exit(err);
- }
-}
-
-static char*
-get_class_signature(jvmtiEnv *jvmti, jclass klass) {
- char* sign = NULL;
- jvmtiError err = (*jvmti)->GetClassSignature(jvmti, klass, &sign, NULL);
-
- check_jvmti_error(jvmti, "GetClassSignature", err);
- return sign;
-}
-
-static jboolean
-is_class_status_prepared(jvmtiEnv *jvmti, jclass klass) {
- char* sign = get_class_signature(jvmti, klass);
- jint status = 0;
- jvmtiError err = (*jvmti)->GetClassStatus(jvmti, klass, &status);
-
- check_jvmti_error(jvmti, "GetClassStatus", err);
- printf(" Class %s status: 0x%08x\n", sign, status);
- printf(" Class %s is prepared: %d\n", sign, (status & JVMTI_CLASS_STATUS_PREPARED) != 0);
- fflush(0);
-
- return (status & JVMTI_CLASS_STATUS_PREPARED) != 0;
-}
-
-static jboolean
-is_class_in_loaded_classes(JNIEnv *env, jclass klass) {
- char* sign = get_class_signature(jvmti, klass);
- jint class_count = 0;
- jclass* classes = NULL;
- jvmtiError err = (*jvmti)->GetLoadedClasses(jvmti, &class_count, &classes);
-
- check_jvmti_error(jvmti, "GetLoadedClasses", err);
-
- for (int i = 0; i < class_count; i++) {
- jclass cls = classes[i];
- jboolean same = (*env)->IsSameObject(env, cls, klass);
- if (same) {
- printf("Found class %s in the list of loaded classes\n", sign);
- fflush(0);
- return JNI_TRUE;
- }
- }
- printf("Error: Have not found class %s in the list of loaded classes\n", sign);
- fflush(0);
- return JNI_FALSE;
-}
-
-static void JNICALL
-ClassPrepare(jvmtiEnv *jvmti, JNIEnv *env, jthread thread, jclass klass) {
- char* sign = get_class_signature(jvmti, klass);
-
- sign = (sign == NULL) ? "NULL" : sign;
-
- if (strcmp(sign, "LFoo2;") == 0 || strcmp(sign, "LFoo3;") == 0) {
- printf("ClassPrepare event for class: %s\n", sign);
- fflush(0);
- }
-}
-
-static jint
-Agent_Initialize(JavaVM *jvm, char *options, void *reserved) {
- jvmtiError err;
- jint size;
- jint res;
- jvmtiEventCallbacks callbacks;
-
- printf("Agent_Initialize started\n");
- fflush(0);
- res = JNI_ENV_PTR(jvm)->GetEnv(JNI_ENV_ARG(jvm, (void **) &jvmti), JVMTI_VERSION_9);
- if (res != JNI_OK || jvmti == NULL) {
- printf("## Agent_Initialize: Error in GetEnv: res: %d, jvmti env: %p\n", res, jvmti);
- return JNI_ERR;
- }
-
- size = (jint)sizeof(callbacks);
- memset(&callbacks, 0, size);
- callbacks.ClassPrepare = ClassPrepare;
-
- err = (*jvmti)->SetEventCallbacks(jvmti, &callbacks, size);
- check_jvmti_error(jvmti, "## Agent_Initialize: SetEventCallbacks", err);
-
- err = (*jvmti)->SetEventNotificationMode(jvmti, JVMTI_ENABLE, JVMTI_EVENT_CLASS_PREPARE, NULL);
- check_jvmti_error(jvmti, "## Agent_Initialize: SetEventNotificationMode CLASS_PREPARE", err);
- return JNI_OK;
-}
-
-JNIEXPORT jint JNICALL
-Java_ClassStatus_check(JNIEnv *env, jclass cls, jclass klass) {
- if (is_class_in_loaded_classes(env, klass) != JNI_TRUE ||
- is_class_status_prepared(jvmti, klass) != JNI_TRUE) {
- return FAILED;
- }
- return PASSED;
-}
-
-#ifdef __cplusplus
-}
-#endif
--- a/test/jdk/java/net/httpclient/AbstractThrowingPublishers.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/jdk/java/net/httpclient/AbstractThrowingPublishers.java Fri Nov 08 20:41:14 2019 -0500
@@ -1,5 +1,5 @@
/*
- * Copyright (c) 2018, Oracle and/or its affiliates. All rights reserved.
+ * Copyright (c) 2018, 2019, Oracle and/or its affiliates. All rights reserved.
* DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
*
* This code is free software; you can redistribute it and/or modify it
@@ -25,8 +25,10 @@
import com.sun.net.httpserver.HttpsConfigurator;
import com.sun.net.httpserver.HttpsServer;
import jdk.test.lib.net.SimpleSSLContext;
+import org.testng.ITestContext;
import org.testng.annotations.AfterClass;
import org.testng.annotations.AfterTest;
+import org.testng.annotations.BeforeMethod;
import org.testng.annotations.BeforeTest;
import org.testng.annotations.DataProvider;
import org.testng.annotations.Test;
@@ -132,6 +134,17 @@
}
}
+ protected boolean stopAfterFirstFailure() {
+ return Boolean.getBoolean("jdk.internal.httpclient.debug");
+ }
+
+ @BeforeMethod
+ void beforeMethod(ITestContext context) {
+ if (stopAfterFirstFailure() && context.getFailedTests().size() > 0) {
+ throw new RuntimeException("some tests failed");
+ }
+ }
+
@AfterClass
static final void printFailedTests() {
out.println("\n=========================");
@@ -217,7 +230,10 @@
}
@DataProvider(name = "subscribeProvider")
- public Object[][] subscribeProvider() {
+ public Object[][] subscribeProvider(ITestContext context) {
+ if (stopAfterFirstFailure() && context.getFailedTests().size() > 0) {
+ return new Object[0][];
+ }
return variants(List.of(
new UncheckedCustomExceptionThrower(),
new UncheckedIOExceptionThrower()),
@@ -225,7 +241,10 @@
}
@DataProvider(name = "requestProvider")
- public Object[][] requestProvider() {
+ public Object[][] requestProvider(ITestContext context) {
+ if (stopAfterFirstFailure() && context.getFailedTests().size() > 0) {
+ return new Object[0][];
+ }
return variants(List.of(
new UncheckedCustomExceptionThrower(),
new UncheckedIOExceptionThrower()),
@@ -233,7 +252,10 @@
}
@DataProvider(name = "nextRequestProvider")
- public Object[][] nextRequestProvider() {
+ public Object[][] nextRequestProvider(ITestContext context) {
+ if (stopAfterFirstFailure() && context.getFailedTests().size() > 0) {
+ return new Object[0][];
+ }
return variants(List.of(
new UncheckedCustomExceptionThrower(),
new UncheckedIOExceptionThrower()),
@@ -241,28 +263,40 @@
}
@DataProvider(name = "beforeCancelProviderIO")
- public Object[][] beforeCancelProviderIO() {
+ public Object[][] beforeCancelProviderIO(ITestContext context) {
+ if (stopAfterFirstFailure() && context.getFailedTests().size() > 0) {
+ return new Object[0][];
+ }
return variants(List.of(
new UncheckedIOExceptionThrower()),
EnumSet.of(Where.BEFORE_CANCEL));
}
@DataProvider(name = "afterCancelProviderIO")
- public Object[][] afterCancelProviderIO() {
+ public Object[][] afterCancelProviderIO(ITestContext context) {
+ if (stopAfterFirstFailure() && context.getFailedTests().size() > 0) {
+ return new Object[0][];
+ }
return variants(List.of(
new UncheckedIOExceptionThrower()),
EnumSet.of(Where.AFTER_CANCEL));
}
@DataProvider(name = "beforeCancelProviderCustom")
- public Object[][] beforeCancelProviderCustom() {
+ public Object[][] beforeCancelProviderCustom(ITestContext context) {
+ if (stopAfterFirstFailure() && context.getFailedTests().size() > 0) {
+ return new Object[0][];
+ }
return variants(List.of(
new UncheckedCustomExceptionThrower()),
EnumSet.of(Where.BEFORE_CANCEL));
}
@DataProvider(name = "afterCancelProviderCustom")
- public Object[][] afterCancelProvider() {
+ public Object[][] afterCancelProvider(ITestContext context) {
+ if (stopAfterFirstFailure() && context.getFailedTests().size() > 0) {
+ return new Object[0][];
+ }
return variants(List.of(
new UncheckedCustomExceptionThrower()),
EnumSet.of(Where.AFTER_CANCEL));
--- a/test/jdk/java/net/httpclient/AbstractThrowingPushPromises.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/jdk/java/net/httpclient/AbstractThrowingPushPromises.java Fri Nov 08 20:41:14 2019 -0500
@@ -42,11 +42,12 @@
*/
import jdk.test.lib.net.SimpleSSLContext;
+import org.testng.ITestContext;
import org.testng.annotations.AfterTest;
import org.testng.annotations.AfterClass;
+import org.testng.annotations.BeforeMethod;
import org.testng.annotations.BeforeTest;
import org.testng.annotations.DataProvider;
-import org.testng.annotations.Test;
import javax.net.ssl.SSLContext;
import java.io.BufferedReader;
@@ -146,6 +147,17 @@
}
}
+ protected boolean stopAfterFirstFailure() {
+ return Boolean.getBoolean("jdk.internal.httpclient.debug");
+ }
+
+ @BeforeMethod
+ void beforeMethod(ITestContext context) {
+ if (stopAfterFirstFailure() && context.getFailedTests().size() > 0) {
+ throw new RuntimeException("some tests failed");
+ }
+ }
+
@AfterClass
static final void printFailedTests() {
out.println("\n=========================");
@@ -208,27 +220,38 @@
private Object[][] variants(List<Thrower> throwers) {
String[] uris = uris();
- Object[][] result = new Object[uris.length * 2 * throwers.size()][];
+ // reduce traces by always using the same client if
+ // stopAfterFirstFailure is requested.
+ List<Boolean> sameClients = stopAfterFirstFailure()
+ ? List.of(true)
+ : List.of(false, true);
+ Object[][] result = new Object[uris.length * sameClients.size() * throwers.size()][];
int i = 0;
for (Thrower thrower : throwers) {
- for (boolean sameClient : List.of(false, true)) {
+ for (boolean sameClient : sameClients) {
for (String uri : uris()) {
result[i++] = new Object[]{uri, sameClient, thrower};
}
}
}
- assert i == uris.length * 2 * throwers.size();
+ assert i == uris.length * sameClients.size() * throwers.size();
return result;
}
@DataProvider(name = "ioVariants")
- public Object[][] ioVariants() {
+ public Object[][] ioVariants(ITestContext context) {
+ if (stopAfterFirstFailure() && context.getFailedTests().size() > 0) {
+ return new Object[0][];
+ }
return variants(List.of(
new UncheckedIOExceptionThrower()));
}
@DataProvider(name = "customVariants")
- public Object[][] customVariants() {
+ public Object[][] customVariants(ITestContext context) {
+ if (stopAfterFirstFailure() && context.getFailedTests().size() > 0) {
+ return new Object[0][];
+ }
return variants(List.of(
new UncheckedCustomExceptionThrower()));
}
--- a/test/jdk/java/net/httpclient/AbstractThrowingSubscribers.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/jdk/java/net/httpclient/AbstractThrowingSubscribers.java Fri Nov 08 20:41:14 2019 -0500
@@ -1,5 +1,5 @@
/*
- * Copyright (c) 2018, Oracle and/or its affiliates. All rights reserved.
+ * Copyright (c) 2018, 2019, Oracle and/or its affiliates. All rights reserved.
* DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
*
* This code is free software; you can redistribute it and/or modify it
@@ -25,8 +25,10 @@
import com.sun.net.httpserver.HttpsConfigurator;
import com.sun.net.httpserver.HttpsServer;
import jdk.test.lib.net.SimpleSSLContext;
+import org.testng.ITestContext;
import org.testng.annotations.AfterTest;
import org.testng.annotations.AfterClass;
+import org.testng.annotations.BeforeMethod;
import org.testng.annotations.BeforeTest;
import org.testng.annotations.DataProvider;
import org.testng.annotations.Test;
@@ -131,6 +133,17 @@
}
}
+ protected boolean stopAfterFirstFailure() {
+ return Boolean.getBoolean("jdk.internal.httpclient.debug");
+ }
+
+ @BeforeMethod
+ void beforeMethod(ITestContext context) {
+ if (stopAfterFirstFailure() && context.getFailedTests().size() > 0) {
+ throw new RuntimeException("some tests failed");
+ }
+ }
+
@AfterClass
static final void printFailedTests() {
out.println("\n=========================");
@@ -182,7 +195,10 @@
}
@DataProvider(name = "variants")
- public Object[][] variants() {
+ public Object[][] variants(ITestContext context) {
+ if (stopAfterFirstFailure() && context.getFailedTests().size() > 0) {
+ return new Object[0][];
+ }
String[] uris = uris();
Object[][] result = new Object[uris.length * 2 * 2][];
int i = 0;
--- a/test/jdk/java/net/httpclient/ShortRequestBody.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/jdk/java/net/httpclient/ShortRequestBody.java Fri Nov 08 20:41:14 2019 -0500
@@ -1,5 +1,5 @@
/*
- * Copyright (c) 2015, 2018, Oracle and/or its affiliates. All rights reserved.
+ * Copyright (c) 2015, 2019, Oracle and/or its affiliates. All rights reserved.
* DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
*
* This code is free software; you can redistribute it and/or modify it
@@ -29,6 +29,7 @@
import java.net.InetSocketAddress;
import java.net.ServerSocket;
import java.net.Socket;
+import java.net.SocketException;
import java.net.URI;
import java.net.http.HttpClient;
import java.net.http.HttpRequest;
@@ -76,6 +77,7 @@
BYTE_ARRAY_BODY.length,
fileSize(FILE_BODY) };
static final int[] BODY_OFFSETS = new int[] { 0, +1, -1, +2, -2, +3, -3 };
+ static final String MARKER = "ShortRequestBody";
// A delegating Body Publisher. Subtypes will have a concrete body type.
static abstract class AbstractDelegateRequestBody
@@ -134,7 +136,7 @@
try (Server server = new Server()) {
for (Supplier<HttpClient> cs : clientSuppliers) {
err.println("\n---- next supplier ----\n");
- URI uri = new URI("http://localhost:" + server.getPort() + "/");
+ URI uri = new URI("http://localhost:" + server.getPort() + "/" + MARKER);
// sanity ( 6 requests to keep client and server offsets easy to workout )
success(cs, uri, new StringRequestBody(STRING_BODY, 0));
@@ -248,44 +250,56 @@
int offset = 0;
while (!closed) {
+ err.println("Server: waiting for connection");
try (Socket s = ss.accept()) {
err.println("Server: got connection");
InputStream is = s.getInputStream();
- readRequestHeaders(is);
+ try {
+ String headers = readRequestHeaders(is);
+ if (headers == null) continue;
+ } catch (SocketException ex) {
+ err.println("Ignoring unexpected exception while reading headers: " + ex);
+ ex.printStackTrace(err);
+ // proceed in order to update count etc..., even though
+ // we know that read() will fail;
+ }
byte[] ba = new byte[1024];
int length = BODY_LENGTHS[count % 3];
length += BODY_OFFSETS[offset];
err.println("Server: count=" + count + ", offset=" + offset);
err.println("Server: expecting " +length+ " bytes");
- int read = is.readNBytes(ba, 0, length);
- err.println("Server: actually read " + read + " bytes");
-
- // Update the counts before replying, to prevent the
- // client-side racing reset with this thread.
- count++;
- if (count % 6 == 0) // 6 is the number of failure requests per offset
- offset++;
- if (count % 42 == 0) {
- count = 0; // reset, for second iteration
- offset = 0;
+ int read = 0;
+ try {
+ read = is.readNBytes(ba, 0, length);
+ err.println("Server: actually read " + read + " bytes");
+ } finally {
+ // Update the counts before replying, to prevent the
+ // client-side racing reset with this thread.
+ count++;
+ if (count % 6 == 0) // 6 is the number of failure requests per offset
+ offset++;
+ if (count % 42 == 0) {
+ count = 0; // reset, for second iteration
+ offset = 0;
+ }
}
-
if (read < length) {
// no need to reply, client has already closed
// ensure closed
if (is.read() != -1)
- new AssertionError("Unexpected read");
+ new AssertionError("Unexpected read: " + read);
} else {
OutputStream os = s.getOutputStream();
err.println("Server: writing "
+ RESPONSE.getBytes(US_ASCII).length + " bytes");
os.write(RESPONSE.getBytes(US_ASCII));
}
-
- } catch (IOException e) {
- if (!closed)
- System.out.println("Unexpected" + e);
+ } catch (Throwable e) {
+ if (!closed) {
+ err.println("Unexpected: " + e);
+ e.printStackTrace();
+ }
}
}
}
@@ -306,9 +320,14 @@
static final byte[] requestEnd = new byte[] {'\r', '\n', '\r', '\n' };
// Read until the end of a HTTP request headers
- static void readRequestHeaders(InputStream is) throws IOException {
- int requestEndCount = 0, r;
+ static String readRequestHeaders(InputStream is) throws IOException {
+ int requestEndCount = 0, r, eol = -1;
+ StringBuilder headers = new StringBuilder();
while ((r = is.read()) != -1) {
+ if (r == '\r' && eol < 0) {
+ eol = headers.length();
+ }
+ headers.append((char) r);
if (r == requestEnd[requestEndCount]) {
requestEndCount++;
if (requestEndCount == 4) {
@@ -318,6 +337,11 @@
requestEndCount = 0;
}
}
+
+ if (eol <= 0) return null;
+ String requestLine = headers.toString().substring(0, eol);
+ if (!requestLine.contains(MARKER)) return null;
+ return headers.toString();
}
static int fileSize(Path p) {
--- a/test/jdk/java/net/httpclient/ShortResponseBody.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/jdk/java/net/httpclient/ShortResponseBody.java Fri Nov 08 20:41:14 2019 -0500
@@ -57,6 +57,8 @@
import java.util.concurrent.atomic.AtomicLong;
import java.util.stream.Stream;
import jdk.test.lib.net.SimpleSSLContext;
+import org.testng.ITestContext;
+import org.testng.annotations.BeforeMethod;
import org.testng.annotations.AfterTest;
import org.testng.annotations.BeforeTest;
import org.testng.annotations.DataProvider;
@@ -106,6 +108,13 @@
};
final ExecutorService service = Executors.newCachedThreadPool(factory);
+ @BeforeMethod
+ void beforeMethod(ITestContext context) {
+ if (context.getFailedTests().size() > 0) {
+ throw new RuntimeException("some tests failed");
+ }
+ }
+
@DataProvider(name = "sanity")
public Object[][] sanity() {
return new Object[][]{
@@ -129,7 +138,7 @@
}
@DataProvider(name = "uris")
- public Object[][] variants() {
+ public Object[][] variants(ITestContext context) {
String[][] cases = new String[][] {
// The length query string is the total number of bytes in the reply,
// including headers, before the server closes the connection. The
@@ -188,6 +197,13 @@
{ httpsURIClsImed, "no bytes"},
};
+ if (context.getFailedTests().size() > 0) {
+ // Shorten the log output by preventing useless
+ // skip traces to be printed for subsequent methods
+ // if one of the previous @Test method has failed.
+ return new Object[0][];
+ }
+
List<Object[]> list = new ArrayList<>();
Arrays.asList(cases).stream()
.map(e -> new Object[] {e[0], e[1], true}) // reuse client
@@ -469,7 +485,9 @@
try {
ss.close();
} catch (IOException e) {
- throw new UncheckedIOException("Unexpected", e);
+ out.println("Unexpected exception while closing server: " + e);
+ e.printStackTrace(out);
+ throw new UncheckedIOException("Unexpected: ", e);
}
}
}
@@ -494,9 +512,12 @@
((SSLSocket)s).startHandshake();
}
out.println("Server: got connection, closing immediately ");
- } catch (IOException e) {
- if (!closed)
- throw new UncheckedIOException("Unexpected", e);
+ } catch (Throwable e) {
+ if (!closed) {
+ out.println("Unexpected exception in server: " + e);
+ e.printStackTrace(out);
+ throw new RuntimeException("Unexpected: ", e);
+ }
}
}
}
@@ -565,9 +586,12 @@
os.write(responseBytes[i]);
os.flush();
}
- } catch (IOException e) {
- if (!closed)
- throw new UncheckedIOException("Unexpected", e);
+ } catch (Throwable e) {
+ if (!closed) {
+ out.println("Unexpected exception in server: " + e);
+ e.printStackTrace(out);
+ throw new RuntimeException("Unexpected: " + e, e);
+ }
}
}
}
--- a/test/jdk/java/nio/channels/Selector/SelectWithConsumer.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/jdk/java/nio/channels/Selector/SelectWithConsumer.java Fri Nov 08 20:41:14 2019 -0500
@@ -1,5 +1,5 @@
/*
- * Copyright (c) 2018, Oracle and/or its affiliates. All rights reserved.
+ * Copyright (c) 2018, 2019, Oracle and/or its affiliates. All rights reserved.
* DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
*
* This code is free software; you can redistribute it and/or modify it
@@ -197,19 +197,21 @@
// write to sink to ensure that the source is readable
sink.write(messageBuffer());
+ // wait for key1 to be readable
+ sel.select();
+ assertTrue(key2.isWritable());
+ while (!key1.isReadable()) {
+ Thread.sleep(20);
+ sel.select();
+ }
+
var counter = new AtomicInteger();
// select(Consumer)
counter.set(0);
int n = sel.select(k -> {
+ assertTrue(k == key1 || k == key2);
counter.incrementAndGet();
- if (k == key1) {
- assertTrue(k.isReadable());
- } else if (k == key2) {
- assertTrue(k.isWritable());
- } else {
- assertTrue(false);
- }
});
assertTrue(n == 2);
assertTrue(counter.get() == 2);
@@ -217,14 +219,8 @@
// select(Consumer, timeout)
counter.set(0);
n = sel.select(k -> {
+ assertTrue(k == key1 || k == key2);
counter.incrementAndGet();
- if (k == key1) {
- assertTrue(k.isReadable());
- } else if (k == key2) {
- assertTrue(k.isWritable());
- } else {
- assertTrue(false);
- }
}, 1000);
assertTrue(n == 2);
assertTrue(counter.get() == 2);
@@ -232,14 +228,8 @@
// selectNow(Consumer)
counter.set(0);
n = sel.selectNow(k -> {
+ assertTrue(k == key1 || k == key2);
counter.incrementAndGet();
- if (k == key1) {
- assertTrue(k.isReadable());
- } else if (k == key2) {
- assertTrue(k.isWritable());
- } else {
- assertTrue(false);
- }
});
assertTrue(n == 2);
assertTrue(counter.get() == 2);
--- a/test/jdk/java/nio/file/etc/MacVolumesTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/jdk/java/nio/file/etc/MacVolumesTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -109,7 +109,7 @@
private static final void checkDataVolume() throws IOException {
System.out.format("--- Checking data volume %s ---%n", DATA_VOLUME);
- Path data = Path.of(DATA_VOLUME, "tmp");
+ Path data = Path.of(DATA_VOLUME, "private", "tmp");
if (Files.getFileStore(data).isReadOnly()) {
throw new RuntimeException("Data volume is read-only");
}
--- a/test/jdk/java/util/Locale/LocaleProviders.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/jdk/java/util/Locale/LocaleProviders.java Fri Nov 08 20:41:14 2019 -0500
@@ -29,6 +29,7 @@
public class LocaleProviders {
private static final boolean IS_WINDOWS = System.getProperty("os.name").startsWith("Windows");
+ private static final boolean IS_MAC = System.getProperty("os.name").startsWith("Mac");
public static void main(String[] args) {
String methodName = args[0];
@@ -82,6 +83,10 @@
bug8228465Test();
break;
+ case "bug8232871Test":
+ bug8232871Test();
+ break;
+
default:
throw new RuntimeException("Test method '"+methodName+"' not found.");
}
@@ -286,4 +291,40 @@
}
}
}
+
+ static void bug8232871Test() {
+ LocaleProviderAdapter lda = LocaleProviderAdapter.getAdapter(CalendarNameProvider.class, Locale.US);
+ LocaleProviderAdapter.Type type = lda.getAdapterType();
+ var lang = Locale.getDefault().getLanguage();
+ var cal = Calendar.getInstance();
+ var calType = cal.getCalendarType();
+ var expected = "\u4ee4\u548c1\u5e745\u67081\u65e5 \u6c34\u66dc\u65e5 \u5348\u524d0:00:00 \u30a2\u30e1\u30ea\u30ab\u592a\u5e73\u6d0b\u590f\u6642\u9593";
+
+ if (type == LocaleProviderAdapter.Type.HOST &&
+ IS_MAC &&
+ lang.equals("ja") &&
+ calType.equals("japanese")) {
+ cal.set(1, 4, 1, 0, 0, 0);
+ cal.setTimeZone(TimeZone.getTimeZone("America/Los_Angeles"));
+ DateFormat df = DateFormat.getDateTimeInstance(DateFormat.FULL, DateFormat.FULL,
+ Locale.JAPAN);
+ df.setCalendar(cal);
+ var result = df.format(cal.getTime());
+ if (result.equals(expected)) {
+ System.out.println("bug8232871Test succeeded.");
+ } else {
+ throw new RuntimeException(
+ "Japanese calendar names mismatch. result: " +
+ result +
+ ", expected: " +
+ expected);
+ }
+ } else {
+ System.out.println("Test ignored. Either :-\n" +
+ "OS is not macOS, or\n" +
+ "provider is not HOST: " + type + ", or\n" +
+ "Language is not Japanese: " + lang + ", or\n" +
+ "native calendar is not JapaneseCalendar: " + calType);
+ }
+ }
}
--- a/test/jdk/java/util/Locale/LocaleProvidersRun.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/jdk/java/util/Locale/LocaleProvidersRun.java Fri Nov 08 20:41:14 2019 -0500
@@ -25,7 +25,7 @@
* @test
* @bug 6336885 7196799 7197573 7198834 8000245 8000615 8001440 8008577
* 8010666 8013086 8013233 8013903 8015960 8028771 8054482 8062006
- * 8150432 8215913 8220227 8228465
+ * 8150432 8215913 8220227 8228465 8232871
* @summary tests for "java.locale.providers" system property
* @library /test/lib
* @build LocaleProviders
@@ -156,6 +156,9 @@
//testing 8228465 fix. (Windows only)
testRun("HOST", "bug8228465Test", "", "", "");
+
+ //testing 8232871 fix. (macOS only)
+ testRun("HOST", "bug8232871Test", "", "", "");
}
private static void testRun(String prefList, String methodName,
--- a/test/jdk/jdk/jfr/event/gc/configuration/TestGCHeapConfigurationEventWith32BitOops.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/jdk/jdk/jfr/event/gc/configuration/TestGCHeapConfigurationEventWith32BitOops.java Fri Nov 08 20:41:14 2019 -0500
@@ -30,6 +30,20 @@
import jdk.test.lib.jfr.GCHelper;
import sun.hotspot.WhiteBox;
+/*
+ * @test TestGCHeapConfigurationEventWith32BitOops
+ * @key jfr
+ * @requires vm.hasJFR
+ * @requires vm.gc == "Parallel" | vm.gc == null
+ * @requires os.family == "linux" | os.family == "windows"
+ * @requires sun.arch.data.model == "64"
+ * @library /test/lib /test/jdk
+ * @build sun.hotspot.WhiteBox
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @run main/othervm -XX:+UnlockExperimentalVMOptions -XX:-UseFastUnorderedTimeStamps -XX:+UseParallelGC -XX:+UseParallelOldGC -XX:+UseCompressedOops -Xmx100m -Xms100m -XX:InitialHeapSize=100m -Xbootclasspath/a:. -XX:+UnlockDiagnosticVMOptions -XX:+WhiteBoxAPI jdk.jfr.event.gc.configuration.TestGCHeapConfigurationEventWith32BitOops
+ */
+
+
/* See the shell script wrapper for the flags used when invoking the JVM */
public class TestGCHeapConfigurationEventWith32BitOops extends GCHeapConfigurationEventTester {
public static void main(String[] args) throws Exception {
--- a/test/jdk/jdk/jfr/event/gc/configuration/TestGCHeapConfigurationEventWith32BitOops.sh Fri Nov 08 16:48:20 2019 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,61 +0,0 @@
-#
-# Copyright (c) 2013, 2018, Oracle and/or its affiliates. All rights reserved.
-# DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
-#
-# This code is free software; you can redistribute it and/or modify it
-# under the terms of the GNU General Public License version 2 only, as
-# published by the Free Software Foundation.
-#
-# This code is distributed in the hope that it will be useful, but WITHOUT
-# ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
-# FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
-# version 2 for more details (a copy is included in the LICENSE file that
-# accompanied this code).
-#
-# You should have received a copy of the GNU General Public License version
-# 2 along with this work; if not, write to the Free Software Foundation,
-# Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
-#
-# Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
-# or visit www.oracle.com if you need additional information or have any
-# questions.
-#
-# @test TestGCHeapConfigurationEventWith32BitOops
-# @key jfr
-# @requires vm.hasJFR
-# @requires vm.gc == "Parallel" | vm.gc == null
-# @library /test/lib /test/jdk
-# @build jdk.jfr.event.gc.configuration.TestGCHeapConfigurationEventWith32BitOops sun.hotspot.WhiteBox
-# @run main ClassFileInstaller sun.hotspot.WhiteBox
-# @run shell TestGCHeapConfigurationEventWith32BitOops.sh
-
-uses_64_bit_testjava() {
- ${TESTJAVA}/bin/java ${TESTVMOPTS} -version 2>&1 | grep '64-Bit' > /dev/null
-}
-
-uses_windows_or_linux() {
- case `uname -s` in
- Linux | CYGWIN* | Windows* )
- return 0
- ;;
- esac
- return 1
-}
-
-TEST='jdk.jfr.event.gc.configuration.TestGCHeapConfigurationEventWith32BitOops'
-
-OPTIONS='-XX:+UnlockExperimentalVMOptions -XX:-UseFastUnorderedTimeStamps -XX:+UseParallelGC -XX:+UseParallelOldGC -XX:+UseCompressedOops -Xmx100m -Xms100m -XX:InitialHeapSize=100m -Xbootclasspath/a:. -XX:+UnlockDiagnosticVMOptions -XX:+WhiteBoxAPI'
-
-if [ -z "${TESTCLASSPATH}" ]; then
- echo "Using TESTCLASSES"
- MY_CLASSPATH=${TESTCLASSES}
-else
- echo "Using TESTCLASSPATH"
- MY_CLASSPATH=${TESTCLASSPATH}
-fi
-
-if uses_windows_or_linux && uses_64_bit_testjava; then
- printenv
- echo "${TESTJAVA}/bin/java ${TESTVMOPTS} ${OPTIONS} -cp ${MY_CLASSPATH} ${TEST}"
- ${TESTJAVA}/bin/java ${TESTVMOPTS} ${OPTIONS} -cp ${MY_CLASSPATH} ${TEST}
-fi
--- a/test/jdk/jdk/jfr/event/gc/configuration/TestGCHeapConfigurationEventWithHeapBasedOops.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/jdk/jdk/jfr/event/gc/configuration/TestGCHeapConfigurationEventWithHeapBasedOops.java Fri Nov 08 20:41:14 2019 -0500
@@ -1,5 +1,5 @@
/*
- * Copyright (c) 2013, 2018, Oracle and/or its affiliates. All rights reserved.
+ * Copyright (c) 2013, 2019, Oracle and/or its affiliates. All rights reserved.
* DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
*
* This code is free software; you can redistribute it and/or modify it
@@ -28,6 +28,19 @@
import jdk.jfr.consumer.RecordedEvent;
import jdk.test.lib.jfr.EventVerifier;
+/*
+ * @test TestGCHeapConfigurationEventWith32BitOops
+ * @key jfr
+ * @requires vm.hasJFR
+ * @requires vm.gc == "Parallel" | vm.gc == null
+ * @requires os.family == "linux" | os.family == "windows"
+ * @requires sun.arch.data.model == "64"
+ * @library /test/lib /test/jdk
+ * @build sun.hotspot.WhiteBox
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @run main/othervm -XX:+UnlockExperimentalVMOptions -XX:-UseFastUnorderedTimeStamps -XX:+UseParallelGC -XX:+UseParallelOldGC -XX:+UseCompressedOops -Xmx31g jdk.jfr.event.gc.configuration.TestGCHeapConfigurationEventWithHeapBasedOops
+ */
+
/* See the shell script wrapper for the flags used when invoking the JVM */
public class TestGCHeapConfigurationEventWithHeapBasedOops extends GCHeapConfigurationEventTester {
public static void main(String[] args) throws Exception {
--- a/test/jdk/jdk/jfr/event/gc/configuration/TestGCHeapConfigurationEventWithHeapBasedOops.sh Fri Nov 08 16:48:20 2019 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,63 +0,0 @@
-#
-# Copyright (c) 2013, 2018, Oracle and/or its affiliates. All rights reserved.
-# DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
-#
-# This code is free software; you can redistribute it and/or modify it
-# under the terms of the GNU General Public License version 2 only, as
-# published by the Free Software Foundation.
-#
-# This code is distributed in the hope that it will be useful, but WITHOUT
-# ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
-# FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
-# version 2 for more details (a copy is included in the LICENSE file that
-# accompanied this code).
-#
-# You should have received a copy of the GNU General Public License version
-# 2 along with this work; if not, write to the Free Software Foundation,
-# Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
-#
-# Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
-# or visit www.oracle.com if you need additional information or have any
-# questions.
-#
-# @test TestGCHeapConfigurationEventWithHeapBasedOops
-# @key jfr
-# @requires vm.hasJFR
-# @requires vm.gc == "Parallel" | vm.gc == null
-# @library /test/lib /test/jdk
-# @build jdk.jfr.event.gc.configuration.TestGCHeapConfigurationEventWithHeapBasedOops
-# @run shell TestGCHeapConfigurationEventWithHeapBasedOops.sh
-
-uses_64_bit_testjava() {
- ${TESTJAVA}/bin/java ${TESTVMOPTS} -version 2>&1 | grep '64-Bit' > /dev/null
-}
-
-uses_windows_or_linux() {
- case `uname -s` in
- Linux | CYGWIN* | Windows* )
- return 0
- ;;
- esac
- return 1
-}
-
-TEST='jdk.jfr.event.gc.configuration.TestGCHeapConfigurationEventWithHeapBasedOops'
-
-# NOTE: Can't use 32g heap with UseCompressedOops. Hopefully the 31g heap will
-# force HeapBased compressed oops to be enalbed by hoping that there isn't
-# enough space in the lowest 1 GB of the virtual address space.
-OPTIONS='-XX:+UnlockExperimentalVMOptions -XX:-UseFastUnorderedTimeStamps -XX:+UseParallelGC -XX:+UseParallelOldGC -Xmx31g -XX:+UseCompressedOops'
-
-if [ -z "${TESTCLASSPATH}" ]; then
- echo "Using TESTCLASSES"
- MY_CLASSPATH=${TESTCLASSES}
-else
- echo "Using TESTCLASSPATH"
- MY_CLASSPATH=${TESTCLASSPATH}
-fi
-
-if uses_windows_or_linux && uses_64_bit_testjava; then
- printenv
- echo "${TESTJAVA}/bin/java ${TESTVMOPTS} ${OPTIONS} -cp ${MY_CLASSPATH} ${TEST}"
- ${TESTJAVA}/bin/java ${TESTVMOPTS} ${OPTIONS} -cp ${MY_CLASSPATH} ${TEST}
-fi
--- a/test/jdk/jdk/jfr/event/gc/configuration/TestGCHeapConfigurationEventWithZeroBasedOops.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/jdk/jdk/jfr/event/gc/configuration/TestGCHeapConfigurationEventWithZeroBasedOops.java Fri Nov 08 20:41:14 2019 -0500
@@ -1,5 +1,5 @@
/*
- * Copyright (c) 2013, 2018, Oracle and/or its affiliates. All rights reserved.
+ * Copyright (c) 2013, 2019, Oracle and/or its affiliates. All rights reserved.
* DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
*
* This code is free software; you can redistribute it and/or modify it
@@ -28,6 +28,17 @@
import jdk.jfr.consumer.RecordedEvent;
import jdk.test.lib.jfr.EventVerifier;
+/*
+ * @test TestGCHeapConfigurationEventWithZeroBasedOops
+ * @key jfr
+ * @requires vm.hasJFR
+ * @requires vm.gc == "Parallel" | vm.gc == null
+ * @requires os.family == "linux" | os.family == "windows"
+ * @requires sun.arch.data.model == "64"
+ * @library /test/lib /test/jdk
+ * @run main/othervm -XX:+UnlockExperimentalVMOptions -XX:-UseFastUnorderedTimeStamps -XX:+UseParallelGC -XX:+UseParallelOldGC -XX:+UseCompressedOops -Xmx4g jdk.jfr.event.gc.configuration.TestGCHeapConfigurationEventWithZeroBasedOops
+ */
+
/* See the shell script wrapper for the flags used when invoking the JVM */
public class TestGCHeapConfigurationEventWithZeroBasedOops extends GCHeapConfigurationEventTester {
public static void main(String[] args) throws Exception {
--- a/test/jdk/jdk/jfr/event/gc/configuration/TestGCHeapConfigurationEventWithZeroBasedOops.sh Fri Nov 08 16:48:20 2019 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,60 +0,0 @@
-#
-# Copyright (c) 2013, 2018, Oracle and/or its affiliates. All rights reserved.
-# DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
-#
-# This code is free software; you can redistribute it and/or modify it
-# under the terms of the GNU General Public License version 2 only, as
-# published by the Free Software Foundation.
-#
-# This code is distributed in the hope that it will be useful, but WITHOUT
-# ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
-# FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
-# version 2 for more details (a copy is included in the LICENSE file that
-# accompanied this code).
-#
-# You should have received a copy of the GNU General Public License version
-# 2 along with this work; if not, write to the Free Software Foundation,
-# Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
-#
-# Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
-# or visit www.oracle.com if you need additional information or have any
-# questions.
-#
-# @test TestGCHeapConfigurationEventWithZeroBasedOops
-# @key jfr
-# @requires vm.hasJFR
-# @requires vm.gc == "Parallel" | vm.gc == null
-# @library /test/lib /test/jdk
-# @build jdk.jfr.event.gc.configuration.TestGCHeapConfigurationEventWithZeroBasedOops
-# @run shell TestGCHeapConfigurationEventWithZeroBasedOops.sh
-
-uses_64_bit_testjava() {
- ${TESTJAVA}/bin/java ${TESTVMOPTS} -version 2>&1 | grep '64-Bit' > /dev/null
-}
-
-uses_windows_or_linux() {
- case `uname -s` in
- Linux | CYGWIN* | Windows* )
- return 0
- ;;
- esac
- return 1
-}
-
-TEST='jdk.jfr.event.gc.configuration.TestGCHeapConfigurationEventWithZeroBasedOops'
-
-OPTIONS='-XX:+UnlockExperimentalVMOptions -XX:-UseFastUnorderedTimeStamps -XX:+UseParallelGC -XX:+UseParallelOldGC -XX:+UseCompressedOops -Xmx4g'
-
-if [ -z "${TESTCLASSPATH}" ]; then
- echo "Using TESTCLASSES"
- MY_CLASSPATH=${TESTCLASSES}
-else
- echo "Using TESTCLASSPATH"
- MY_CLASSPATH=${TESTCLASSPATH}
-fi
-
-if uses_windows_or_linux && uses_64_bit_testjava; then
- printenv
- echo "${TESTJAVA}/bin/java ${TESTVMOPTS} ${OPTIONS} -cp ${MY_CLASSPATH} ${TEST}"
- ${TESTJAVA}/bin/java ${TESTVMOPTS} ${OPTIONS} -cp ${MY_CLASSPATH} ${TEST}
-fi
--- a/test/jdk/jdk/jfr/event/io/EvilInstrument.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/jdk/jdk/jfr/event/io/EvilInstrument.java Fri Nov 08 20:41:14 2019 -0500
@@ -53,7 +53,8 @@
* @modules java.instrument
*
* @build jdk.jfr.event.io.EvilInstrument
- * @run shell MakeJAR.sh EvilInstrument 'Can-Redefine-Classes: true'
+ * @run driver jdk.test.lib.util.JavaAgentBuilder
+ * jdk.jfr.event.io.EvilInstrument EvilInstrument.jar
* @run main/othervm -javaagent:EvilInstrument.jar jdk.jfr.event.io.EvilInstrument
*/
--- a/test/jdk/jdk/jfr/event/io/MakeJAR.sh Fri Nov 08 16:48:20 2019 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,45 +0,0 @@
-#!/bin/sh
-
-AGENT="$1"
-
-if [ "${TESTSRC}" = "" ]
-then
- echo "TESTSRC not set. Test cannot execute. Failed."
- exit 1
-fi
-echo "TESTSRC=${TESTSRC}"
-
-if [ "${TESTJAVA}" = "" ]
-then
- echo "TESTJAVA not set. Test cannot execute. Failed."
- exit 1
-fi
-echo "TESTJAVA=${TESTJAVA}"
-
-if [ "${TESTCLASSES}" = "" ]
-then
- echo "TESTCLASSES not set. Test cannot execute. Failed."
- exit 1
-fi
-
-if [ -z "${COMPILEJAVA}" ]
-then
- COMPILEJAVA=${TESTJAVA}
-fi
-
-JAVAC="${COMPILEJAVA}/bin/javac -g"
-JAR="${COMPILEJAVA}/bin/jar"
-
-cp ${TESTSRC}/${AGENT}.java .
-${JAVAC} -cp ${TESTCLASSPATH} ${AGENT}.java
-
-echo "Manifest-Version: 1.0" > ${AGENT}.mf
-echo Premain-Class: jdk.jfr.event.io.${AGENT} >> ${AGENT}.mf
-shift
-while [ $# != 0 ] ; do
- echo $1 >> ${AGENT}.mf
- shift
-done
-
-
-${JAR} cvfm ${AGENT}.jar ${AGENT}.mf ${AGENT}*.class
--- a/test/jdk/jdk/jfr/event/os/TestInitialEnvironmentVariable.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/jdk/jdk/jfr/event/os/TestInitialEnvironmentVariable.java Fri Nov 08 20:41:14 2019 -0500
@@ -1,5 +1,5 @@
/*
- * Copyright (c) 2013, 2018, Oracle and/or its affiliates. All rights reserved.
+ * Copyright (c) 2013, 2019, Oracle and/or its affiliates. All rights reserved.
* DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
*
* This code is free software; you can redistribute it and/or modify it
@@ -36,30 +36,51 @@
import jdk.jfr.consumer.RecordedEvent;
import jdk.test.lib.jfr.EventNames;
import jdk.test.lib.jfr.Events;
+import jdk.test.lib.process.OutputAnalyzer;
+import jdk.test.lib.process.ProcessTools;
+/**
+ * @test
+ * @key jfr
+ * @requires vm.hasJFR
+ * @library /test/lib
+ * @run main jdk.jfr.event.os.TestInitialEnvironmentVariable
+ */
public class TestInitialEnvironmentVariable {
private final static String EVENT_NAME = EventNames.InitialEnvironmentVariable;
public static void main(String[] args) throws Exception {
- Map<String, String> env = new HashMap<>();
+ ProcessBuilder pb = ProcessTools.createJavaProcessBuilder(Test.class.getName());
+ setEnv(pb.environment());
+ (new OutputAnalyzer(pb.start())).shouldHaveExitValue(0);
+ }
+
+ static void setEnv(Map<String, String> env) {
env.put("keytest1", "value1");
env.put("keytest2", "value 2");
+ }
- Recording recording = new Recording();
- recording.enable(EVENT_NAME);
- recording.start();
- recording.stop();
- List<RecordedEvent> events = Events.fromRecording(recording);
- Events.hasEvents(events);
- for (RecordedEvent event : events) {
- System.out.println("Event: " + event);
- String key = Events.assertField(event, "key").notNull().getValue();
- String value = Events.assertField(event, "value").notNull().getValue();
- if (env.containsKey(key)) {
- assertEquals(value, env.get(key), "Wrong value for key: " + key);
- env.remove(key);
+ static class Test {
+ public static void main(String[] args) throws Exception {
+ Map<String, String> env = new HashMap<>();
+ setEnv(env);
+
+ Recording recording = new Recording();
+ recording.enable(EVENT_NAME);
+ recording.start();
+ recording.stop();
+ List<RecordedEvent> events = Events.fromRecording(recording);
+ Events.hasEvents(events);
+ for (RecordedEvent event : events) {
+ System.out.println("Event: " + event);
+ String key = Events.assertField(event, "key").notNull().getValue();
+ String value = Events.assertField(event, "value").notNull().getValue();
+ if (env.containsKey(key)) {
+ assertEquals(value, env.get(key), "Wrong value for key: " + key);
+ env.remove(key);
+ }
}
+ assertTrue(env.isEmpty(), "Missing env keys " + env.keySet());
}
- assertTrue(env.isEmpty(), "Missing env keys " + env.keySet());
}
}
--- a/test/jdk/jdk/jfr/event/os/TestInitialEnvironmentVariable.sh Fri Nov 08 16:48:20 2019 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,38 +0,0 @@
-#
-# Copyright (c) 2013, 2018, Oracle and/or its affiliates. All rights reserved.
-# DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
-#
-# This code is free software; you can redistribute it and/or modify it
-# under the terms of the GNU General Public License version 2 only, as
-# published by the Free Software Foundation.
-#
-# This code is distributed in the hope that it will be useful, but WITHOUT
-# ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
-# FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
-# version 2 for more details (a copy is included in the LICENSE file that
-# accompanied this code).
-#
-# You should have received a copy of the GNU General Public License version
-# 2 along with this work; if not, write to the Free Software Foundation,
-# Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
-#
-# Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
-# or visit www.oracle.com if you need additional information or have any
-# questions.
-#
-# @test
-# @key jfr
-# @requires vm.hasJFR
-# @library /test/lib
-# @build jdk.jfr.event.os.TestInitialEnvironmentVariable
-# @run shell TestInitialEnvironmentVariable.sh
-
-echo -------------------------------------------------------------
-echo "TESTCLASSES='$TESTCLASSES'"
-echo "TESTSRC='$TESTSRC'"
-echo Launching test for `basename $0 .sh`
-echo -------------------------------------------------------------
-keytest1="value1";export keytest1
-keytest2="value 2";export keytest2
-${TESTJAVA}/bin/java -cp ${TESTCLASSPATH} jdk.jfr.event.os.TestInitialEnvironmentVariable
-exit $?
--- a/test/jdk/jdk/jfr/event/runtime/TestVMInfoEvent.flags Fri Nov 08 16:48:20 2019 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,1 +0,0 @@
-+FlightRecorder
\ No newline at end of file
--- a/test/jdk/jdk/jfr/event/runtime/TestVMInfoEvent.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/jdk/jdk/jfr/event/runtime/TestVMInfoEvent.java Fri Nov 08 20:41:14 2019 -0500
@@ -1,5 +1,5 @@
/*
- * Copyright (c) 2013, 2018, Oracle and/or its affiliates. All rights reserved.
+ * Copyright (c) 2013, 2019, Oracle and/or its affiliates. All rights reserved.
* DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
*
* This code is free software; you can redistribute it and/or modify it
@@ -25,10 +25,10 @@
package jdk.jfr.event.runtime;
-
-
import java.lang.management.ManagementFactory;
import java.lang.management.RuntimeMXBean;
+import java.nio.file.Files;
+import java.nio.file.Paths;
import java.util.List;
import java.util.stream.Collectors;
@@ -39,13 +39,21 @@
import jdk.test.lib.jfr.Events;
/**
- * The test will verify that JVM Information event values are delivered
- * and compare them with the RuntimeMXBean's values.
+ * @test
+ * @key jfr
+ * @requires vm.hasJFR
+ * @library /test/lib
+ * @run driver jdk.jfr.event.runtime.TestVMInfoEvent generateFlagsFile
+ * @run main/othervm -XX:Flags=TestVMInfoEvent.flags -Xmx500m jdk.jfr.event.runtime.TestVMInfoEvent arg1 arg2
*/
public class TestVMInfoEvent {
private final static String EVENT_NAME = EventNames.JVMInformation;
public static void main(String[] args) throws Exception {
+ if( (args.length > 0) && ("generateFlagsFile".equals(args[0])) ) {
+ generateFlagsFile();
+ return;
+ }
RuntimeMXBean mbean = ManagementFactory.getRuntimeMXBean();
Recording recording = new Recording();
recording.enable(EVENT_NAME);
@@ -76,4 +84,7 @@
}
}
+ public static void generateFlagsFile() throws Exception {
+ Files.writeString(Paths.get("", "TestVMInfoEvent.flags"), "+UseSerialGC");
+ }
}
--- a/test/jdk/jdk/jfr/event/runtime/TestVMInfoEvent.sh Fri Nov 08 16:48:20 2019 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,35 +0,0 @@
-#
-# Copyright (c) 2013, 2018, Oracle and/or its affiliates. All rights reserved.
-# DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
-#
-# This code is free software; you can redistribute it and/or modify it
-# under the terms of the GNU General Public License version 2 only, as
-# published by the Free Software Foundation.
-#
-# This code is distributed in the hope that it will be useful, but WITHOUT
-# ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
-# FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
-# version 2 for more details (a copy is included in the LICENSE file that
-# accompanied this code).
-#
-# You should have received a copy of the GNU General Public License version
-# 2 along with this work; if not, write to the Free Software Foundation,
-# Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
-#
-# Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
-# or visit www.oracle.com if you need additional information or have any
-# questions.
-#
-# @test
-# @key jfr
-# @requires vm.hasJFR
-# @library /test/lib /test/jdk
-# @build jdk.jfr.event.runtime.TestVMInfoEvent
-# @run shell TestVMInfoEvent.sh
-
-echo -------------------------------------------------------------
-echo Launching test for `basename $0 .sh`
-echo -------------------------------------------------------------
-
-${TESTJAVA}/bin/java -cp ${TESTCLASSPATH} -XX:Flags=${TESTSRC}/TestVMInfoEvent.flags jdk.jfr.event.runtime.TestVMInfoEvent arg1 arg2
-exit $?
--- a/test/jdk/jdk/jfr/javaagent/JavaAgentBuilder.java Fri Nov 08 16:48:20 2019 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,87 +0,0 @@
-/*
- * Copyright (c) 2019, Oracle and/or its affiliates. All rights reserved.
- * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
- *
- * This code is free software; you can redistribute it and/or modify it
- * under the terms of the GNU General Public License version 2 only, as
- * published by the Free Software Foundation.
- *
- * This code is distributed in the hope that it will be useful, but WITHOUT
- * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
- * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
- * version 2 for more details (a copy is included in the LICENSE file that
- * accompanied this code).
- *
- * You should have received a copy of the GNU General Public License version
- * 2 along with this work; if not, write to the Free Software Foundation,
- * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
- *
- * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
- * or visit www.oracle.com if you need additional information or have any
- * questions.
- */
-
-package jdk.test.lib.util;
-
-import java.io.File;
-import java.io.IOException;
-import java.nio.file.Path;
-import java.nio.file.Paths;
-import java.util.Arrays;
-import java.util.jar.Attributes;
-import java.util.jar.Manifest;
-
-import jdk.test.lib.Utils;
-import jdk.test.lib.util.JarUtils;
-
-/**
- * A builder for a common Java agent.
- * Can be used directly from the jtreg test header to
- * build a java agent before the test is executed.
- *
- * E.g.:
- * @run driver jdk.test.lib.util.JavaAgentBuilder
- * jdk.jfr.javaagent.EventEmitterAgent EventEmitterAgent.jar
- *
- */
-public class JavaAgentBuilder {
-
- /**
- * Build a java agent jar file with a given agent class.
- *
- * @param args[0] fully qualified name of an agent class
- * @param args[1] file name of the agent jar to be created
- * @throws IOException
- */
- public static void main(String... args) throws IOException {
- String agentClass = args[0];
- String agentJar = args[1];
- System.out.println("Building " + agentJar + " with agent class " + agentClass);
- build(agentClass, agentJar);
- }
-
- /**
- * Build a java agent jar file with a given agent class.
- * The agent class will be added as both premain class and agent class.
- *
- * @param agentClass fully qualified name of an agent class
- * @param agentJar file name of the agent jar to be created
- * the file will be placed in a current work directory
- * @throws IOException
- */
- public static void build(String agentClass, String agentJar) throws IOException {
- Manifest mf = new Manifest();
- Attributes attrs = mf.getMainAttributes();
- attrs.put(Attributes.Name.MANIFEST_VERSION, "1.0");
- attrs.putValue("Premain-Class", agentClass);
- attrs.putValue("Agent-Class", agentClass);
-
- Path jarFile = Paths.get(".", agentJar);
- String testClasses = Utils.TEST_CLASSES;
- String agentPath = agentClass.replace(".", File.separator) + ".class";
- Path agentFile = Paths.get(testClasses, agentPath);
- Path dir = Paths.get(testClasses);
- JarUtils.createJarFile(jarFile, mf, dir, agentFile);
- System.out.println("Agent built:" + jarFile.toAbsolutePath());
- }
-}
--- a/test/jdk/jdk/nio/zipfs/CopyMoveTests.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/jdk/jdk/nio/zipfs/CopyMoveTests.java Fri Nov 08 20:41:14 2019 -0500
@@ -41,7 +41,7 @@
/**
* @test
- * @bug 8223771
+ * @bug 8231766
* @summary Test Files::copy and Files::move with Zip FS
* @modules jdk.zipfs
* @run testng/othervm CopyMoveTests
--- a/test/jdk/sun/text/resources/LocaleData.cldr Fri Nov 08 16:48:20 2019 -0500
+++ b/test/jdk/sun/text/resources/LocaleData.cldr Fri Nov 08 20:41:14 2019 -0500
@@ -8382,3 +8382,9 @@
CalendarData/zh_SG/firstDayOfWeek=1: AG AS AU BD BR BS BT BW BZ CA CN CO DM DO ET GT GU HK HN ID IL IN JM JP KE KH KR LA MH MM MO MT MX MZ NI NP PA PE PH PK PR PT PY SA SG SV TH TT TW UM US VE VI WS YE ZA ZW;2: 001 AD AI AL AM AN AR AT AX AZ BA BE BG BM BN BY CH CL CM CR CY CZ DE DK EC EE ES FI FJ FO FR GB GE GF GP GR HR HU IE IS IT KG KZ LB LI LK LT LU LV MC MD ME MK MN MQ MY NL NO NZ PL RE RO RS RU SE SI SK SM TJ TM TR UA UY UZ VA VN XK;6: MV;7: AE AF BH DJ DZ EG IQ IR JO KW LY OM QA SD SY
CalendarData/zh_TW/firstDayOfWeek=1: AG AS AU BD BR BS BT BW BZ CA CN CO DM DO ET GT GU HK HN ID IL IN JM JP KE KH KR LA MH MM MO MT MX MZ NI NP PA PE PH PK PR PT PY SA SG SV TH TT TW UM US VE VI WS YE ZA ZW;2: 001 AD AI AL AM AN AR AT AX AZ BA BE BG BM BN BY CH CL CM CR CY CZ DE DK EC EE ES FI FJ FO FR GB GE GF GP GR HR HU IE IS IT KG KZ LB LI LK LT LU LV MC MD ME MK MN MQ MY NL NO NZ PL RE RO RS RU SE SI SK SM TJ TM TR UA UY UZ VA VN XK;6: MV;7: AE AF BH DJ DZ EG IQ IR JO KW LY OM QA SD SY
CalendarData/zh_TW/minimalDaysInFirstWeek=1: 001 GU UM US VI;4: AD AN AT AX BE BG CH CZ DE DK EE ES FI FJ FO FR GB GF GG GI GP GR HU IE IM IS IT JE LI LT LU MC MQ NL NO PL PT RE RU SE SJ SK SM VA
+
+# bug 8233579
+FormatData/es_CL/MonthAbbreviations/8=sep.
+FormatData/es_CL/standalone.MonthAbbreviations/8=sept.
+FormatData/es_CO/MonthAbbreviations/8=sep.
+FormatData/es_CO/standalone.MonthAbbreviations/8=sept.
--- a/test/jdk/sun/text/resources/LocaleDataTest.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/jdk/sun/text/resources/LocaleDataTest.java Fri Nov 08 20:41:14 2019 -0500
@@ -39,7 +39,7 @@
* 8017142 8037343 8055222 8042126 8074791 8075173 8080774 8129361 8134916
* 8145136 8145952 8164784 8037111 8081643 7037368 8178872 8185841 8190918
* 8187946 8195478 8181157 8179071 8193552 8202026 8204269 8202537 8208746
- * 8209775 8221432 8227127 8230284 8231273
+ * 8209775 8221432 8227127 8230284 8231273 8233579
* @summary Verify locale data
* @modules java.base/sun.util.resources
* @modules jdk.localedata
--- a/test/lib/jdk/test/lib/cds/CDSTestUtils.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/lib/jdk/test/lib/cds/CDSTestUtils.java Fri Nov 08 20:41:14 2019 -0500
@@ -601,4 +601,64 @@
ps.close();
fos.close();
}
+
+ // Format a line that defines an extra symbol in the file specify by -XX:SharedArchiveConfigFile=<file>
+ public static String formatArchiveConfigSymbol(String symbol) {
+ int refCount = -1; // This is always -1 in the current HotSpot implementation.
+ if (isAsciiPrintable(symbol)) {
+ return symbol.length() + " " + refCount + ": " + symbol;
+ } else {
+ StringBuilder sb = new StringBuilder();
+ int utf8_length = escapeArchiveConfigString(sb, symbol);
+ return utf8_length + " " + refCount + ": " + sb.toString();
+ }
+ }
+
+ // This method generates the same format as HashtableTextDump::put_utf8() in HotSpot,
+ // to be used by -XX:SharedArchiveConfigFile=<file>.
+ private static int escapeArchiveConfigString(StringBuilder sb, String s) {
+ byte arr[];
+ try {
+ arr = s.getBytes("UTF8");
+ } catch (java.io.UnsupportedEncodingException e) {
+ throw new RuntimeException("Unexpected", e);
+ }
+ for (int i = 0; i < arr.length; i++) {
+ char ch = (char)(arr[i] & 0xff);
+ if (isAsciiPrintable(ch)) {
+ sb.append(ch);
+ } else if (ch == '\t') {
+ sb.append("\\t");
+ } else if (ch == '\r') {
+ sb.append("\\r");
+ } else if (ch == '\n') {
+ sb.append("\\n");
+ } else if (ch == '\\') {
+ sb.append("\\\\");
+ } else {
+ String hex = Integer.toHexString(ch);
+ if (ch < 16) {
+ sb.append("\\x0");
+ } else {
+ sb.append("\\x");
+ }
+ sb.append(hex);
+ }
+ }
+
+ return arr.length;
+ }
+
+ private static boolean isAsciiPrintable(String s) {
+ for (int i = 0; i < s.length(); i++) {
+ if (!isAsciiPrintable(s.charAt(i))) {
+ return false;
+ }
+ }
+ return true;
+ }
+
+ private static boolean isAsciiPrintable(char ch) {
+ return ch >= 32 && ch < 127;
+ }
}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/lib/jdk/test/lib/util/JavaAgentBuilder.java Fri Nov 08 20:41:14 2019 -0500
@@ -0,0 +1,87 @@
+/*
+ * Copyright (c) 2019, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ */
+
+package jdk.test.lib.util;
+
+import java.io.File;
+import java.io.IOException;
+import java.nio.file.Path;
+import java.nio.file.Paths;
+import java.util.Arrays;
+import java.util.jar.Attributes;
+import java.util.jar.Manifest;
+
+import jdk.test.lib.Utils;
+import jdk.test.lib.util.JarUtils;
+
+/**
+ * A builder for a common Java agent.
+ * Can be used directly from the jtreg test header to
+ * build a java agent before the test is executed.
+ *
+ * E.g.:
+ * @run driver jdk.test.lib.util.JavaAgentBuilder
+ * jdk.jfr.javaagent.EventEmitterAgent EventEmitterAgent.jar
+ *
+ */
+public class JavaAgentBuilder {
+
+ /**
+ * Build a java agent jar file with a given agent class.
+ *
+ * @param args[0] fully qualified name of an agent class
+ * @param args[1] file name of the agent jar to be created
+ * @throws IOException
+ */
+ public static void main(String... args) throws IOException {
+ String agentClass = args[0];
+ String agentJar = args[1];
+ System.out.println("Building " + agentJar + " with agent class " + agentClass);
+ build(agentClass, agentJar);
+ }
+
+ /**
+ * Build a java agent jar file with a given agent class.
+ * The agent class will be added as both premain class and agent class.
+ *
+ * @param agentClass fully qualified name of an agent class
+ * @param agentJar file name of the agent jar to be created
+ * the file will be placed in a current work directory
+ * @throws IOException
+ */
+ public static void build(String agentClass, String agentJar) throws IOException {
+ Manifest mf = new Manifest();
+ Attributes attrs = mf.getMainAttributes();
+ attrs.put(Attributes.Name.MANIFEST_VERSION, "1.0");
+ attrs.putValue("Premain-Class", agentClass);
+ attrs.putValue("Agent-Class", agentClass);
+
+ Path jarFile = Paths.get(".", agentJar);
+ String testClasses = Utils.TEST_CLASSES;
+ String agentPath = agentClass.replace(".", File.separator) + ".class";
+ Path agentFile = Paths.get(testClasses, agentPath);
+ Path dir = Paths.get(testClasses);
+ JarUtils.createJarFile(jarFile, mf, dir, agentFile);
+ System.out.println("Agent built:" + jarFile.toAbsolutePath());
+ }
+}
--- a/test/micro/org/openjdk/bench/java/lang/Clone.java Fri Nov 08 16:48:20 2019 -0500
+++ b/test/micro/org/openjdk/bench/java/lang/Clone.java Fri Nov 08 20:41:14 2019 -0500
@@ -43,12 +43,17 @@
private BitSet testObj1;
private Date testObj2;
private char[] testObj3;
+ private char[] testObj4;
+ private String[] testObj5;
@Setup
public void setup() {
testObj1 = new BitSet(10);
testObj2 = new Date();
testObj3 = new char[5];
+ testObj4 = new char[311];
+ String str = "Lorem ipsum dolor sit amet, consectetur adipiscing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. Ut enim ad minim veniam, quis nostrud exercitation ullamco laboris nisi ut";
+ testObj5 = str.split(" ", -1);
}
/** Calls clone on three different types. The types are java.util.BitSet, java.util.Date and char[]. */
@@ -59,5 +64,11 @@
bh.consume(testObj3.clone());
}
+ @Benchmark
+ public void cloneLarge(Blackhole bh) {
+ bh.consume(testObj4.clone());
+ bh.consume(testObj5.clone());
+ }
+
}