8188791: Move AppCDS from closed repo to open repo
Reviewed-by: dsamersoff, simonis, minqi
Contributed-by: jiangli.zhou@oracle.com, mikhailo.seledtsov@oracle.com, calvin.cheung@oracle.com
--- a/src/hotspot/share/classfile/classListParser.cpp Mon Nov 27 20:35:56 2017 -0500
+++ b/src/hotspot/share/classfile/classListParser.cpp Mon Nov 27 20:21:34 2017 -0800
@@ -1,5 +1,5 @@
/*
- * Copyright (c) 2015, Oracle and/or its affiliates. All rights reserved.
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
* DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
*
* This code is free software; you can redistribute it and/or modify it
@@ -23,13 +23,32 @@
*/
#include "precompiled.hpp"
+#include "jvm.h"
+#include "jimage.hpp"
#include "classfile/classListParser.hpp"
-#include "runtime/os.hpp"
-#include "runtime/java.hpp"
+#include "classfile/classLoaderExt.hpp"
+#include "classfile/sharedClassUtil.hpp"
+#include "classfile/symbolTable.hpp"
+#include "classfile/systemDictionary.hpp"
+#include "classfile/systemDictionaryShared.hpp"
+#include "memory/metaspaceShared.hpp"
+#include "memory/resourceArea.hpp"
+#include "runtime/fieldType.hpp"
+#include "runtime/javaCalls.hpp"
+#include "utilities/defaultStream.hpp"
+#include "utilities/hashtable.inline.hpp"
+#include "utilities/macros.hpp"
+
+ClassListParser* ClassListParser::_instance = NULL;
ClassListParser::ClassListParser(const char* file) {
+ assert(_instance == NULL, "must be singleton");
+ _instance = this;
_classlist_file = file;
_file = fopen(file, "r");
+ _line_no = 0;
+ _interfaces = new (ResourceObj::C_HEAP, mtClass) GrowableArray<int>(10, true);
+
if (_file == NULL) {
char errmsg[JVM_MAXPATHLEN];
os::lasterror(errmsg, JVM_MAXPATHLEN);
@@ -41,6 +60,7 @@
if (_file) {
fclose(_file);
}
+ _instance = NULL;
}
bool ClassListParser::parse_one_line() {
@@ -48,10 +68,10 @@
if (fgets(_line, sizeof(_line), _file) == NULL) {
return false;
}
- int line_len = (int)strlen(_line);
- if (line_len > _max_allowed_line_len) {
- tty->print_cr("input line too long (must be no longer than %d chars)", _max_allowed_line_len);
- vm_exit_during_initialization("Loading classlist failed");
+ ++ _line_no;
+ _line_len = (int)strlen(_line);
+ if (_line_len > _max_allowed_line_len) {
+ error("input line too long (must be no longer than %d chars)", _max_allowed_line_len);
}
if (*_line == '#') { // comment
continue;
@@ -59,8 +79,378 @@
break;
}
- // Remove trailing \r\n
- _line[strcspn(_line, "\r\n")] = 0;
+ _id = _unspecified;
+ _super = _unspecified;
+ _interfaces->clear();
+ _source = NULL;
+ _interfaces_specified = false;
+
+ {
+ int len = (int)strlen(_line);
+ int i;
+ // Replace \t\r\n with ' '
+ for (i=0; i<len; i++) {
+ if (_line[i] == '\t' || _line[i] == '\r' || _line[i] == '\n') {
+ _line[i] = ' ';
+ }
+ }
+
+ // Remove trailing newline/space
+ while (len > 0) {
+ if (_line[len-1] == ' ') {
+ _line[len-1] = '\0';
+ len --;
+ } else {
+ break;
+ }
+ }
+ _line_len = len;
+ _class_name = _line;
+ }
+
+ if ((_token = strchr(_line, ' ')) == NULL) {
+ // No optional arguments are specified.
+ return true;
+ }
+
+ // Mark the end of the name, and go to the next input char
+ *_token++ = '\0';
+
+ while (*_token) {
+ skip_whitespaces();
+
+ if (parse_int_option("id:", &_id)) {
+ continue;
+ } else if (parse_int_option("super:", &_super)) {
+ check_already_loaded("Super class", _super);
+ continue;
+ } else if (skip_token("interfaces:")) {
+ int i;
+ while (try_parse_int(&i)) {
+ check_already_loaded("Interface", i);
+ _interfaces->append(i);
+ }
+ } else if (skip_token("source:")) {
+ skip_whitespaces();
+ _source = _token;
+ char* s = strchr(_token, ' ');
+ if (s == NULL) {
+ break; // end of input line
+ } else {
+ *s = '\0'; // mark the end of _source
+ _token = s+1;
+ }
+ } else {
+ error("Unknown input");
+ }
+ }
+
+ // if src is specified
+ // id super interfaces must all be specified
+ // loader may be specified
+ // else
+ // # the class is loaded from classpath
+ // id may be specified
+ // super, interfaces, loader must not be specified
return true;
}
+void ClassListParser::skip_whitespaces() {
+ while (*_token == ' ' || *_token == '\t') {
+ _token ++;
+ }
+}
+
+void ClassListParser::skip_non_whitespaces() {
+ while (*_token && *_token != ' ' && *_token != '\t') {
+ _token ++;
+ }
+}
+
+void ClassListParser::parse_int(int* value) {
+ skip_whitespaces();
+ if (sscanf(_token, "%i", value) == 1) {
+ skip_non_whitespaces();
+ if (*value < 0) {
+ error("Error: negative integers not allowed (%d)", *value);
+ }
+ } else {
+ error("Error: expected integer");
+ }
+}
+
+bool ClassListParser::try_parse_int(int* value) {
+ skip_whitespaces();
+ if (sscanf(_token, "%i", value) == 1) {
+ skip_non_whitespaces();
+ return true;
+ }
+ return false;
+}
+
+bool ClassListParser::skip_token(const char* option_name) {
+ size_t len = strlen(option_name);
+ if (strncmp(_token, option_name, len) == 0) {
+ _token += len;
+ return true;
+ } else {
+ return false;
+ }
+}
+
+bool ClassListParser::parse_int_option(const char* option_name, int* value) {
+ if (skip_token(option_name)) {
+ if (*value != _unspecified) {
+ error("%s specified twice", option_name);
+ } else {
+ parse_int(value);
+ return true;
+ }
+ }
+ return false;
+}
+
+void ClassListParser::print_specified_interfaces() {
+ const int n = _interfaces->length();
+ jio_fprintf(defaultStream::error_stream(), "Currently specified interfaces[%d] = {\n", n);
+ for (int i=0; i<n; i++) {
+ InstanceKlass* k = lookup_class_by_id(_interfaces->at(i));
+ jio_fprintf(defaultStream::error_stream(), " %4d = %s\n", _interfaces->at(i), k->name()->as_klass_external_name());
+ }
+ jio_fprintf(defaultStream::error_stream(), "}\n");
+}
+
+void ClassListParser::print_actual_interfaces(InstanceKlass *ik) {
+ int n = ik->local_interfaces()->length();
+ jio_fprintf(defaultStream::error_stream(), "Actual interfaces[%d] = {\n", n);
+ for (int i = 0; i < n; i++) {
+ InstanceKlass* e = InstanceKlass::cast(ik->local_interfaces()->at(i));
+ jio_fprintf(defaultStream::error_stream(), " %s\n", e->name()->as_klass_external_name());
+ }
+ jio_fprintf(defaultStream::error_stream(), "}\n");
+}
+
+void ClassListParser::error(const char *msg, ...) {
+ va_list ap;
+ va_start(ap, msg);
+ int error_index = _token - _line;
+ if (error_index >= _line_len) {
+ error_index = _line_len - 1;
+ }
+ if (error_index < 0) {
+ error_index = 0;
+ }
+
+ jio_fprintf(defaultStream::error_stream(),
+ "An error has occurred while processing class list file %s %d:%d.\n",
+ _classlist_file, _line_no, (error_index + 1));
+ jio_vfprintf(defaultStream::error_stream(), msg, ap);
+
+ if (_line_len <= 0) {
+ jio_fprintf(defaultStream::error_stream(), "\n");
+ } else {
+ jio_fprintf(defaultStream::error_stream(), ":\n");
+ for (int i=0; i<_line_len; i++) {
+ char c = _line[i];
+ if (c == '\0') {
+ jio_fprintf(defaultStream::error_stream(), "%s", " ");
+ } else {
+ jio_fprintf(defaultStream::error_stream(), "%c", c);
+ }
+ }
+ jio_fprintf(defaultStream::error_stream(), "\n");
+ for (int i=0; i<error_index; i++) {
+ jio_fprintf(defaultStream::error_stream(), "%s", " ");
+ }
+ jio_fprintf(defaultStream::error_stream(), "^\n");
+ }
+
+ vm_exit_during_initialization("class list format error.", NULL);
+ va_end(ap);
+}
+
+// This function is used for loading classes for customized class loaders
+// during archive dumping.
+InstanceKlass* ClassListParser::load_class_from_source(Symbol* class_name, TRAPS) {
+#if !((defined(LINUX) && defined(X86) && defined(_LP64)) || \
+ (defined(SOLARIS) && defined(_LP64)))
+ // The only supported platforms are: (1) Linux/AMD64; (2) Solaris/64-bit
+ error("AppCDS custom class loaders not supported on this platform");
+#endif
+
+ assert(UseAppCDS, "must be");
+ if (!is_super_specified()) {
+ error("If source location is specified, super class must be also specified");
+ }
+ if (!is_id_specified()) {
+ error("If source location is specified, id must be also specified");
+ }
+ InstanceKlass* k = ClassLoaderExt::load_class(class_name, _source, THREAD);
+
+ if (strncmp(_class_name, "java/", 5) == 0) {
+ log_info(cds)("Prohibited package for non-bootstrap classes: %s.class from %s",
+ _class_name, _source);
+ return NULL;
+ }
+
+ if (k != NULL) {
+ if (k->local_interfaces()->length() != _interfaces->length()) {
+ print_specified_interfaces();
+ print_actual_interfaces(k);
+ error("The number of interfaces (%d) specified in class list does not match the class file (%d)",
+ _interfaces->length(), k->local_interfaces()->length());
+ }
+
+ if (!SystemDictionaryShared::add_non_builtin_klass(class_name, ClassLoaderData::the_null_class_loader_data(),
+ k, THREAD)) {
+ error("Duplicated class %s", _class_name);
+ }
+
+ // This tells JVM_FindLoadedClass to not find this class.
+ k->set_shared_classpath_index(UNREGISTERED_INDEX);
+ }
+
+ return k;
+}
+
+InstanceKlass* ClassListParser::load_current_class(TRAPS) {
+ TempNewSymbol class_name_symbol = SymbolTable::new_symbol(_class_name, THREAD);
+ guarantee(!HAS_PENDING_EXCEPTION, "Exception creating a symbol.");
+
+ InstanceKlass *klass = NULL;
+ if (!is_loading_from_source()) {
+ if (is_super_specified()) {
+ error("If source location is not specified, super class must not be specified");
+ }
+ if (are_interfaces_specified()) {
+ error("If source location is not specified, interface(s) must not be specified");
+ }
+
+ bool non_array = !FieldType::is_array(class_name_symbol);
+
+ Handle s = java_lang_String::create_from_symbol(class_name_symbol, CHECK_0);
+ // Translate to external class name format, i.e., convert '/' chars to '.'
+ Handle string = java_lang_String::externalize_classname(s, CHECK_0);
+ JavaValue result(T_OBJECT);
+ InstanceKlass* spec_klass = non_array ?
+ SystemDictionary::ClassLoader_klass() : SystemDictionary::Class_klass();
+ Symbol* method_name = non_array ?
+ vmSymbols::loadClass_name() : vmSymbols::forName_name();
+ Handle loader = Handle(THREAD, SystemDictionary::java_system_loader());
+
+ if (non_array) {
+ JavaCalls::call_virtual(&result,
+ loader, //SystemDictionary::java_system_loader(),
+ spec_klass,
+ method_name, //vmSymbols::loadClass_name(),
+ vmSymbols::string_class_signature(),
+ string,
+ THREAD);
+ } else {
+ JavaCalls::call_static(&result,
+ spec_klass,
+ method_name,
+ vmSymbols::string_class_signature(),
+ string,
+ CHECK_NULL);
+ }
+ assert(result.get_type() == T_OBJECT, "just checking");
+ oop obj = (oop) result.get_jobject();
+ if (!HAS_PENDING_EXCEPTION && (obj != NULL)) {
+ if (non_array) {
+ klass = InstanceKlass::cast(java_lang_Class::as_Klass(obj));
+ } else {
+ klass = static_cast<InstanceKlass*>(java_lang_Class::array_klass_acquire(obj));
+ }
+ } else { // load classes in bootclasspath/a
+ if (HAS_PENDING_EXCEPTION) {
+ CLEAR_PENDING_EXCEPTION;
+ }
+
+ if (non_array) {
+ Klass* k = SystemDictionary::resolve_or_null(class_name_symbol, CHECK_NULL);
+ if (k != NULL) {
+ klass = InstanceKlass::cast(k);
+ } else {
+ if (!HAS_PENDING_EXCEPTION) {
+ THROW_NULL(vmSymbols::java_lang_ClassNotFoundException());
+ }
+ }
+ }
+ }
+ } else {
+ // If "source:" tag is specified, all super class and super interfaces must be specified in the
+ // class list file.
+ if (UseAppCDS) {
+ klass = load_class_from_source(class_name_symbol, CHECK_NULL);
+ }
+ }
+
+ if (klass != NULL && is_id_specified()) {
+ int id = this->id();
+ SystemDictionaryShared::update_shared_entry(klass, id);
+ InstanceKlass* old = table()->lookup(id);
+ if (old != NULL && old != klass) {
+ error("Duplicated ID %d for class %s", id, _class_name);
+ }
+ table()->add(id, klass);
+ }
+
+ return klass;
+}
+
+bool ClassListParser::is_loading_from_source() {
+ return (_source != NULL);
+}
+
+InstanceKlass* ClassListParser::lookup_class_by_id(int id) {
+ InstanceKlass* klass = table()->lookup(id);
+ if (klass == NULL) {
+ error("Class ID %d has not been defined", id);
+ }
+ return klass;
+}
+
+
+InstanceKlass* ClassListParser::lookup_super_for_current_class(Symbol* super_name) {
+ if (!is_loading_from_source()) {
+ return NULL;
+ }
+
+ InstanceKlass* k = lookup_class_by_id(super());
+ if (super_name != k->name()) {
+ error("The specified super class %s (id %d) does not match actual super class %s",
+ k->name()->as_klass_external_name(), super(),
+ super_name->as_klass_external_name());
+ }
+ return k;
+}
+
+InstanceKlass* ClassListParser::lookup_interface_for_current_class(Symbol* interface_name) {
+ if (!is_loading_from_source()) {
+ return NULL;
+ }
+
+ const int n = _interfaces->length();
+ if (n == 0) {
+ error("Class %s implements the interface %s, but no interface has been specified in the input line",
+ _class_name, interface_name->as_klass_external_name());
+ ShouldNotReachHere();
+ }
+
+ int i;
+ for (i=0; i<n; i++) {
+ InstanceKlass* k = lookup_class_by_id(_interfaces->at(i));
+ if (interface_name == k->name()) {
+ return k;
+ }
+ }
+
+ // interface_name is not specified by the "interfaces:" keyword.
+ print_specified_interfaces();
+ error("The interface %s implemented by class %s does not match any of the specified interface IDs",
+ interface_name->as_klass_external_name(), _class_name);
+ ShouldNotReachHere();
+ return NULL;
+}
+
--- a/src/hotspot/share/classfile/classListParser.hpp Mon Nov 27 20:35:56 2017 -0500
+++ b/src/hotspot/share/classfile/classListParser.hpp Mon Nov 27 20:21:34 2017 -0800
@@ -1,5 +1,5 @@
/*
- * Copyright (c) 2015, Oracle and/or its affiliates. All rights reserved.
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
* DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
*
* This code is free software; you can redistribute it and/or modify it
@@ -27,30 +27,122 @@
#include "utilities/exceptions.hpp"
#include "utilities/globalDefinitions.hpp"
+#include "utilities/hashtable.hpp"
+
+class CDSClassInfo;
+
+// Look up from ID -> InstanceKlass*
+class ID2KlassTable : public Hashtable<InstanceKlass*, mtClass> {
+public:
+ ID2KlassTable() : Hashtable<InstanceKlass*, mtClass>(1987, sizeof(HashtableEntry<InstanceKlass*, mtClass>)) { }
+ void add(int id, InstanceKlass* klass) {
+ unsigned int hash = (unsigned int)id;
+ HashtableEntry<InstanceKlass*, mtClass>* entry = new_entry(hash, klass);
+ add_entry(hash_to_index(hash), entry);
+ }
+
+ InstanceKlass* lookup(int id) {
+ unsigned int hash = (unsigned int)id;
+ int index = hash_to_index(id);
+ for (HashtableEntry<InstanceKlass*, mtClass>* e = bucket(index); e != NULL; e = e->next()) {
+ if (e->hash() == hash) {
+ return e->literal();
+ }
+ }
+ return NULL;
+ }
+};
class ClassListParser : public StackObj {
enum {
+ _unspecified = -999,
+
// Max number of bytes allowed per line in the classlist.
- // Theoretically Java class names could be 65535 bytes in length. In reality,
+ // Theoretically Java class names could be 65535 bytes in length. Also, an input line
+ // could have a very long path name up to JVM_MAXPATHLEN bytes in length. In reality,
// 4K bytes is more than enough.
_max_allowed_line_len = 4096,
_line_buf_extra = 10, // for detecting input too long
_line_buf_size = _max_allowed_line_len + _line_buf_extra
};
+ static ClassListParser* _instance; // the singleton.
const char* _classlist_file;
FILE* _file;
- char _line[_line_buf_size]; // The buffer that holds the current line.
+
+ ID2KlassTable _id2klass_table;
+ // The following field contains information from the *current* line being
+ // parsed.
+ char _line[_line_buf_size]; // The buffer that holds the current line. Some characters in
+ // the buffer may be overwritten by '\0' during parsing.
+ int _line_len; // Original length of the input line.
+ int _line_no; // Line number for current line being parsed
+ const char* _class_name;
+ int _id;
+ int _super;
+ GrowableArray<int>* _interfaces;
+ bool _interfaces_specified;
+ const char* _source;
+
+ bool parse_int_option(const char* option_name, int* value);
+ InstanceKlass* load_class_from_source(Symbol* class_name, TRAPS);
+ ID2KlassTable *table() {
+ return &_id2klass_table;
+ }
+ InstanceKlass* lookup_class_by_id(int id);
+ void print_specified_interfaces();
+ void print_actual_interfaces(InstanceKlass *ik);
public:
ClassListParser(const char* file);
~ClassListParser();
+
+ static ClassListParser* instance() {
+ return _instance;
+ }
bool parse_one_line();
+ char* _token;
+ void error(const char* msg, ...);
+ void parse_int(int* value);
+ bool try_parse_int(int* value);
+ bool skip_token(const char* option_name);
+ void skip_whitespaces();
+ void skip_non_whitespaces();
+
+ bool is_id_specified() {
+ return _id != _unspecified;
+ }
+ bool is_super_specified() {
+ return _super != _unspecified;
+ }
+ bool are_interfaces_specified() {
+ return _interfaces->length() > 0;
+ }
+ int id() {
+ assert(is_id_specified(), "do not query unspecified id");
+ return _id;
+ }
+ int super() {
+ assert(is_super_specified(), "do not query unspecified super");
+ return _super;
+ }
+ void check_already_loaded(const char* which, int id) {
+ if (_id2klass_table.lookup(id) == NULL) {
+ error("%s id %d is not yet loaded", which, id);
+ }
+ }
const char* current_class_name() {
- return _line;
+ return _class_name;
}
+
+ InstanceKlass* load_current_class(TRAPS);
+
+ bool is_loading_from_source();
+
+ // Look up the super or interface of the current class being loaded
+ // (in this->load_current_class()).
+ InstanceKlass* lookup_super_for_current_class(Symbol* super_name);
+ InstanceKlass* lookup_interface_for_current_class(Symbol* interface_name);
};
-
-
-#endif // SHARE_VM_MEMORY_CLASSLISTPARSER_HPP
+#endif
--- a/src/hotspot/share/classfile/classLoaderExt.cpp Mon Nov 27 20:35:56 2017 -0500
+++ b/src/hotspot/share/classfile/classLoaderExt.cpp Mon Nov 27 20:21:34 2017 -0800
@@ -1,5 +1,5 @@
/*
- * Copyright (c) 2015, Oracle and/or its affiliates. All rights reserved.
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
* DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
*
* This code is free software; you can redistribute it and/or modify it
@@ -23,14 +23,329 @@
*/
#include "precompiled.hpp"
+#include "classfile/classFileParser.hpp"
+#include "classfile/classFileStream.hpp"
#include "classfile/classListParser.hpp"
+#include "classfile/classLoader.hpp"
#include "classfile/classLoaderExt.hpp"
-#include "classfile/symbolTable.hpp"
-#include "classfile/systemDictionary.hpp"
+#include "classfile/classLoaderData.inline.hpp"
+#include "classfile/klassFactory.hpp"
+#include "classfile/sharedClassUtil.hpp"
+#include "classfile/sharedPathsMiscInfo.hpp"
+#include "classfile/systemDictionaryShared.hpp"
+#include "classfile/vmSymbols.hpp"
+#include "memory/allocation.inline.hpp"
+#include "memory/filemap.hpp"
+#include "memory/resourceArea.hpp"
+#include "oops/instanceKlass.hpp"
+#include "oops/oop.inline.hpp"
+#include "oops/symbol.hpp"
+#include "runtime/arguments.hpp"
+#include "runtime/java.hpp"
+#include "runtime/javaCalls.hpp"
+#include "runtime/os.hpp"
+#include "services/threadService.hpp"
+#include "utilities/stringUtils.hpp"
+
+jshort ClassLoaderExt::_app_paths_start_index = ClassLoaderExt::max_classpath_index;
+bool ClassLoaderExt::_has_app_classes = false;
+bool ClassLoaderExt::_has_platform_classes = false;
+
+void ClassLoaderExt::setup_app_search_path() {
+ assert(DumpSharedSpaces, "this function is only used with -Xshare:dump and -XX:+UseAppCDS");
+ _app_paths_start_index = ClassLoader::num_boot_classpath_entries();
+ char* app_class_path = os::strdup(Arguments::get_appclasspath());
+
+ if (strcmp(app_class_path, ".") == 0) {
+ // This doesn't make any sense, even for AppCDS, so let's skip it. We
+ // don't want to throw an error here because -cp "." is usually assigned
+ // by the launcher when classpath is not specified.
+ trace_class_path("app loader class path (skipped)=", app_class_path);
+ } else {
+ trace_class_path("app loader class path=", app_class_path);
+ shared_paths_misc_info()->add_app_classpath(app_class_path);
+ ClassLoader::setup_app_search_path(app_class_path);
+ }
+}
+
+char* ClassLoaderExt::read_manifest(ClassPathEntry* entry, jint *manifest_size, bool clean_text, TRAPS) {
+ const char* name = "META-INF/MANIFEST.MF";
+ char* manifest;
+ jint size;
+
+ assert(entry->is_jar_file(), "must be");
+ manifest = (char*) ((ClassPathZipEntry*)entry )->open_entry(name, &size, true, CHECK_NULL);
+
+ if (manifest == NULL) { // No Manifest
+ *manifest_size = 0;
+ return NULL;
+ }
+ if (clean_text) {
+ // See http://docs.oracle.com/javase/6/docs/technotes/guides/jar/jar.html#JAR%20Manifest
+ // (1): replace all CR/LF and CR with LF
+ StringUtils::replace_no_expand(manifest, "\r\n", "\n");
+
+ // (2) remove all new-line continuation (remove all "\n " substrings)
+ StringUtils::replace_no_expand(manifest, "\n ", "");
+ }
+
+ *manifest_size = (jint)strlen(manifest);
+ return manifest;
+}
+
+char* ClassLoaderExt::get_class_path_attr(const char* jar_path, char* manifest, jint manifest_size) {
+ const char* tag = "Class-Path: ";
+ const int tag_len = (int)strlen(tag);
+ char* found = NULL;
+ char* line_start = manifest;
+ char* end = manifest + manifest_size;
+
+ assert(*end == 0, "must be nul-terminated");
+
+ while (line_start < end) {
+ char* line_end = strchr(line_start, '\n');
+ if (line_end == NULL) {
+ // JAR spec require the manifest file to be terminated by a new line.
+ break;
+ }
+ if (strncmp(tag, line_start, tag_len) == 0) {
+ if (found != NULL) {
+ // Same behavior as jdk/src/share/classes/java/util/jar/Attributes.java
+ // If duplicated entries are found, the last one is used.
+ tty->print_cr("Warning: Duplicate name in Manifest: %s.\n"
+ "Ensure that the manifest does not have duplicate entries, and\n"
+ "that blank lines separate individual sections in both your\n"
+ "manifest and in the META-INF/MANIFEST.MF entry in the jar file:\n%s\n", tag, jar_path);
+ }
+ found = line_start + tag_len;
+ assert(found <= line_end, "sanity");
+ *line_end = '\0';
+ }
+ line_start = line_end + 1;
+ }
+ return found;
+}
+
+void ClassLoaderExt::process_jar_manifest(ClassPathEntry* entry,
+ bool check_for_duplicates) {
+ Thread* THREAD = Thread::current();
+ ResourceMark rm(THREAD);
+ jint manifest_size;
+ char* manifest = read_manifest(entry, &manifest_size, CHECK);
+
+ if (manifest == NULL) {
+ return;
+ }
+
+ if (strstr(manifest, "Extension-List:") != NULL) {
+ tty->print_cr("-Xshare:dump does not support Extension-List in JAR manifest: %s", entry->name());
+ vm_exit(1);
+ }
+
+ char* cp_attr = get_class_path_attr(entry->name(), manifest, manifest_size);
+
+ if (cp_attr != NULL && strlen(cp_attr) > 0) {
+ trace_class_path("found Class-Path: ", cp_attr);
+
+ char sep = os::file_separator()[0];
+ const char* dir_name = entry->name();
+ const char* dir_tail = strrchr(dir_name, sep);
+ int dir_len;
+ if (dir_tail == NULL) {
+ dir_len = 0;
+ } else {
+ dir_len = dir_tail - dir_name + 1;
+ }
+
+ // Split the cp_attr by spaces, and add each file
+ char* file_start = cp_attr;
+ char* end = file_start + strlen(file_start);
+
+ while (file_start < end) {
+ char* file_end = strchr(file_start, ' ');
+ if (file_end != NULL) {
+ *file_end = 0;
+ file_end += 1;
+ } else {
+ file_end = end;
+ }
+
+ int name_len = (int)strlen(file_start);
+ if (name_len > 0) {
+ ResourceMark rm(THREAD);
+ char* libname = NEW_RESOURCE_ARRAY(char, dir_len + name_len + 1);
+ *libname = 0;
+ strncat(libname, dir_name, dir_len);
+ strncat(libname, file_start, name_len);
+ trace_class_path("library = ", libname);
+ ClassLoader::update_class_path_entry_list(libname, true, false);
+ }
+
+ file_start = file_end;
+ }
+ }
+}
+
+void ClassLoaderExt::setup_search_paths() {
+ if (UseAppCDS) {
+ shared_paths_misc_info()->record_app_offset();
+ ClassLoaderExt::setup_app_search_path();
+ }
+}
+
+Thread* ClassLoaderExt::Context::_dump_thread = NULL;
+
+bool ClassLoaderExt::check(ClassLoaderExt::Context *context,
+ const ClassFileStream* stream,
+ const int classpath_index) {
+ if (stream != NULL) {
+ // Ignore any App classes from signed JAR file during CDS archiving
+ // dumping
+ if (DumpSharedSpaces &&
+ SharedClassUtil::is_classpath_entry_signed(classpath_index) &&
+ classpath_index >= _app_paths_start_index) {
+ tty->print_cr("Preload Warning: Skipping %s from signed JAR",
+ context->class_name());
+ return false;
+ }
+ if (classpath_index >= _app_paths_start_index) {
+ _has_app_classes = true;
+ _has_platform_classes = true;
+ }
+ }
+
+ return true;
+}
+
+void ClassLoaderExt::record_result(ClassLoaderExt::Context *context,
+ Symbol* class_name,
+ const s2 classpath_index,
+ InstanceKlass* result,
+ TRAPS) {
+ assert(DumpSharedSpaces, "Sanity");
+
+ // We need to remember where the class comes from during dumping.
+ oop loader = result->class_loader();
+ s2 classloader_type = ClassLoader::BOOT_LOADER;
+ if (SystemDictionary::is_system_class_loader(loader)) {
+ classloader_type = ClassLoader::APP_LOADER;
+ ClassLoaderExt::set_has_app_classes();
+ } else if (SystemDictionary::is_platform_class_loader(loader)) {
+ classloader_type = ClassLoader::PLATFORM_LOADER;
+ ClassLoaderExt::set_has_platform_classes();
+ }
+ result->set_shared_classpath_index(classpath_index);
+ result->set_class_loader_type(classloader_type);
+}
+
+void ClassLoaderExt::finalize_shared_paths_misc_info() {
+ if (UseAppCDS) {
+ if (!_has_app_classes) {
+ shared_paths_misc_info()->pop_app();
+ }
+ }
+}
+
+// Load the class of the given name from the location given by path. The path is specified by
+// the "source:" in the class list file (see classListParser.cpp), and can be a directory or
+// a JAR file.
+InstanceKlass* ClassLoaderExt::load_class(Symbol* name, const char* path, TRAPS) {
+
+ assert(name != NULL, "invariant");
+ assert(DumpSharedSpaces && UseAppCDS, "this function is only used with -Xshare:dump and -XX:+UseAppCDS");
+ ResourceMark rm(THREAD);
+ const char* class_name = name->as_C_string();
+
+ const char* file_name = file_name_for_class_name(class_name,
+ name->utf8_length());
+ assert(file_name != NULL, "invariant");
+
+ // Lookup stream for parsing .class file
+ ClassFileStream* stream = NULL;
+ ClassPathEntry* e = find_classpath_entry_from_cache(path, CHECK_NULL);
+ if (e == NULL) {
+ return NULL;
+ }
+ {
+ PerfClassTraceTime vmtimer(perf_sys_class_lookup_time(),
+ ((JavaThread*) THREAD)->get_thread_stat()->perf_timers_addr(),
+ PerfClassTraceTime::CLASS_LOAD);
+ stream = e->open_stream(file_name, CHECK_NULL);
+ }
+
+ if (NULL == stream) {
+ tty->print_cr("Preload Warning: Cannot find %s", class_name);
+ return NULL;
+ }
+
+ assert(stream != NULL, "invariant");
+ stream->set_verify(true);
+
+ ClassLoaderData* loader_data = ClassLoaderData::the_null_class_loader_data();
+ Handle protection_domain;
+
+ InstanceKlass* result = KlassFactory::create_from_stream(stream,
+ name,
+ loader_data,
+ protection_domain,
+ NULL, // host_klass
+ NULL, // cp_patches
+ THREAD);
+
+ if (HAS_PENDING_EXCEPTION) {
+ tty->print_cr("Preload Error: Failed to load %s", class_name);
+ return NULL;
+ }
+ result->set_shared_classpath_index(UNREGISTERED_INDEX);
+ SystemDictionaryShared::set_shared_class_misc_info(result, stream);
+ return result;
+}
+
+struct CachedClassPathEntry {
+ const char* _path;
+ ClassPathEntry* _entry;
+};
+
+static GrowableArray<CachedClassPathEntry>* cached_path_entries = NULL;
+
+ClassPathEntry* ClassLoaderExt::find_classpath_entry_from_cache(const char* path, TRAPS) {
+ // This is called from dump time so it's single threaded and there's no need for a lock.
+ assert(DumpSharedSpaces && UseAppCDS, "this function is only used with -Xshare:dump and -XX:+UseAppCDS");
+ if (cached_path_entries == NULL) {
+ cached_path_entries = new (ResourceObj::C_HEAP, mtClass) GrowableArray<CachedClassPathEntry>(20, /*c heap*/ true);
+ }
+ CachedClassPathEntry ccpe;
+ for (int i=0; i<cached_path_entries->length(); i++) {
+ ccpe = cached_path_entries->at(i);
+ if (strcmp(ccpe._path, path) == 0) {
+ if (i != 0) {
+ // Put recent entries at the beginning to speed up searches.
+ cached_path_entries->remove_at(i);
+ cached_path_entries->insert_before(0, ccpe);
+ }
+ return ccpe._entry;
+ }
+ }
+
+ struct stat st;
+ if (os::stat(path, &st) != 0) {
+ // File or directory not found
+ return NULL;
+ }
+ ClassPathEntry* new_entry = NULL;
+
+ new_entry = create_class_path_entry(path, &st, false, false, CHECK_NULL);
+ if (new_entry == NULL) {
+ return NULL;
+ }
+ ccpe._path = strdup(path);
+ ccpe._entry = new_entry;
+ cached_path_entries->insert_before(0, ccpe);
+ return new_entry;
+}
+
Klass* ClassLoaderExt::load_one_class(ClassListParser* parser, TRAPS) {
- TempNewSymbol class_name_symbol = SymbolTable::new_symbol(parser->current_class_name(), THREAD);
- guarantee(!HAS_PENDING_EXCEPTION, "Exception creating a symbol.");
- return SystemDictionary::resolve_or_null(class_name_symbol, THREAD);
+ return parser->load_current_class(THREAD);
}
--- a/src/hotspot/share/classfile/classLoaderExt.hpp Mon Nov 27 20:35:56 2017 -0500
+++ b/src/hotspot/share/classfile/classLoaderExt.hpp Mon Nov 27 20:21:34 2017 -0800
@@ -26,65 +26,152 @@
#define SHARE_VM_CLASSFILE_CLASSLOADEREXT_HPP
#include "classfile/classLoader.hpp"
-#include "classfile/systemDictionary.hpp"
-#include "oops/instanceKlass.hpp"
-#include "runtime/handles.hpp"
+#include "utilities/macros.hpp"
-class ClassListParser;
+CDS_ONLY(class SharedPathsMiscInfoExt;)
+CDS_ONLY(class ClassListParser;)
class ClassLoaderExt: public ClassLoader { // AllStatic
public:
-
+ enum SomeConstants {
+ max_classpath_index = 0x7fff
+ };
+ // ClassLoaderExt::Context --
+ //
+ // This is used by DumpSharedSpaces only - it enforces the same classloader
+ // delegation model as would be in run-time. I.e.,
+ // + classes defined by the NULL class loader cannot load classes in the PLATFORM or APP paths.
+ // + classes defined by the PLATFORM class loader cannot load classes in the APP paths.
class Context {
+ static Thread* _dump_thread;
+ const char* _class_name;
const char* _file_name;
public:
+ const char* class_name() {
+ return _class_name;
+ }
+ const char* file_name() {
+ return _file_name;
+ }
+
Context(const char* class_name, const char* file_name, TRAPS) {
+ _class_name = class_name;
_file_name = file_name;
+#if INCLUDE_CDS
+ if (!DumpSharedSpaces && !UseSharedSpaces) {
+ // Must not modify _app_paths_start_index if we're not using CDS.
+ assert(_app_paths_start_index == ClassLoaderExt::max_classpath_index, "must be");
+ }
+#endif
}
bool check(const ClassFileStream* stream, const int classpath_index) {
- return true;
+ CDS_ONLY(return ClassLoaderExt::check(this, stream, classpath_index);)
+ NOT_CDS(return true;)
}
bool should_verify(int classpath_index) {
- return false;
+ CDS_ONLY(return (classpath_index >= _app_paths_start_index);)
+ NOT_CDS(return false;)
}
void record_result(Symbol* class_name,
const s2 classpath_index,
- InstanceKlass* result, TRAPS) {
+ InstanceKlass* result,
+ TRAPS) {
#if INCLUDE_CDS
- assert(DumpSharedSpaces, "Sanity");
- oop loader = result->class_loader();
- s2 classloader_type = ClassLoader::BOOT_LOADER;
- if (SystemDictionary::is_system_class_loader(loader)) {
- classloader_type = ClassLoader::APP_LOADER;
- ClassLoaderExt::set_has_app_classes();
- } else if (SystemDictionary::is_platform_class_loader(loader)) {
- classloader_type = ClassLoader::PLATFORM_LOADER;
- ClassLoaderExt::set_has_platform_classes();
+ ClassLoaderExt::record_result(this, class_name, classpath_index, result, THREAD);
+#endif
+ }
+
+ ~Context() {
+#if INCLUDE_CDS
+ if (!DumpSharedSpaces && !UseSharedSpaces) {
+ // Must not modify app_paths_start_index if we're not using CDS.
+ assert(_app_paths_start_index == ClassLoaderExt::max_classpath_index, "must be");
}
- result->set_shared_classpath_index(classpath_index);
- result->set_class_loader_type(classloader_type);
#endif
}
- };
+ }; // end ClassLoaderExt::Context
+private:
+#if INCLUDE_CDS
+ static char* get_class_path_attr(const char* jar_path, char* manifest, jint manifest_size);
+ static void setup_app_search_path(); // Only when -Xshare:dump
+ static SharedPathsMiscInfoExt* shared_paths_misc_info() {
+ return (SharedPathsMiscInfoExt*)_shared_paths_misc_info;
+ }
+ static jshort _app_paths_start_index; // index of first app JAR in shared classpath entry table
+ static bool _has_app_classes;
+ static bool _has_platform_classes;
+#endif
+
+public:
+ CDS_ONLY(static void process_jar_manifest(ClassPathEntry* entry, bool check_for_duplicates);)
+
+ // Called by JVMTI code to add boot classpath
static void append_boot_classpath(ClassPathEntry* new_entry) {
+#if INCLUDE_CDS
+ if (UseAppCDS) {
+ warning("UseAppCDS is disabled because bootstrap classpath has been appended");
+ UseAppCDS = false;
+ }
+#endif
ClassLoader::add_to_boot_append_entries(new_entry);
}
- static void setup_search_paths() {}
- static bool is_boot_classpath(int classpath_index) {
- return true;
- }
- static Klass* load_one_class(ClassListParser* parser, TRAPS);
+
+ static void setup_search_paths() NOT_CDS_RETURN;
+
#if INCLUDE_CDS
- static void set_has_app_classes() {}
- static void set_has_platform_classes() {}
+private:
+ static char* read_manifest(ClassPathEntry* entry, jint *manifest_size, bool clean_text, TRAPS);
+ static ClassPathEntry* find_classpath_entry_from_cache(const char* path, TRAPS);
+
+public:
static char* read_manifest(ClassPathEntry* entry, jint *manifest_size, TRAPS) {
- return NULL;
+ // Remove all the new-line continuations (which wrap long lines at 72 characters, see
+ // http://docs.oracle.com/javase/6/docs/technotes/guides/jar/jar.html#JAR%20Manifest), so
+ // that the manifest is easier to parse.
+ return read_manifest(entry, manifest_size, true, THREAD);
+ }
+ static char* read_raw_manifest(ClassPathEntry* entry, jint *manifest_size, TRAPS) {
+ // Do not remove new-line continuations, so we can easily pass it as an argument to
+ // java.util.jar.Manifest.getManifest() at run-time.
+ return read_manifest(entry, manifest_size, false, THREAD);
+ }
+
+ static void finalize_shared_paths_misc_info();
+
+ static jshort app_paths_start_index() { return _app_paths_start_index; }
+
+ static void init_paths_start_index(jshort app_start) {
+ _app_paths_start_index = app_start;
+ }
+
+ static bool is_boot_classpath(int classpath_index) {
+ return classpath_index < _app_paths_start_index;
}
- static void process_jar_manifest(ClassPathEntry* entry, bool check_for_duplicates) {}
+
+ static bool has_platform_or_app_classes() {
+ return _has_app_classes || _has_platform_classes;
+ }
+
+ static bool check(class ClassLoaderExt::Context *context,
+ const ClassFileStream* stream,
+ const int classpath_index);
+
+ static void record_result(class ClassLoaderExt::Context *context,
+ Symbol* class_name,
+ const s2 classpath_index,
+ InstanceKlass* result, TRAPS);
+ static InstanceKlass* load_class(Symbol* h_name, const char* path, TRAPS);
+ static Klass* load_one_class(ClassListParser* parser, TRAPS);
+ static void set_has_app_classes() {
+ _has_app_classes = true;
+ }
+ static void set_has_platform_classes() {
+ _has_platform_classes = true;
+ }
#endif
};
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/src/hotspot/share/classfile/sharedClassUtil.cpp Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,248 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+#include "precompiled.hpp"
+#include "classfile/classLoader.hpp"
+#include "classfile/classLoaderExt.hpp"
+#include "classfile/dictionary.hpp"
+#include "classfile/javaClasses.hpp"
+#include "classfile/sharedClassUtil.hpp"
+#include "classfile/stringTable.hpp"
+#include "classfile/symbolTable.hpp"
+#include "classfile/systemDictionary.hpp"
+#include "classfile/systemDictionaryShared.hpp"
+#include "memory/filemap.hpp"
+#include "memory/metadataFactory.hpp"
+#include "memory/resourceArea.hpp"
+#include "oops/instanceKlass.hpp"
+#include "runtime/arguments.hpp"
+#include "runtime/java.hpp"
+#include "runtime/os.hpp"
+
+class ManifestStream: public ResourceObj {
+ private:
+ u1* _buffer_start; // Buffer bottom
+ u1* _buffer_end; // Buffer top (one past last element)
+ u1* _current; // Current buffer position
+
+ public:
+ // Constructor
+ ManifestStream(u1* buffer, int length) : _buffer_start(buffer),
+ _current(buffer) {
+ _buffer_end = buffer + length;
+ }
+
+ static bool is_attr(u1* attr, const char* name) {
+ return strncmp((const char*)attr, name, strlen(name)) == 0;
+ }
+
+ static char* copy_attr(u1* value, size_t len) {
+ char* buf = NEW_RESOURCE_ARRAY(char, len + 1);
+ strncpy(buf, (char*)value, len);
+ buf[len] = 0;
+ return buf;
+ }
+
+ // The return value indicates if the JAR is signed or not
+ bool check_is_signed() {
+ u1* attr = _current;
+ bool isSigned = false;
+ while (_current < _buffer_end) {
+ if (*_current == '\n') {
+ *_current = '\0';
+ u1* value = (u1*)strchr((char*)attr, ':');
+ if (value != NULL) {
+ assert(*(value+1) == ' ', "Unrecognized format" );
+ if (strstr((char*)attr, "-Digest") != NULL) {
+ isSigned = true;
+ break;
+ }
+ }
+ *_current = '\n'; // restore
+ attr = _current + 1;
+ }
+ _current ++;
+ }
+ return isSigned;
+ }
+};
+
+void SharedPathsMiscInfoExt::print_path(outputStream* out, int type, const char* path) {
+ switch(type) {
+ case APP:
+ ClassLoader::trace_class_path("Expecting -Djava.class.path=", path);
+ break;
+ default:
+ SharedPathsMiscInfo::print_path(out, type, path);
+ }
+}
+
+bool SharedPathsMiscInfoExt::check(jint type, const char* path) {
+
+ switch (type) {
+ case APP:
+ {
+ // Prefix is OK: E.g., dump with -cp foo.jar, but run with -cp foo.jar:bar.jar
+ size_t len = strlen(path);
+ const char *appcp = Arguments::get_appclasspath();
+ assert(appcp != NULL, "NULL app classpath");
+ size_t appcp_len = strlen(appcp);
+ if (appcp_len < len) {
+ return fail("Run time APP classpath is shorter than the one at dump time: ", appcp);
+ }
+ ResourceMark rm;
+ char* tmp_path;
+ if (len == appcp_len) {
+ tmp_path = (char*)appcp;
+ } else {
+ tmp_path = NEW_RESOURCE_ARRAY(char, len + 1);
+ strncpy(tmp_path, appcp, len);
+ tmp_path[len] = 0;
+ }
+ if (os::file_name_strcmp(path, tmp_path) != 0) {
+ return fail("[APP classpath mismatch, actual: -Djava.class.path=", appcp);
+ }
+ if (appcp[len] != '\0' && appcp[len] != os::path_separator()[0]) {
+ return fail("Dump time APP classpath is not a proper prefix of run time APP classpath: ", appcp);
+ }
+ }
+ break;
+ default:
+ return SharedPathsMiscInfo::check(type, path);
+ }
+
+ return true;
+}
+
+void SharedClassUtil::update_shared_classpath(ClassPathEntry *cpe, SharedClassPathEntry* e, TRAPS) {
+ ClassLoaderData* loader_data = ClassLoaderData::the_null_class_loader_data();
+ SharedClassPathEntryExt* ent = (SharedClassPathEntryExt*)e;
+ ResourceMark rm(THREAD);
+ jint manifest_size;
+ bool isSigned;
+ char* manifest = ClassLoaderExt::read_manifest(cpe, &manifest_size, CHECK);
+ if (manifest != NULL) {
+ ManifestStream* stream = new ManifestStream((u1*)manifest,
+ manifest_size);
+ isSigned = stream->check_is_signed();
+ if (isSigned) {
+ ent->_is_signed = true;
+ } else {
+ // Copy the manifest into the shared archive
+ manifest = ClassLoaderExt::read_raw_manifest(cpe, &manifest_size, CHECK);
+ Array<u1>* buf = MetadataFactory::new_array<u1>(loader_data,
+ manifest_size,
+ THREAD);
+ char* p = (char*)(buf->data());
+ memcpy(p, manifest, manifest_size);
+ ent->set_manifest(buf);
+ ent->_is_signed = false;
+ }
+ }
+}
+
+void SharedClassUtil::initialize(TRAPS) {
+ if (UseSharedSpaces) {
+ int size = FileMapInfo::get_number_of_share_classpaths();
+ if (size > 0) {
+ SystemDictionaryShared::allocate_shared_data_arrays(size, THREAD);
+ if (!DumpSharedSpaces) {
+ FileMapHeaderExt* header = (FileMapHeaderExt*)FileMapInfo::current_info()->header();
+ ClassLoaderExt::init_paths_start_index(header->_app_paths_start_index);
+ }
+ }
+ }
+
+ if (DumpSharedSpaces) {
+ if (SharedArchiveConfigFile) {
+ read_extra_data(SharedArchiveConfigFile, THREAD);
+ }
+ }
+}
+
+void SharedClassUtil::read_extra_data(const char* filename, TRAPS) {
+ HashtableTextDump reader(filename);
+ reader.check_version("VERSION: 1.0");
+
+ while (reader.remain() > 0) {
+ int utf8_length;
+ int prefix_type = reader.scan_prefix(&utf8_length);
+ ResourceMark rm(THREAD);
+ char* utf8_buffer = NEW_RESOURCE_ARRAY(char, utf8_length);
+ reader.get_utf8(utf8_buffer, utf8_length);
+
+ if (prefix_type == HashtableTextDump::SymbolPrefix) {
+ SymbolTable::new_symbol(utf8_buffer, utf8_length, THREAD);
+ } else{
+ assert(prefix_type == HashtableTextDump::StringPrefix, "Sanity");
+ utf8_buffer[utf8_length] = '\0';
+ oop s = StringTable::intern(utf8_buffer, THREAD);
+ }
+ }
+}
+
+bool SharedClassUtil::is_classpath_entry_signed(int classpath_index) {
+ assert(classpath_index >= 0, "Sanity");
+ SharedClassPathEntryExt* ent = (SharedClassPathEntryExt*)
+ FileMapInfo::shared_classpath(classpath_index);
+ return ent->_is_signed;
+}
+
+void FileMapHeaderExt::populate(FileMapInfo* mapinfo, size_t alignment) {
+ FileMapInfo::FileMapHeader::populate(mapinfo, alignment);
+
+ ClassLoaderExt::finalize_shared_paths_misc_info();
+ _app_paths_start_index = ClassLoaderExt::app_paths_start_index();
+
+ _verify_local = BytecodeVerificationLocal;
+ _verify_remote = BytecodeVerificationRemote;
+ _has_platform_or_app_classes = ClassLoaderExt::has_platform_or_app_classes();
+}
+
+bool FileMapHeaderExt::validate() {
+ if (UseAppCDS) {
+ const char* prop = Arguments::get_property("java.system.class.loader");
+ if (prop != NULL) {
+ warning("UseAppCDS is disabled because the java.system.class.loader property is specified (value = \"%s\"). "
+ "To enable UseAppCDS, this property must be not be set", prop);
+ UseAppCDS = false;
+ }
+ }
+
+ if (!FileMapInfo::FileMapHeader::validate()) {
+ return false;
+ }
+
+ // For backwards compatibility, we don't check the verification setting
+ // if the archive only contains system classes.
+ if (_has_platform_or_app_classes &&
+ ((!_verify_local && BytecodeVerificationLocal) ||
+ (!_verify_remote && BytecodeVerificationRemote))) {
+ FileMapInfo::fail_continue("The shared archive file was created with less restrictive "
+ "verification setting than the current setting.");
+ return false;
+ }
+
+ return true;
+}
--- a/src/hotspot/share/classfile/sharedClassUtil.hpp Mon Nov 27 20:35:56 2017 -0500
+++ b/src/hotspot/share/classfile/sharedClassUtil.hpp Mon Nov 27 20:21:34 2017 -0800
@@ -27,37 +27,108 @@
#include "classfile/sharedPathsMiscInfo.hpp"
#include "memory/filemap.hpp"
+#include "classfile/classLoaderExt.hpp"
+#include "classfile/dictionary.hpp"
+#include "classfile/systemDictionaryShared.hpp"
+#include "oops/klass.hpp"
+
+class FileMapHeaderExt: public FileMapInfo::FileMapHeader {
+public:
+ jshort _app_paths_start_index; // Index of first app classpath entry
+ bool _verify_local; // BytecodeVerificationLocal setting
+ bool _verify_remote; // BytecodeVerificationRemote setting
+ bool _has_platform_or_app_classes; // Archive contains app classes
+
+ FileMapHeaderExt() {
+ _has_platform_or_app_classes = true;
+ }
+ virtual void populate(FileMapInfo* mapinfo, size_t alignment);
+ virtual bool validate();
+};
+
+// In addition to SharedPathsMiscInfo, the following information is also stored
+//
+//
+// + The value of Arguments::get_appclasspath() used during dumping.
+//
+class SharedPathsMiscInfoExt : public SharedPathsMiscInfo {
+private:
+ int _app_offset;
+public:
+ enum {
+ APP = 5
+ };
+
+ virtual const char* type_name(int type) {
+ switch (type) {
+ case APP: return "APP";
+ default: return SharedPathsMiscInfo::type_name(type);
+ }
+ }
+
+ virtual void print_path(outputStream* out, int type, const char* path);
+
+ SharedPathsMiscInfoExt() : SharedPathsMiscInfo() {
+ _app_offset = 0;
+ }
+ SharedPathsMiscInfoExt(char* buf, int size) : SharedPathsMiscInfo(buf, size) {
+ _app_offset = 0;
+ }
+
+ virtual bool check(jint type, const char* path);
+
+ void add_app_classpath(const char* path) {
+ add_path(path, APP);
+ }
+
+ void record_app_offset() {
+ _app_offset = get_used_bytes();
+ }
+ void pop_app() {
+ _cur_ptr = _buf_start + _app_offset;
+ write_jint(0);
+ }
+};
+
+class SharedClassPathEntryExt: public SharedClassPathEntry {
+public:
+ //Maniest attributes
+ bool _is_signed;
+ void set_manifest(Array<u1>* manifest) {
+ _manifest = manifest;
+ }
+};
class SharedClassUtil : AllStatic {
public:
-
static SharedPathsMiscInfo* allocate_shared_paths_misc_info() {
- return new SharedPathsMiscInfo();
+ return new SharedPathsMiscInfoExt();
}
static SharedPathsMiscInfo* allocate_shared_paths_misc_info(char* buf, int size) {
- return new SharedPathsMiscInfo(buf, size);
+ return new SharedPathsMiscInfoExt(buf, size);
}
static FileMapInfo::FileMapHeader* allocate_file_map_header() {
- return new FileMapInfo::FileMapHeader();
+ return new FileMapHeaderExt();
}
static size_t file_map_header_size() {
- return sizeof(FileMapInfo::FileMapHeader);
+ return sizeof(FileMapHeaderExt);
}
static size_t shared_class_path_entry_size() {
- return sizeof(SharedClassPathEntry);
+ return sizeof(SharedClassPathEntryExt);
}
- static void update_shared_classpath(ClassPathEntry *cpe,
- SharedClassPathEntry* ent, TRAPS) {}
- static void initialize(TRAPS) {}
+ static void update_shared_classpath(ClassPathEntry *cpe, SharedClassPathEntry* ent, TRAPS);
+ static void initialize(TRAPS);
- inline static bool is_shared_boot_class(Klass* klass) {
- return (klass->_shared_class_path_index >= 0);
- }
+private:
+ static void read_extra_data(const char* filename, TRAPS);
+
+public:
+ static bool is_classpath_entry_signed(int classpath_index);
};
#endif // SHARE_VM_CLASSFILE_SHAREDCLASSUTIL_HPP
--- a/src/hotspot/share/classfile/systemDictionary.cpp Mon Nov 27 20:35:56 2017 -0500
+++ b/src/hotspot/share/classfile/systemDictionary.cpp Mon Nov 27 20:21:34 2017 -0800
@@ -1087,7 +1087,7 @@
#if INCLUDE_CDS
ResourceMark rm(THREAD);
if (DumpSharedSpaces && !class_loader.is_null() &&
- !ArgumentsExt::using_AppCDS() && strcmp(class_name->as_C_string(), "Unnamed") != 0) {
+ !UseAppCDS && strcmp(class_name->as_C_string(), "Unnamed") != 0) {
// If AppCDS is not enabled, don't define the class at dump time (except for the "Unnamed"
// class, which is used by MethodHandles).
THROW_MSG_NULL(vmSymbols::java_lang_ClassNotFoundException(), class_name->as_C_string());
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/src/hotspot/share/classfile/systemDictionaryShared.cpp Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,1086 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+#include "precompiled.hpp"
+#include "classfile/classFileStream.hpp"
+#include "classfile/classListParser.hpp"
+#include "classfile/classLoader.hpp"
+#include "classfile/classLoaderData.inline.hpp"
+#include "classfile/classLoaderExt.hpp"
+#include "classfile/compactHashtable.inline.hpp"
+#include "classfile/dictionary.hpp"
+#include "classfile/javaClasses.hpp"
+#include "classfile/sharedClassUtil.hpp"
+#include "classfile/symbolTable.hpp"
+#include "classfile/systemDictionary.hpp"
+#include "classfile/systemDictionaryShared.hpp"
+#include "classfile/verificationType.hpp"
+#include "classfile/vmSymbols.hpp"
+#include "logging/log.hpp"
+#include "memory/allocation.hpp"
+#include "memory/filemap.hpp"
+#include "memory/metadataFactory.hpp"
+#include "memory/metaspaceClosure.hpp"
+#include "memory/oopFactory.hpp"
+#include "memory/resourceArea.hpp"
+#include "oops/instanceKlass.hpp"
+#include "oops/klass.inline.hpp"
+#include "oops/objArrayOop.inline.hpp"
+#include "oops/oop.inline.hpp"
+#include "runtime/java.hpp"
+#include "runtime/javaCalls.hpp"
+#include "runtime/mutexLocker.hpp"
+#include "utilities/hashtable.inline.hpp"
+#include "utilities/stringUtils.hpp"
+
+
+objArrayOop SystemDictionaryShared::_shared_protection_domains = NULL;
+objArrayOop SystemDictionaryShared::_shared_jar_urls = NULL;
+objArrayOop SystemDictionaryShared::_shared_jar_manifests = NULL;
+
+static Mutex* SharedDictionary_lock = NULL;
+
+void SystemDictionaryShared::initialize(TRAPS) {
+ if (_java_system_loader != NULL) {
+ SharedDictionary_lock = new Mutex(Mutex::leaf, "SharedDictionary_lock", true);
+
+ // These classes need to be initialized before calling get_shared_jar_manifest(), etc.
+ SystemDictionary::ByteArrayInputStream_klass()->initialize(CHECK);
+ SystemDictionary::File_klass()->initialize(CHECK);
+ SystemDictionary::Jar_Manifest_klass()->initialize(CHECK);
+ SystemDictionary::CodeSource_klass()->initialize(CHECK);
+ }
+}
+
+oop SystemDictionaryShared::shared_protection_domain(int index) {
+ return _shared_protection_domains->obj_at(index);
+}
+
+oop SystemDictionaryShared::shared_jar_url(int index) {
+ return _shared_jar_urls->obj_at(index);
+}
+
+oop SystemDictionaryShared::shared_jar_manifest(int index) {
+ return _shared_jar_manifests->obj_at(index);
+}
+
+
+Handle SystemDictionaryShared::get_shared_jar_manifest(int shared_path_index, TRAPS) {
+ Handle empty;
+ Handle manifest ;
+ if (shared_jar_manifest(shared_path_index) == NULL) {
+ SharedClassPathEntryExt* ent = (SharedClassPathEntryExt*)FileMapInfo::shared_classpath(shared_path_index);
+ long size = ent->manifest_size();
+ if (size <= 0) {
+ return empty; // No manifest - return NULL handle
+ }
+
+ // ByteArrayInputStream bais = new ByteArrayInputStream(buf);
+ InstanceKlass* bais_klass = SystemDictionary::ByteArrayInputStream_klass();
+ Handle bais = bais_klass->allocate_instance_handle(CHECK_(empty));
+ {
+ const char* src = ent->manifest();
+ assert(src != NULL, "No Manifest data");
+ typeArrayOop buf = oopFactory::new_byteArray(size, CHECK_(empty));
+ typeArrayHandle bufhandle(THREAD, buf);
+ char* dst = (char*)(buf->byte_at_addr(0));
+ memcpy(dst, src, (size_t)size);
+
+ JavaValue result(T_VOID);
+ JavaCalls::call_special(&result, bais, bais_klass,
+ vmSymbols::object_initializer_name(),
+ vmSymbols::byte_array_void_signature(),
+ bufhandle, CHECK_(empty));
+ }
+
+ // manifest = new Manifest(bais)
+ InstanceKlass* manifest_klass = SystemDictionary::Jar_Manifest_klass();
+ manifest = manifest_klass->allocate_instance_handle(CHECK_(empty));
+ {
+ JavaValue result(T_VOID);
+ JavaCalls::call_special(&result, manifest, manifest_klass,
+ vmSymbols::object_initializer_name(),
+ vmSymbols::input_stream_void_signature(),
+ bais, CHECK_(empty));
+ }
+ atomic_set_shared_jar_manifest(shared_path_index, manifest());
+ }
+
+ manifest = Handle(THREAD, shared_jar_manifest(shared_path_index));
+ assert(manifest.not_null(), "sanity");
+ return manifest;
+}
+
+Handle SystemDictionaryShared::get_shared_jar_url(int shared_path_index, TRAPS) {
+ Handle url_h;
+ if (shared_jar_url(shared_path_index) == NULL) {
+ JavaValue result(T_OBJECT);
+ const char* path = FileMapInfo::shared_classpath_name(shared_path_index);
+ Handle path_string = java_lang_String::create_from_str(path, CHECK_(url_h));
+ Klass* classLoaders_klass =
+ SystemDictionary::jdk_internal_loader_ClassLoaders_klass();
+ JavaCalls::call_static(&result, classLoaders_klass,
+ vmSymbols::toFileURL_name(),
+ vmSymbols::toFileURL_signature(),
+ path_string, CHECK_(url_h));
+
+ atomic_set_shared_jar_url(shared_path_index, (oop)result.get_jobject());
+ }
+
+ url_h = Handle(THREAD, shared_jar_url(shared_path_index));
+ assert(url_h.not_null(), "sanity");
+ return url_h;
+}
+
+Handle SystemDictionaryShared::get_package_name(Symbol* class_name, TRAPS) {
+ ResourceMark rm(THREAD);
+ Handle pkgname_string;
+ char* pkgname = (char*) ClassLoader::package_from_name((const char*) class_name->as_C_string());
+ if (pkgname != NULL) { // Package prefix found
+ StringUtils::replace_no_expand(pkgname, "/", ".");
+ pkgname_string = java_lang_String::create_from_str(pkgname,
+ CHECK_(pkgname_string));
+ }
+ return pkgname_string;
+}
+
+// Define Package for shared app classes from JAR file and also checks for
+// package sealing (all done in Java code)
+// See http://docs.oracle.com/javase/tutorial/deployment/jar/sealman.html
+void SystemDictionaryShared::define_shared_package(Symbol* class_name,
+ Handle class_loader,
+ Handle manifest,
+ Handle url,
+ TRAPS) {
+ assert(class_loader == _java_system_loader, "unexpected class loader");
+ // get_package_name() returns a NULL handle if the class is in unnamed package
+ Handle pkgname_string = get_package_name(class_name, CHECK);
+ if (pkgname_string.not_null()) {
+ Klass* app_classLoader_klass = SystemDictionary::jdk_internal_loader_ClassLoaders_AppClassLoader_klass();
+ JavaValue result(T_OBJECT);
+ JavaCallArguments args(3);
+ args.set_receiver(class_loader);
+ args.push_oop(pkgname_string);
+ args.push_oop(manifest);
+ args.push_oop(url);
+ JavaCalls::call_virtual(&result, app_classLoader_klass,
+ vmSymbols::defineOrCheckPackage_name(),
+ vmSymbols::defineOrCheckPackage_signature(),
+ &args,
+ CHECK);
+ }
+}
+
+// Define Package for shared app/platform classes from named module
+void SystemDictionaryShared::define_shared_package(Symbol* class_name,
+ Handle class_loader,
+ ModuleEntry* mod_entry,
+ TRAPS) {
+ assert(mod_entry != NULL, "module_entry should not be NULL");
+ Handle module_handle(THREAD, mod_entry->module());
+
+ Handle pkg_name = get_package_name(class_name, CHECK);
+ assert(pkg_name.not_null(), "Package should not be null for class in named module");
+
+ Klass* classLoader_klass;
+ if (SystemDictionary::is_system_class_loader(class_loader())) {
+ classLoader_klass = SystemDictionary::jdk_internal_loader_ClassLoaders_AppClassLoader_klass();
+ } else {
+ assert(SystemDictionary::is_platform_class_loader(class_loader()), "unexpected classloader");
+ classLoader_klass = SystemDictionary::jdk_internal_loader_ClassLoaders_PlatformClassLoader_klass();
+ }
+
+ JavaValue result(T_OBJECT);
+ JavaCallArguments args(2);
+ args.set_receiver(class_loader);
+ args.push_oop(pkg_name);
+ args.push_oop(module_handle);
+ JavaCalls::call_virtual(&result, classLoader_klass,
+ vmSymbols::definePackage_name(),
+ vmSymbols::definePackage_signature(),
+ &args,
+ CHECK);
+}
+
+// Get the ProtectionDomain associated with the CodeSource from the classloader.
+Handle SystemDictionaryShared::get_protection_domain_from_classloader(Handle class_loader,
+ Handle url, TRAPS) {
+ // CodeSource cs = new CodeSource(url, null);
+ InstanceKlass* cs_klass = SystemDictionary::CodeSource_klass();
+ Handle cs = cs_klass->allocate_instance_handle(CHECK_NH);
+ JavaValue void_result(T_VOID);
+ JavaCalls::call_special(&void_result, cs, cs_klass,
+ vmSymbols::object_initializer_name(),
+ vmSymbols::url_code_signer_array_void_signature(),
+ url, Handle(), CHECK_NH);
+
+ // protection_domain = SecureClassLoader.getProtectionDomain(cs);
+ Klass* secureClassLoader_klass = SystemDictionary::SecureClassLoader_klass();
+ JavaValue obj_result(T_OBJECT);
+ JavaCalls::call_virtual(&obj_result, class_loader, secureClassLoader_klass,
+ vmSymbols::getProtectionDomain_name(),
+ vmSymbols::getProtectionDomain_signature(),
+ cs, CHECK_NH);
+ return Handle(THREAD, (oop)obj_result.get_jobject());
+}
+
+// Returns the ProtectionDomain associated with the JAR file identified by the url.
+Handle SystemDictionaryShared::get_shared_protection_domain(Handle class_loader,
+ int shared_path_index,
+ Handle url,
+ TRAPS) {
+ Handle protection_domain;
+ if (shared_protection_domain(shared_path_index) == NULL) {
+ Handle pd = get_protection_domain_from_classloader(class_loader, url, THREAD);
+ atomic_set_shared_protection_domain(shared_path_index, pd());
+ }
+
+ // Acquire from the cache because if another thread beats the current one to
+ // set the shared protection_domain and the atomic_set fails, the current thread
+ // needs to get the updated protection_domain from the cache.
+ protection_domain = Handle(THREAD, shared_protection_domain(shared_path_index));
+ assert(protection_domain.not_null(), "sanity");
+ return protection_domain;
+}
+
+// Returns the ProtectionDomain associated with the moduleEntry.
+Handle SystemDictionaryShared::get_shared_protection_domain(Handle class_loader,
+ ModuleEntry* mod, TRAPS) {
+ ClassLoaderData *loader_data = mod->loader_data();
+ Handle protection_domain;
+ if (mod->shared_protection_domain() == NULL) {
+ Symbol* location = mod->location();
+ if (location != NULL) {
+ Handle url_string = java_lang_String::create_from_symbol(
+ location, CHECK_(protection_domain));
+ JavaValue result(T_OBJECT);
+ Klass* classLoaders_klass =
+ SystemDictionary::jdk_internal_loader_ClassLoaders_klass();
+ JavaCalls::call_static(&result, classLoaders_klass, vmSymbols::toFileURL_name(),
+ vmSymbols::toFileURL_signature(),
+ url_string, CHECK_(protection_domain));
+ Handle url = Handle(THREAD, (oop)result.get_jobject());
+
+ Handle pd = get_protection_domain_from_classloader(class_loader, url, THREAD);
+ mod->set_shared_protection_domain(loader_data, pd);
+ }
+ }
+
+ protection_domain = Handle(THREAD, mod->shared_protection_domain());
+ assert(protection_domain.not_null(), "sanity");
+ return protection_domain;
+}
+
+// Initializes the java.lang.Package and java.security.ProtectionDomain objects associated with
+// the given InstanceKlass.
+// Returns the ProtectionDomain for the InstanceKlass.
+Handle SystemDictionaryShared::init_security_info(Handle class_loader, InstanceKlass* ik, TRAPS) {
+ Handle pd;
+
+ if (ik != NULL) {
+ int index = ik->shared_classpath_index();
+ assert(index >= 0, "Sanity");
+ SharedClassPathEntryExt* ent =
+ (SharedClassPathEntryExt*)FileMapInfo::shared_classpath(index);
+ Symbol* class_name = ik->name();
+
+ if (ent->is_modules_image()) {
+ // For shared app/platform classes originated from the run-time image:
+ // The ProtectionDomains are cached in the corresponding ModuleEntries
+ // for fast access by the VM.
+ ResourceMark rm;
+ ClassLoaderData *loader_data =
+ ClassLoaderData::class_loader_data(class_loader());
+ PackageEntryTable* pkgEntryTable = loader_data->packages();
+ TempNewSymbol pkg_name = InstanceKlass::package_from_name(class_name, CHECK_(pd));
+ if (pkg_name != NULL) {
+ PackageEntry* pkg_entry = pkgEntryTable->lookup_only(pkg_name);
+ if (pkg_entry != NULL) {
+ ModuleEntry* mod_entry = pkg_entry->module();
+ pd = get_shared_protection_domain(class_loader, mod_entry, THREAD);
+ define_shared_package(class_name, class_loader, mod_entry, CHECK_(pd));
+ }
+ }
+ } else {
+ // For shared app/platform classes originated from JAR files on the class path:
+ // Each of the 3 SystemDictionaryShared::_shared_xxx arrays has the same length
+ // as the shared classpath table in the shared archive (see
+ // FileMap::_classpath_entry_table in filemap.hpp for details).
+ //
+ // If a shared InstanceKlass k is loaded from the class path, let
+ //
+ // index = k->shared_classpath_index():
+ //
+ // FileMap::_classpath_entry_table[index] identifies the JAR file that contains k.
+ //
+ // k's protection domain is:
+ //
+ // ProtectionDomain pd = _shared_protection_domains[index];
+ //
+ // and k's Package is initialized using
+ //
+ // manifest = _shared_jar_manifests[index];
+ // url = _shared_jar_urls[index];
+ // define_shared_package(class_name, class_loader, manifest, url, CHECK_(pd));
+ //
+ // Note that if an element of these 3 _shared_xxx arrays is NULL, it will be initialized by
+ // the corresponding SystemDictionaryShared::get_shared_xxx() function.
+ Handle manifest = get_shared_jar_manifest(index, CHECK_(pd));
+ Handle url = get_shared_jar_url(index, CHECK_(pd));
+ define_shared_package(class_name, class_loader, manifest, url, CHECK_(pd));
+ pd = get_shared_protection_domain(class_loader, index, url, CHECK_(pd));
+ }
+ }
+ return pd;
+}
+
+// Currently AppCDS only archives classes from the run-time image, the
+// -Xbootclasspath/a path, and the class path. The following rules need to be
+// revised when AppCDS is changed to archive classes from other code sources
+// in the future, for example the module path (specified by -p).
+//
+// Check if a shared class can be loaded by the specific classloader. Following
+// are the "visible" archived classes for different classloaders.
+//
+// NULL classloader:
+// - see SystemDictionary::is_shared_class_visible()
+// Platform classloader:
+// - Module class from "modules" jimage. ModuleEntry must be defined in the
+// classloader.
+// App Classloader:
+// - Module class from "modules" jimage. ModuleEntry must be defined in the
+// classloader.
+// - Class from -cp. The class must have no PackageEntry defined in any of the
+// boot/platform/app classloader, or must be in the unnamed module defined in the
+// AppClassLoader.
+bool SystemDictionaryShared::is_shared_class_visible_for_classloader(
+ InstanceKlass* ik,
+ Handle class_loader,
+ const char* pkg_string,
+ Symbol* pkg_name,
+ PackageEntry* pkg_entry,
+ ModuleEntry* mod_entry,
+ TRAPS) {
+ assert(class_loader.not_null(), "Class loader should not be NULL");
+ assert(Universe::is_module_initialized(), "Module system is not initialized");
+
+ int path_index = ik->shared_classpath_index();
+ SharedClassPathEntry* ent =
+ (SharedClassPathEntry*)FileMapInfo::shared_classpath(path_index);
+
+ if (SystemDictionary::is_platform_class_loader(class_loader())) {
+ assert(ent != NULL, "shared class for PlatformClassLoader should have valid SharedClassPathEntry");
+ // The PlatformClassLoader can only load archived class originated from the
+ // run-time image. The class' PackageEntry/ModuleEntry must be
+ // defined by the PlatformClassLoader.
+ if (mod_entry != NULL) {
+ // PackageEntry/ModuleEntry is found in the classloader. Check if the
+ // ModuleEntry's location agrees with the archived class' origination.
+ if (ent->is_modules_image() && mod_entry->location()->starts_with("jrt:")) {
+ return true; // Module class from the "modules" jimage
+ }
+ }
+ } else if (SystemDictionary::is_system_class_loader(class_loader())) {
+ assert(ent != NULL, "shared class for system loader should have valid SharedClassPathEntry");
+ if (pkg_string == NULL) {
+ // The archived class is in the unnamed package. Currently, the boot image
+ // does not contain any class in the unnamed package.
+ assert(!ent->is_modules_image(), "Class in the unnamed package must be from the classpath");
+ if (path_index >= ClassLoaderExt::app_paths_start_index()) {
+ return true;
+ }
+ } else {
+ // Check if this is from a PackageEntry/ModuleEntry defined in the AppClassloader.
+ if (pkg_entry == NULL) {
+ // It's not guaranteed that the class is from the classpath if the
+ // PackageEntry cannot be found from the AppClassloader. Need to check
+ // the boot and platform classloader as well.
+ if (get_package_entry(pkg_name, ClassLoaderData::class_loader_data_or_null(SystemDictionary::java_platform_loader())) == NULL &&
+ get_package_entry(pkg_name, ClassLoaderData::the_null_class_loader_data()) == NULL) {
+ // The PackageEntry is not defined in any of the boot/platform/app classloaders.
+ // The archived class must from -cp path and not from the run-time image.
+ if (!ent->is_modules_image() && path_index >= ClassLoaderExt::app_paths_start_index()) {
+ return true;
+ }
+ }
+ } else if (mod_entry != NULL) {
+ // The package/module is defined in the AppClassLoader. Currently we only
+ // support archiving application module class from the run-time image.
+ // Packages from the -cp path are in the unnamed_module.
+ if ((ent->is_modules_image() && mod_entry->location()->starts_with("jrt:")) ||
+ (pkg_entry->in_unnamed_module() && path_index >= ClassLoaderExt::app_paths_start_index())) {
+ DEBUG_ONLY( \
+ ClassLoaderData* loader_data = class_loader_data(class_loader); \
+ if (pkg_entry->in_unnamed_module()) \
+ assert(mod_entry == loader_data->unnamed_module(), "the unnamed module is not defined in the classloader");)
+
+ return true;
+ }
+ }
+ }
+ } else {
+ // TEMP: if a shared class can be found by a custom loader, consider it visible now.
+ // FIXME: is this actually correct?
+ return true;
+ }
+ return false;
+}
+
+// The following stack shows how this code is reached:
+//
+// [0] SystemDictionaryShared::find_or_load_shared_class()
+// [1] JVM_FindLoadedClass
+// [2] java.lang.ClassLoader.findLoadedClass0()
+// [3] java.lang.ClassLoader.findLoadedClass()
+// [4] java.lang.ClassLoader.loadClass()
+// [5] jdk.internal.loader.ClassLoaders$AppClassLoader_klass.loadClass()
+//
+// Because AppCDS supports only the PlatformClassLoader and AppClassLoader, we make the following
+// assumptions (based on the JDK 8.0 source code):
+//
+// [a] these two loaders use the default implementation of
+// ClassLoader.loadClass(String name, boolean resolve), which
+// [b] calls findLoadedClass(name), immediately followed by parent.loadClass(),
+// immediately followed by findClass(name).
+// [c] If the requested class is a shared class of the current class loader, parent.loadClass()
+// always returns null, and
+// [d] if AppCDS is not enabled, the class would be loaded by findClass() by decoding it from a
+// JAR file and then parsed.
+//
+// Given these assumptions, we intercept the findLoadedClass() call to invoke
+// SystemDictionaryShared::find_or_load_shared_class() to load the shared class from
+// the archive. The reasons are:
+//
+// + Because AppCDS is a commercial feature, we want to hide the implementation. There
+// is currently no easy way to hide Java code, so we did it with native code.
+// + Start-up is improved because we avoid decoding the JAR file, and avoid delegating
+// to the parent (since we know the parent will not find this class).
+//
+// NOTE: there's a lot of assumption about the Java code. If any of that change, this
+// needs to be redesigned.
+//
+// An alternative is to modify the Java code of AppClassLoader.loadClass().
+//
+InstanceKlass* SystemDictionaryShared::find_or_load_shared_class(
+ Symbol* name, Handle class_loader, TRAPS) {
+ if (DumpSharedSpaces) {
+ return NULL;
+ }
+
+ InstanceKlass* k = NULL;
+ if (shared_dictionary() != NULL &&
+ UseAppCDS && (SystemDictionary::is_system_class_loader(class_loader()) ||
+ SystemDictionary::is_platform_class_loader(class_loader()))) {
+
+ // Fix for 4474172; see evaluation for more details
+ class_loader = Handle(
+ THREAD, java_lang_ClassLoader::non_reflection_class_loader(class_loader()));
+ ClassLoaderData *loader_data = register_loader(class_loader, CHECK_NULL);
+ Dictionary* dictionary = loader_data->dictionary();
+
+ unsigned int d_hash = dictionary->compute_hash(name);
+
+ bool DoObjectLock = true;
+ if (is_parallelCapable(class_loader)) {
+ DoObjectLock = false;
+ }
+
+ // Make sure we are synchronized on the class loader before we proceed
+ //
+ // Note: currently, find_or_load_shared_class is called only from
+ // JVM_FindLoadedClass and used for PlatformClassLoader and AppClassLoader,
+ // which are parallel-capable loaders, so this lock is NOT taken.
+ Handle lockObject = compute_loader_lock_object(class_loader, THREAD);
+ check_loader_lock_contention(lockObject, THREAD);
+ ObjectLocker ol(lockObject, THREAD, DoObjectLock);
+
+ {
+ MutexLocker mu(SystemDictionary_lock, THREAD);
+ Klass* check = find_class(d_hash, name, dictionary);
+ if (check != NULL) {
+ return InstanceKlass::cast(check);
+ }
+ }
+
+ k = load_shared_class_for_builtin_loader(name, class_loader, THREAD);
+ if (k != NULL) {
+ define_instance_class(k, CHECK_NULL);
+ }
+ }
+
+ return k;
+}
+
+InstanceKlass* SystemDictionaryShared::load_shared_class_for_builtin_loader(
+ Symbol* class_name, Handle class_loader, TRAPS) {
+ assert(UseAppCDS && shared_dictionary() != NULL, "already checked");
+ Klass* k = shared_dictionary()->find_class_for_builtin_loader(class_name);
+
+ if (k != NULL) {
+ InstanceKlass* ik = InstanceKlass::cast(k);
+ if ((ik->is_shared_app_class() &&
+ SystemDictionary::is_system_class_loader(class_loader())) ||
+ (ik->is_shared_platform_class() &&
+ SystemDictionary::is_platform_class_loader(class_loader()))) {
+ Handle protection_domain =
+ SystemDictionaryShared::init_security_info(class_loader, ik, CHECK_NULL);
+ return load_shared_class(ik, class_loader, protection_domain, THREAD);
+ }
+ }
+
+ return NULL;
+}
+
+void SystemDictionaryShared::oops_do(OopClosure* f) {
+ f->do_oop((oop*)&_shared_protection_domains);
+ f->do_oop((oop*)&_shared_jar_urls);
+ f->do_oop((oop*)&_shared_jar_manifests);
+}
+
+void SystemDictionaryShared::allocate_shared_protection_domain_array(int size, TRAPS) {
+ if (_shared_protection_domains == NULL) {
+ _shared_protection_domains = oopFactory::new_objArray(
+ SystemDictionary::ProtectionDomain_klass(), size, CHECK);
+ }
+}
+
+void SystemDictionaryShared::allocate_shared_jar_url_array(int size, TRAPS) {
+ if (_shared_jar_urls == NULL) {
+ _shared_jar_urls = oopFactory::new_objArray(
+ SystemDictionary::URL_klass(), size, CHECK);
+ }
+}
+
+void SystemDictionaryShared::allocate_shared_jar_manifest_array(int size, TRAPS) {
+ if (_shared_jar_manifests == NULL) {
+ _shared_jar_manifests = oopFactory::new_objArray(
+ SystemDictionary::Jar_Manifest_klass(), size, CHECK);
+ }
+}
+
+void SystemDictionaryShared::allocate_shared_data_arrays(int size, TRAPS) {
+ allocate_shared_protection_domain_array(size, CHECK);
+ allocate_shared_jar_url_array(size, CHECK);
+ allocate_shared_jar_manifest_array(size, CHECK);
+}
+
+
+InstanceKlass* SystemDictionaryShared::lookup_from_stream(const Symbol* class_name,
+ Handle class_loader,
+ Handle protection_domain,
+ const ClassFileStream* cfs,
+ TRAPS) {
+ if (!UseAppCDS || shared_dictionary() == NULL) {
+ return NULL;
+ }
+ if (class_name == NULL) { // don't do this for anonymous classes
+ return NULL;
+ }
+ if (class_loader.is_null() ||
+ SystemDictionary::is_system_class_loader(class_loader()) ||
+ SystemDictionary::is_platform_class_loader(class_loader())) {
+ // This function is called for loading only UNREGISTERED classes.
+ // Do nothing for the BUILTIN loaders.
+ return NULL;
+ }
+
+ ClassLoaderData* loader_data = ClassLoaderData::class_loader_data(class_loader());
+ Klass* k;
+
+ { // UNREGISTERED loader
+ if (!shared_dictionary()->class_exists_for_unregistered_loader(class_name)) {
+ // No classes of this name for unregistered loaders.
+ return NULL;
+ }
+
+ int clsfile_size = cfs->length();
+ int clsfile_crc32 = ClassLoader::crc32(0, (const char*)cfs->buffer(), cfs->length());
+
+ k = shared_dictionary()->find_class_for_unregistered_loader(class_name,
+ clsfile_size, clsfile_crc32);
+ }
+
+ if (k == NULL) { // not archived
+ return NULL;
+ }
+
+ return acquire_class_for_current_thread(InstanceKlass::cast(k), class_loader,
+ protection_domain, THREAD);
+}
+
+InstanceKlass* SystemDictionaryShared::acquire_class_for_current_thread(
+ InstanceKlass *ik,
+ Handle class_loader,
+ Handle protection_domain,
+ TRAPS) {
+ ClassLoaderData* loader_data = ClassLoaderData::class_loader_data(class_loader());
+
+ {
+ MutexLocker mu(SharedDictionary_lock, THREAD);
+ if (ik->class_loader_data() != NULL) {
+ // ik is already loaded (by this loader or by a different loader)
+ // or ik is being loaded by a different thread (by this loader or by a different loader)
+ return NULL;
+ }
+
+ // No other thread has acquired this yet, so give it to *this thread*
+ ik->set_class_loader_data(loader_data);
+ }
+
+ // No longer holding SharedDictionary_lock
+ // No need to lock, as <ik> can be held only by a single thread.
+ loader_data->add_class(ik);
+
+ // Load and check super/interfaces, restore unsharable info
+ InstanceKlass* shared_klass = load_shared_class(ik, class_loader, protection_domain, THREAD);
+ if (shared_klass == NULL || HAS_PENDING_EXCEPTION) {
+ // TODO: clean up <ik> so it can be used again
+ return NULL;
+ }
+
+ return shared_klass;
+}
+
+bool SystemDictionaryShared::add_non_builtin_klass(Symbol* name, ClassLoaderData* loader_data,
+ InstanceKlass* k,
+ TRAPS) {
+ assert(DumpSharedSpaces, "only when dumping");
+ assert(UseAppCDS && boot_loader_dictionary() != NULL, "must be");
+
+ if (boot_loader_dictionary()->add_non_builtin_klass(name, loader_data, k)) {
+ MutexLocker mu_r(Compile_lock, THREAD); // not really necessary, but add_to_hierarchy asserts this.
+ add_to_hierarchy(k, CHECK_0);
+ return true;
+ }
+ return false;
+}
+
+// This function is called to resolve the super/interfaces of shared classes for
+// non-built-in loaders. E.g., ChildClass in the below example
+// where "super:" (and optionally "interface:") have been specified.
+//
+// java/lang/Object id: 0
+// Interface id: 2 super: 0 source: cust.jar
+// ChildClass id: 4 super: 0 interfaces: 2 source: cust.jar
+Klass* SystemDictionaryShared::dump_time_resolve_super_or_fail(
+ Symbol* child_name, Symbol* class_name, Handle class_loader,
+ Handle protection_domain, bool is_superclass, TRAPS) {
+
+ assert(DumpSharedSpaces, "only when dumping");
+
+ ClassListParser* parser = ClassListParser::instance();
+ if (parser == NULL) {
+ // We're still loading the well-known classes, before the ClassListParser is created.
+ return NULL;
+ }
+ if (child_name->equals(parser->current_class_name())) {
+ // When this function is called, all the numbered super and interface types
+ // must have already been loaded. Hence this function is never recursively called.
+ if (is_superclass) {
+ return parser->lookup_super_for_current_class(class_name);
+ } else {
+ return parser->lookup_interface_for_current_class(class_name);
+ }
+ } else {
+ // The VM is not trying to resolve a super type of parser->current_class_name().
+ // Instead, it's resolving an error class (because parser->current_class_name() has
+ // failed parsing or verification). Don't do anything here.
+ return NULL;
+ }
+}
+
+struct SharedMiscInfo {
+ Klass* _klass;
+ int _clsfile_size;
+ int _clsfile_crc32;
+};
+
+static GrowableArray<SharedMiscInfo>* misc_info_array = NULL;
+
+void SystemDictionaryShared::set_shared_class_misc_info(Klass* k, ClassFileStream* cfs) {
+ assert(DumpSharedSpaces, "only when dumping");
+ int clsfile_size = cfs->length();
+ int clsfile_crc32 = ClassLoader::crc32(0, (const char*)cfs->buffer(), cfs->length());
+
+ if (misc_info_array == NULL) {
+ misc_info_array = new (ResourceObj::C_HEAP, mtClass) GrowableArray<SharedMiscInfo>(20, /*c heap*/ true);
+ }
+
+ SharedMiscInfo misc_info;
+ DEBUG_ONLY({
+ for (int i=0; i<misc_info_array->length(); i++) {
+ misc_info = misc_info_array->at(i);
+ assert(misc_info._klass != k, "cannot call set_shared_class_misc_info twice for the same class");
+ }
+ });
+
+ misc_info._klass = k;
+ misc_info._clsfile_size = clsfile_size;
+ misc_info._clsfile_crc32 = clsfile_crc32;
+
+ misc_info_array->append(misc_info);
+}
+
+void SystemDictionaryShared::init_shared_dictionary_entry(Klass* k, DictionaryEntry* ent) {
+ SharedDictionaryEntry* entry = (SharedDictionaryEntry*)ent;
+ entry->_id = -1;
+ entry->_clsfile_size = -1;
+ entry->_clsfile_crc32 = -1;
+ entry->_verifier_constraints = NULL;
+ entry->_verifier_constraint_flags = NULL;
+
+ if (misc_info_array != NULL) {
+ for (int i=0; i<misc_info_array->length(); i++) {
+ SharedMiscInfo misc_info = misc_info_array->at(i);
+ if (misc_info._klass == k) {
+ entry->_clsfile_size = misc_info._clsfile_size;
+ entry->_clsfile_crc32 = misc_info._clsfile_crc32;
+ misc_info_array->remove_at(i);
+ return;
+ }
+ }
+ }
+}
+
+bool SystemDictionaryShared::add_verification_constraint(Klass* k, Symbol* name,
+ Symbol* from_name, bool from_field_is_protected, bool from_is_array, bool from_is_object) {
+ assert(DumpSharedSpaces, "called at dump time only");
+
+ // Skip anonymous classes, which are not archived as they are not in
+ // dictionary (see assert_no_anonymoys_classes_in_dictionaries() in
+ // VM_PopulateDumpSharedSpace::doit()).
+ if (k->class_loader_data()->is_anonymous()) {
+ return true; // anonymous classes are not archived, skip
+ }
+
+ SharedDictionaryEntry* entry = ((SharedDictionary*)(k->class_loader_data()->dictionary()))->find_entry_for(k);
+ ResourceMark rm;
+ // Lambda classes are not archived and will be regenerated at runtime.
+ if (entry == NULL && strstr(k->name()->as_C_string(), "Lambda$") != NULL) {
+ return true;
+ }
+ assert(entry != NULL, "class should be in dictionary before being verified");
+ entry->add_verification_constraint(name, from_name, from_field_is_protected,
+ from_is_array, from_is_object);
+ if (entry->is_builtin()) {
+ // For builtin class loaders, we can try to complete the verification check at dump time,
+ // because we can resolve all the constraint classes.
+ return false;
+ } else {
+ // For non-builtin class loaders, we cannot complete the verification check at dump time,
+ // because at dump time we don't know how to resolve classes for such loaders.
+ return true;
+ }
+}
+
+void SystemDictionaryShared::finalize_verification_constraints() {
+ boot_loader_dictionary()->finalize_verification_constraints();
+}
+
+void SystemDictionaryShared::check_verification_constraints(InstanceKlass* klass,
+ TRAPS) {
+ assert(!DumpSharedSpaces && UseSharedSpaces, "called at run time with CDS enabled only");
+ SharedDictionaryEntry* entry = shared_dictionary()->find_entry_for(klass);
+ assert(entry != NULL, "call this only for shared classes");
+ entry->check_verification_constraints(klass, THREAD);
+}
+
+SharedDictionaryEntry* SharedDictionary::find_entry_for(Klass* klass) {
+ Symbol* class_name = klass->name();
+ unsigned int hash = compute_hash(class_name);
+ int index = hash_to_index(hash);
+
+ for (SharedDictionaryEntry* entry = bucket(index);
+ entry != NULL;
+ entry = entry->next()) {
+ if (entry->hash() == hash && entry->literal() == klass) {
+ return entry;
+ }
+ }
+
+ return NULL;
+}
+
+void SharedDictionary::finalize_verification_constraints() {
+ int bytes = 0, count = 0;
+ for (int index = 0; index < table_size(); index++) {
+ for (SharedDictionaryEntry *probe = bucket(index);
+ probe != NULL;
+ probe = probe->next()) {
+ int n = probe->finalize_verification_constraints();
+ if (n > 0) {
+ bytes += n;
+ count ++;
+ }
+ }
+ }
+ if (log_is_enabled(Info, cds, verification)) {
+ double avg = 0;
+ if (count > 0) {
+ avg = double(bytes) / double(count);
+ }
+ log_info(cds, verification)("Recorded verification constraints for %d classes = %d bytes (avg = %.2f bytes) ", count, bytes, avg);
+ }
+}
+
+void SharedDictionaryEntry::add_verification_constraint(Symbol* name,
+ Symbol* from_name, bool from_field_is_protected, bool from_is_array, bool from_is_object) {
+ if (_verifier_constraints == NULL) {
+ _verifier_constraints = new(ResourceObj::C_HEAP, mtClass) GrowableArray<Symbol*>(8, true, mtClass);
+ }
+ if (_verifier_constraint_flags == NULL) {
+ _verifier_constraint_flags = new(ResourceObj::C_HEAP, mtClass) GrowableArray<char>(4, true, mtClass);
+ }
+ GrowableArray<Symbol*>* vc_array = (GrowableArray<Symbol*>*)_verifier_constraints;
+ for (int i=0; i<vc_array->length(); i+= 2) {
+ if (name == vc_array->at(i) &&
+ from_name == vc_array->at(i+1)) {
+ return;
+ }
+ }
+ vc_array->append(name);
+ vc_array->append(from_name);
+
+ GrowableArray<char>* vcflags_array = (GrowableArray<char>*)_verifier_constraint_flags;
+ char c = 0;
+ c |= from_field_is_protected ? FROM_FIELD_IS_PROTECTED : 0;
+ c |= from_is_array ? FROM_IS_ARRAY : 0;
+ c |= from_is_object ? FROM_IS_OBJECT : 0;
+ vcflags_array->append(c);
+
+ if (log_is_enabled(Trace, cds, verification)) {
+ ResourceMark rm;
+ log_trace(cds, verification)("add_verification_constraint: %s: %s must be subclass of %s",
+ instance_klass()->external_name(), from_name->as_klass_external_name(),
+ name->as_klass_external_name());
+ }
+}
+
+int SharedDictionaryEntry::finalize_verification_constraints() {
+ assert(DumpSharedSpaces, "called at dump time only");
+ Thread* THREAD = Thread::current();
+ ClassLoaderData* loader_data = ClassLoaderData::the_null_class_loader_data();
+ GrowableArray<Symbol*>* vc_array = (GrowableArray<Symbol*>*)_verifier_constraints;
+ GrowableArray<char>* vcflags_array = (GrowableArray<char>*)_verifier_constraint_flags;
+
+ if (vc_array != NULL) {
+ if (log_is_enabled(Trace, cds, verification)) {
+ ResourceMark rm;
+ log_trace(cds, verification)("finalize_verification_constraint: %s",
+ literal()->external_name());
+ }
+
+ // Copy the constraints from C_HEAP-alloced GrowableArrays to Metaspace-alloced
+ // Arrays
+ int size = 0;
+ {
+ // FIXME: change this to be done after relocation, so we can use symbol offset??
+ int length = vc_array->length();
+ Array<Symbol*>* out = MetadataFactory::new_array<Symbol*>(loader_data, length, 0, THREAD);
+ assert(out != NULL, "Dump time allocation failure would have aborted VM");
+ for (int i=0; i<length; i++) {
+ out->at_put(i, vc_array->at(i));
+ }
+ _verifier_constraints = out;
+ size += out->size() * BytesPerWord;
+ delete vc_array;
+ }
+ {
+ int length = vcflags_array->length();
+ Array<char>* out = MetadataFactory::new_array<char>(loader_data, length, 0, THREAD);
+ assert(out != NULL, "Dump time allocation failure would have aborted VM");
+ for (int i=0; i<length; i++) {
+ out->at_put(i, vcflags_array->at(i));
+ }
+ _verifier_constraint_flags = out;
+ size += out->size() * BytesPerWord;
+ delete vcflags_array;
+ }
+
+ return size;
+ }
+ return 0;
+}
+
+void SharedDictionaryEntry::check_verification_constraints(InstanceKlass* klass, TRAPS) {
+ Array<Symbol*>* vc_array = (Array<Symbol*>*)_verifier_constraints;
+ Array<char>* vcflags_array = (Array<char>*)_verifier_constraint_flags;
+
+ if (vc_array != NULL) {
+ int length = vc_array->length();
+ for (int i=0; i<length; i+=2) {
+ Symbol* name = vc_array->at(i);
+ Symbol* from_name = vc_array->at(i+1);
+ char c = vcflags_array->at(i/2);
+
+ bool from_field_is_protected = (c & FROM_FIELD_IS_PROTECTED) ? true : false;
+ bool from_is_array = (c & FROM_IS_ARRAY) ? true : false;
+ bool from_is_object = (c & FROM_IS_OBJECT) ? true : false;
+
+ bool ok = VerificationType::resolve_and_check_assignability(klass, name,
+ from_name, from_field_is_protected, from_is_array, from_is_object, CHECK);
+ if (!ok) {
+ ResourceMark rm(THREAD);
+ stringStream ss;
+
+ ss.print_cr("Bad type on operand stack");
+ ss.print_cr("Exception Details:");
+ ss.print_cr(" Location:\n %s", klass->name()->as_C_string());
+ ss.print_cr(" Reason:\n Type '%s' is not assignable to '%s'",
+ from_name->as_quoted_ascii(), name->as_quoted_ascii());
+ THROW_MSG(vmSymbols::java_lang_VerifyError(), ss.as_string());
+ }
+ }
+ }
+}
+
+void SharedDictionaryEntry::metaspace_pointers_do(MetaspaceClosure* it) {
+ it->push((Array<Symbol*>**)&_verifier_constraints);
+ it->push((Array<char>**)&_verifier_constraint_flags);
+}
+
+bool SharedDictionary::add_non_builtin_klass(const Symbol* class_name,
+ ClassLoaderData* loader_data,
+ InstanceKlass* klass) {
+
+ assert(DumpSharedSpaces, "supported only when dumping");
+ assert(klass != NULL, "adding NULL klass");
+ assert(klass->name() == class_name, "sanity check on name");
+ assert(klass->shared_classpath_index() < 0,
+ "the shared classpath index should not be set for shared class loaded by the custom loaders");
+
+ // Add an entry for a non-builtin class.
+ // For a shared class for custom class loaders, SystemDictionary::resolve_or_null will
+ // not find this class, because is_builtin() is false.
+ unsigned int hash = compute_hash(class_name);
+ int index = hash_to_index(hash);
+
+ for (SharedDictionaryEntry* entry = bucket(index);
+ entry != NULL;
+ entry = entry->next()) {
+ if (entry->hash() == hash) {
+ Klass* klass = (Klass*)entry->literal();
+ if (klass->name() == class_name && klass->class_loader_data() == loader_data) {
+ // There is already a class defined with the same name
+ return false;
+ }
+ }
+ }
+
+ assert(Dictionary::entry_size() >= sizeof(SharedDictionaryEntry), "must be big enough");
+ SharedDictionaryEntry* entry = (SharedDictionaryEntry*)new_entry(hash, klass);
+ add_entry(index, entry);
+
+ assert(entry->is_unregistered(), "sanity");
+ assert(!entry->is_builtin(), "sanity");
+ return true;
+}
+
+
+//-----------------
+// SharedDictionary
+//-----------------
+
+
+Klass* SharedDictionary::find_class_for_builtin_loader(const Symbol* name) const {
+ SharedDictionaryEntry* entry = get_entry_for_builtin_loader(name);
+ return entry != NULL ? entry->instance_klass() : (Klass*)NULL;
+}
+
+Klass* SharedDictionary::find_class_for_unregistered_loader(const Symbol* name,
+ int clsfile_size,
+ int clsfile_crc32) const {
+
+ const SharedDictionaryEntry* entry = get_entry_for_unregistered_loader(name,
+ clsfile_size,
+ clsfile_crc32);
+ return entry != NULL ? entry->instance_klass() : (Klass*)NULL;
+}
+
+void SharedDictionary::update_entry(Klass* klass, int id) {
+ assert(DumpSharedSpaces, "supported only when dumping");
+ Symbol* class_name = klass->name();
+ unsigned int hash = compute_hash(class_name);
+ int index = hash_to_index(hash);
+
+ for (SharedDictionaryEntry* entry = bucket(index);
+ entry != NULL;
+ entry = entry->next()) {
+ if (entry->hash() == hash && entry->literal() == klass) {
+ entry->_id = id;
+ return;
+ }
+ }
+
+ ShouldNotReachHere();
+}
+
+SharedDictionaryEntry* SharedDictionary::get_entry_for_builtin_loader(const Symbol* class_name) const {
+ assert(!DumpSharedSpaces, "supported only when at runtime");
+ unsigned int hash = compute_hash(class_name);
+ const int index = hash_to_index(hash);
+
+ for (SharedDictionaryEntry* entry = bucket(index);
+ entry != NULL;
+ entry = entry->next()) {
+ if (entry->hash() == hash && entry->equals(class_name)) {
+ if (entry->is_builtin()) {
+ return entry;
+ }
+ }
+ }
+ return NULL;
+}
+
+SharedDictionaryEntry* SharedDictionary::get_entry_for_unregistered_loader(const Symbol* class_name,
+ int clsfile_size,
+ int clsfile_crc32) const {
+ assert(!DumpSharedSpaces, "supported only when at runtime");
+ unsigned int hash = compute_hash(class_name);
+ int index = hash_to_index(hash);
+
+ for (SharedDictionaryEntry* entry = bucket(index);
+ entry != NULL;
+ entry = entry->next()) {
+ if (entry->hash() == hash && entry->equals(class_name)) {
+ if (entry->is_unregistered()) {
+ if (clsfile_size == -1) {
+ // We're called from class_exists_for_unregistered_loader. At run time, we want to
+ // compute the CRC of a ClassFileStream only if there is an UNREGISTERED class
+ // with the matching name.
+ return entry;
+ } else {
+ // We're called from find_class_for_unregistered_loader
+ if (entry->_clsfile_size && clsfile_crc32 == entry->_clsfile_crc32) {
+ return entry;
+ }
+ }
+
+ // There can be only 1 class with this name for unregistered loaders.
+ return NULL;
+ }
+ }
+ }
+ return NULL;
+}
--- a/src/hotspot/share/classfile/systemDictionaryShared.hpp Mon Nov 27 20:35:56 2017 -0500
+++ b/src/hotspot/share/classfile/systemDictionaryShared.hpp Mon Nov 27 20:21:34 2017 -0800
@@ -25,75 +25,362 @@
#ifndef SHARE_VM_CLASSFILE_SYSTEMDICTIONARYSHARED_HPP
#define SHARE_VM_CLASSFILE_SYSTEMDICTIONARYSHARED_HPP
+#include "oops/klass.hpp"
+#include "classfile/dictionary.hpp"
#include "classfile/systemDictionary.hpp"
-#include "classfile/dictionary.hpp"
+#include "memory/filemap.hpp"
+
+
+/*===============================================================================
+
+ Handling of the classes in the AppCDS archive
+
+ To ensure safety and to simplify the implementation, archived classes are
+ "segregated" into several types. The following rules describe how they
+ are stored and looked up.
+
+[1] Category of archived classes
+
+ There are 3 disjoint groups of classes stored in the AppCDS archive. They are
+ categorized as by their SharedDictionaryEntry::loader_type()
+
+ BUILTIN: These classes may be defined ONLY by the BOOT/PLATFORM/APP
+ loaders.
+
+ UNREGISTERED: These classes may be defined ONLY by a ClassLoader
+ instance that's not listed above (using fingerprint matching)
+
+[2] How classes from different categories are specified in the classlist:
+
+ Starting from JDK9, each class in the classlist may be specified with
+ these keywords: "id", "super", "interfaces", "loader" and "source".
+
+
+ BUILTIN Only the "id" keyword may be (optionally) specified. All other
+ keywords are forbidden.
+
+ The named class is looked up from the jimage and from
+ Xbootclasspath/a and CLASSPATH.
+
+ UNREGISTERED: The "id", "super", and "source" keywords must all be
+ specified.
+
+ The "interfaces" keyword must be specified if the class implements
+ one or more local interfaces. The "interfaces" keyword must not be
+ specified if the class does not implement local interfaces.
+
+ The named class is looked up from the location specified in the
+ "source" keyword.
+
+ Example classlist:
+
+ # BUILTIN
+ java/lang/Object id: 0
+ java/lang/Cloneable id: 1
+ java/lang/String
+
+ # UNREGISTERED
+ Bar id: 3 super: 0 interfaces: 1 source: /foo.jar
+
+
+[3] Identifying the loader_type of archived classes in the shared dictionary
+
+ Each archived Klass* C is associated with a SharedDictionaryEntry* E
+
+ BUILTIN: (C->shared_classpath_index() >= 0)
+ UNREGISTERED: (C->shared_classpath_index() < 0)
+
+[4] Lookup of archived classes at run time:
+
+ (a) BUILTIN loaders:
+
+ Search the shared directory for a BUILTIN class with a matching name.
+
+ (b) UNREGISTERED loaders:
+
+ The search originates with SystemDictionaryShared::lookup_from_stream().
+
+ Search the shared directory for a UNREGISTERED class with a matching
+ (name, clsfile_len, clsfile_crc32) tuple.
+
+===============================================================================*/
+#define UNREGISTERED_INDEX -9999
class ClassFileStream;
-class SystemDictionaryShared: public SystemDictionary {
+// Archived classes need extra information not needed by traditionally loaded classes.
+// To keep footprint small, we add these in the dictionary entry instead of the InstanceKlass.
+class SharedDictionaryEntry : public DictionaryEntry {
+
+public:
+ enum LoaderType {
+ LT_BUILTIN,
+ LT_UNREGISTERED
+ };
+
+ enum {
+ FROM_FIELD_IS_PROTECTED = 1 << 0,
+ FROM_IS_ARRAY = 1 << 1,
+ FROM_IS_OBJECT = 1 << 2
+ };
+
+ int _id;
+ int _clsfile_size;
+ int _clsfile_crc32;
+ void* _verifier_constraints; // FIXME - use a union here to avoid type casting??
+ void* _verifier_constraint_flags;
+
+ // See "Identifying the loader_type of archived classes" comments above.
+ LoaderType loader_type() const {
+ Klass* k = (Klass*)literal();
+
+ if ((k->shared_classpath_index() != UNREGISTERED_INDEX)) {
+ return LT_BUILTIN;
+ } else {
+ return LT_UNREGISTERED;
+ }
+ }
+
+ SharedDictionaryEntry* next() {
+ return (SharedDictionaryEntry*)(DictionaryEntry::next());
+ }
+
+ bool is_builtin() const {
+ return loader_type() == LT_BUILTIN;
+ }
+ bool is_unregistered() const {
+ return loader_type() == LT_UNREGISTERED;
+ }
+
+ void add_verification_constraint(Symbol* name,
+ Symbol* from_name, bool from_field_is_protected, bool from_is_array, bool from_is_object);
+ int finalize_verification_constraints();
+ void check_verification_constraints(InstanceKlass* klass, TRAPS);
+ void metaspace_pointers_do(MetaspaceClosure* it) NOT_CDS_RETURN;
+};
+
+class SharedDictionary : public Dictionary {
+ SharedDictionaryEntry* get_entry_for_builtin_loader(const Symbol* name) const;
+ SharedDictionaryEntry* get_entry_for_unregistered_loader(const Symbol* name,
+ int clsfile_size,
+ int clsfile_crc32) const;
+
+ // Convenience functions
+ SharedDictionaryEntry* bucket(int index) const {
+ return (SharedDictionaryEntry*)(Dictionary::bucket(index));
+ }
+
public:
- static void initialize(TRAPS) {}
+ SharedDictionaryEntry* find_entry_for(Klass* klass);
+ void finalize_verification_constraints();
+
+ bool add_non_builtin_klass(const Symbol* class_name,
+ ClassLoaderData* loader_data,
+ InstanceKlass* obj);
+
+ void update_entry(Klass* klass, int id);
+
+ Klass* find_class_for_builtin_loader(const Symbol* name) const;
+ Klass* find_class_for_unregistered_loader(const Symbol* name,
+ int clsfile_size,
+ int clsfile_crc32) const;
+ bool class_exists_for_unregistered_loader(const Symbol* name) {
+ return (get_entry_for_unregistered_loader(name, -1, -1) != NULL);
+ }
+};
+
+class SystemDictionaryShared: public SystemDictionary {
+private:
+ // These _shared_xxxs arrays are used to initialize the java.lang.Package and
+ // java.security.ProtectionDomain objects associated with each shared class.
+ //
+ // See SystemDictionaryShared::init_security_info for more info.
+ static objArrayOop _shared_protection_domains;
+ static objArrayOop _shared_jar_urls;
+ static objArrayOop _shared_jar_manifests;
+
+ static InstanceKlass* load_shared_class_for_builtin_loader(
+ Symbol* class_name,
+ Handle class_loader,
+ TRAPS);
+ static Handle get_package_name(Symbol* class_name, TRAPS);
+
+
+ // Package handling:
+ //
+ // 1. For named modules in the runtime image
+ // BOOT classes: Reuses the existing JVM_GetSystemPackage(s) interfaces
+ // to get packages in named modules for shared classes.
+ // Package for non-shared classes in named module is also
+ // handled using JVM_GetSystemPackage(s).
+ //
+ // APP classes: VM calls ClassLoaders.AppClassLoader::definePackage(String, Module)
+ // to define package for shared app classes from named
+ // modules.
+ //
+ // PLATFORM classes: VM calls ClassLoaders.PlatformClassLoader::definePackage(String, Module)
+ // to define package for shared platform classes from named
+ // modules.
+ //
+ // 2. For unnamed modules
+ // BOOT classes: Reuses the existing JVM_GetSystemPackage(s) interfaces to
+ // get packages for shared boot classes in unnamed modules.
+ //
+ // APP classes: VM calls ClassLoaders.AppClassLoader::defineOrCheckPackage()
+ // with with the manifest and url from archived data.
+ //
+ // PLATFORM classes: No package is defined.
+ //
+ // The following two define_shared_package() functions are used to define
+ // package for shared APP and PLATFORM classes.
+ static void define_shared_package(Symbol* class_name,
+ Handle class_loader,
+ Handle manifest,
+ Handle url,
+ TRAPS);
+ static void define_shared_package(Symbol* class_name,
+ Handle class_loader,
+ ModuleEntry* mod_entry,
+ TRAPS);
+
+ static Handle get_shared_jar_manifest(int shared_path_index, TRAPS);
+ static Handle get_shared_jar_url(int shared_path_index, TRAPS);
+ static Handle get_protection_domain_from_classloader(Handle class_loader,
+ Handle url, TRAPS);
+ static Handle get_shared_protection_domain(Handle class_loader,
+ int shared_path_index,
+ Handle url,
+ TRAPS);
+ static Handle get_shared_protection_domain(Handle class_loader,
+ ModuleEntry* mod, TRAPS);
+ static Handle init_security_info(Handle class_loader, InstanceKlass* ik, TRAPS);
+
+ static void atomic_set_array_index(objArrayOop array, int index, oop o) {
+ // Benign race condition: array.obj_at(index) may already be filled in.
+ // The important thing here is that all threads pick up the same result.
+ // It doesn't matter which racing thread wins, as long as only one
+ // result is used by all threads, and all future queries.
+ array->atomic_compare_exchange_oop(index, o, NULL);
+ }
+
+ static oop shared_protection_domain(int index);
+ static void atomic_set_shared_protection_domain(int index, oop pd) {
+ atomic_set_array_index(_shared_protection_domains, index, pd);
+ }
+ static void allocate_shared_protection_domain_array(int size, TRAPS);
+ static oop shared_jar_url(int index);
+ static void atomic_set_shared_jar_url(int index, oop url) {
+ atomic_set_array_index(_shared_jar_urls, index, url);
+ }
+ static void allocate_shared_jar_url_array(int size, TRAPS);
+ static oop shared_jar_manifest(int index);
+ static void atomic_set_shared_jar_manifest(int index, oop man) {
+ atomic_set_array_index(_shared_jar_manifests, index, man);
+ }
+ static void allocate_shared_jar_manifest_array(int size, TRAPS);
+ static InstanceKlass* acquire_class_for_current_thread(
+ InstanceKlass *ik,
+ Handle class_loader,
+ Handle protection_domain,
+ TRAPS);
+
+public:
+ static void initialize(TRAPS);
+
+ // Called by PLATFORM/APP loader only
static InstanceKlass* find_or_load_shared_class(Symbol* class_name,
- Handle class_loader,
- TRAPS) {
- return NULL;
+ Handle class_loader,
+ TRAPS);
+
+
+ static void allocate_shared_data_arrays(int size, TRAPS);
+ static void oops_do(OopClosure* f);
+ static void roots_oops_do(OopClosure* f) {
+ oops_do(f);
}
- static void roots_oops_do(OopClosure* blk) {}
- static void oops_do(OopClosure* f) {}
+
+ // Check if sharing is supported for the class loader.
static bool is_sharing_possible(ClassLoaderData* loader_data) {
oop class_loader = loader_data->class_loader();
- return (class_loader == NULL);
+ return (class_loader == NULL ||
+ (UseAppCDS && (SystemDictionary::is_system_class_loader(class_loader) ||
+ SystemDictionary::is_platform_class_loader(class_loader)))
+ );
}
- static bool is_shared_class_visible_for_classloader(
- InstanceKlass* ik,
- Handle class_loader,
- const char* pkg_string,
- Symbol* pkg_name,
- PackageEntry* pkg_entry,
- ModuleEntry* mod_entry,
- TRAPS) {
- return false;
+ static bool is_shared_class_visible_for_classloader(InstanceKlass* ik,
+ Handle class_loader,
+ const char* pkg_string,
+ Symbol* pkg_name,
+ PackageEntry* pkg_entry,
+ ModuleEntry* mod_entry,
+ TRAPS);
+ static PackageEntry* get_package_entry(Symbol* pkg,
+ ClassLoaderData *loader_data) {
+ if (loader_data != NULL) {
+ PackageEntryTable* pkgEntryTable = loader_data->packages();
+ return pkgEntryTable->lookup_only(pkg);
+ }
+ return NULL;
}
+ static bool add_non_builtin_klass(Symbol* class_name, ClassLoaderData* loader_data,
+ InstanceKlass* k, TRAPS);
static Klass* dump_time_resolve_super_or_fail(Symbol* child_name,
Symbol* class_name,
Handle class_loader,
Handle protection_domain,
bool is_superclass,
- TRAPS) {
- return NULL;
- }
+ TRAPS);
static size_t dictionary_entry_size() {
- return sizeof(DictionaryEntry);
+ return (DumpSharedSpaces) ? sizeof(SharedDictionaryEntry) : sizeof(DictionaryEntry);
+ }
+ static void init_shared_dictionary_entry(Klass* k, DictionaryEntry* entry) NOT_CDS_RETURN;
+ static bool is_builtin(DictionaryEntry* ent) {
+ // Can't use virtual function is_builtin because DictionaryEntry doesn't initialize
+ // vtable because it's not constructed properly.
+ SharedDictionaryEntry* entry = (SharedDictionaryEntry*)ent;
+ return entry->is_builtin();
}
- static void init_shared_dictionary_entry(Klass* k, DictionaryEntry* entry) {}
- static bool is_builtin(DictionaryEntry* entry) { return true; }
+ // For convenient access to the SharedDictionaryEntry's of the archived classes.
+ static SharedDictionary* shared_dictionary() {
+ assert(!DumpSharedSpaces, "not for dumping");
+ return (SharedDictionary*)SystemDictionary::shared_dictionary();
+ }
+
+ static SharedDictionary* boot_loader_dictionary() {
+ return (SharedDictionary*)ClassLoaderData::the_null_class_loader_data()->dictionary();
+ }
- static InstanceKlass* lookup_from_stream(Symbol* class_name,
+ static void update_shared_entry(Klass* klass, int id) {
+ assert(DumpSharedSpaces, "sanity");
+ assert((SharedDictionary*)(klass->class_loader_data()->dictionary()) != NULL, "sanity");
+ ((SharedDictionary*)(klass->class_loader_data()->dictionary()))->update_entry(klass, id);
+ }
+
+ static void set_shared_class_misc_info(Klass* k, ClassFileStream* cfs);
+
+ static InstanceKlass* lookup_from_stream(const Symbol* class_name,
Handle class_loader,
Handle protection_domain,
const ClassFileStream* st,
- TRAPS) {
- return NULL;
- }
-
- // The (non-application) CDS implementation supports only classes in the boot
- // class loader, which ensures that the verification constraints are the same
- // during archive creation time and runtime. Thus we can do the constraint checks
- // entirely during archive creation time.
+ TRAPS);
+ // "verification_constraints" are a set of checks performed by
+ // VerificationType::is_reference_assignable_from when verifying a shared class during
+ // dump time.
+ //
+ // With AppCDS, it is possible to override archived classes by calling
+ // ClassLoader.defineClass() directly. SystemDictionary::load_shared_class() already
+ // ensures that you cannot load a shared class if its super type(s) are changed. However,
+ // we need an additional check to ensure that the verification_constraints did not change
+ // between dump time and runtime.
static bool add_verification_constraint(Klass* k, Symbol* name,
Symbol* from_name, bool from_field_is_protected,
- bool from_is_array, bool from_is_object) {return false;}
- static void finalize_verification_constraints() {}
+ bool from_is_array, bool from_is_object) NOT_CDS_RETURN_(false);
+ static void finalize_verification_constraints() NOT_CDS_RETURN;
static void check_verification_constraints(InstanceKlass* klass,
- TRAPS) {}
-};
-
-class SharedDictionaryEntry : public DictionaryEntry {
-public:
- void metaspace_pointers_do(MetaspaceClosure* it) {}
+ TRAPS) NOT_CDS_RETURN;
};
#endif // SHARE_VM_CLASSFILE_SYSTEMDICTIONARYSHARED_HPP
--- a/src/hotspot/share/classfile/systemDictionary_ext.hpp Mon Nov 27 20:35:56 2017 -0500
+++ b/src/hotspot/share/classfile/systemDictionary_ext.hpp Mon Nov 27 20:21:34 2017 -0800
@@ -1,5 +1,5 @@
/*
- * Copyright (c) 2015, Oracle and/or its affiliates. All rights reserved.
+ * Copyright (c) 2015, 2017 Oracle and/or its affiliates. All rights reserved.
* DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
*
* This code is free software; you can redistribute it and/or modify it
@@ -25,6 +25,17 @@
#ifndef SHARE_VM_CLASSFILE_SYSTEMDICTIONARY_EXT_HPP
#define SHARE_VM_CLASSFILE_SYSTEMDICTIONARY_EXT_HPP
+#if INCLUDE_CDS
+
+#define WK_KLASSES_DO_EXT(do_klass) \
+ /* well-known classes */ \
+ do_klass(jdk_internal_loader_ClassLoaders_klass, jdk_internal_loader_ClassLoaders, Pre ) \
+ /*end*/
+
+#else
+
#define WK_KLASSES_DO_EXT(do_klass)
+#endif // INCLUDE_CDS
+
#endif // SHARE_VM_CLASSFILE_SYSTEMDICTIONARY_EXT_HPP
--- a/src/hotspot/share/classfile/vmSymbols.hpp Mon Nov 27 20:35:56 2017 -0500
+++ b/src/hotspot/share/classfile/vmSymbols.hpp Mon Nov 27 20:21:34 2017 -0800
@@ -26,7 +26,6 @@
#define SHARE_VM_CLASSFILE_VMSYMBOLS_HPP
#include "classfile/moduleEntry.hpp"
-#include "classfile/vmSymbols_ext.hpp"
#include "oops/symbol.hpp"
#include "memory/iterator.hpp"
#include "trace/traceMacros.hpp"
@@ -673,8 +672,12 @@
/* trace signatures */ \
TRACE_TEMPLATES(template) \
\
- /* extensions */ \
- VM_SYMBOLS_DO_EXT(template, do_alias) \
+ /* cds */ \
+ template(jdk_internal_loader_ClassLoaders, "jdk/internal/loader/ClassLoaders") \
+ template(jdk_vm_cds_SharedClassInfo, "jdk/vm/cds/SharedClassInfo") \
+ template(url_void_signature, "(Ljava/net/URL;)V") \
+ template(toFileURL_name, "toFileURL") \
+ template(toFileURL_signature, "(Ljava/lang/String;)Ljava/net/URL;") \
\
/*end*/
--- a/src/hotspot/share/classfile/vmSymbols_ext.hpp Mon Nov 27 20:35:56 2017 -0500
+++ /dev/null Thu Jan 01 00:00:00 1970 +0000
@@ -1,31 +0,0 @@
-/*
- * Copyright (c) 2015, Oracle and/or its affiliates. All rights reserved.
- * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
- *
- * This code is free software; you can redistribute it and/or modify it
- * under the terms of the GNU General Public License version 2 only, as
- * published by the Free Software Foundation.
- *
- * This code is distributed in the hope that it will be useful, but WITHOUT
- * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
- * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
- * version 2 for more details (a copy is included in the LICENSE file that
- * accompanied this code).
- *
- * You should have received a copy of the GNU General Public License version
- * 2 along with this work; if not, write to the Free Software Foundation,
- * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
- *
- * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
- * or visit www.oracle.com if you need additional information or have any
- * questions.
- *
- */
-
-#ifndef SHARE_VM_CLASSFILE_VMSYMBOLS_EXT_HPP
-#define SHARE_VM_CLASSFILE_VMSYMBOLS_EXT_HPP
-
-#define VM_SYMBOLS_DO_EXT(template, do_alias)
-
-#endif // SHARE_VM_CLASSFILE_VMSYMBOLS_EXT_HPP
-
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/src/hotspot/share/prims/cdsoffsets.cpp Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,69 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+#include "precompiled.hpp"
+#include "utilities/macros.hpp"
+#if INCLUDE_CDS
+#include "runtime/os.hpp"
+#include "memory/filemap.hpp"
+#include "memory/allocation.hpp"
+#include "memory/allocation.inline.hpp"
+#include "prims/cdsoffsets.hpp"
+
+CDSOffsets* CDSOffsets::_all = NULL;
+#define ADD_NEXT(list, name, value) \
+ list->add_end(new CDSOffsets(name, value, NULL))
+
+#define CREATE_OFFSET_MAPS \
+ _all = new CDSOffsets("size_t_size", sizeof(size_t), NULL); \
+ ADD_NEXT(_all, "FileMapHeader::_magic", offset_of(FileMapInfo::FileMapHeader, _magic)); \
+ ADD_NEXT(_all, "FileMapHeader::_crc", offset_of(FileMapInfo::FileMapHeader, _crc)); \
+ ADD_NEXT(_all, "FileMapHeader::_version", offset_of(FileMapInfo::FileMapHeader, _version)); \
+ ADD_NEXT(_all, "FileMapHeader::_space[0]", offset_of(FileMapInfo::FileMapHeader, _space)); \
+ ADD_NEXT(_all, "space_info::_crc", offset_of(FileMapInfo::FileMapHeader::space_info, _crc)); \
+ ADD_NEXT(_all, "space_info::_used", offset_of(FileMapInfo::FileMapHeader::space_info, _used)); \
+ ADD_NEXT(_all, "FileMapHeader::_paths_misc_info_size", offset_of(FileMapInfo::FileMapHeader, _paths_misc_info_size)); \
+ ADD_NEXT(_all, "file_header_size", sizeof(FileMapInfo::FileMapHeader)); \
+ ADD_NEXT(_all, "space_info_size", sizeof(FileMapInfo::FileMapHeader::space_info));
+
+int CDSOffsets::find_offset(const char* name) {
+ if (_all == NULL) {
+ CREATE_OFFSET_MAPS
+ }
+ CDSOffsets* it = _all;
+ while(it) {
+ if (!strcmp(name, it->get_name())) {
+ return it->get_offset();
+ }
+ it = it->next();
+ }
+ return -1; // not found
+}
+
+void CDSOffsets::add_end(CDSOffsets* n) {
+ CDSOffsets* p = this;
+ while(p && p->_next) { p = p->_next; }
+ p->_next = n;
+}
+#endif // INCLUDE_CDS
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/src/hotspot/share/prims/cdsoffsets.hpp Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,48 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+#ifndef SHARE_PRIMS_CDSOFFSETS_HPP
+#define SHARE_PRIMS_CDSOFFSETS_HPP
+class CDSOffsets: public CHeapObj<mtInternal> {
+ private:
+ char* _name;
+ int _offset;
+ CDSOffsets* _next;
+ static CDSOffsets* _all; // sole list for cds
+ public:
+ CDSOffsets(const char* name, int offset, CDSOffsets* next) {
+ _name = NEW_C_HEAP_ARRAY(char, strlen(name) + 1, mtInternal);
+ strcpy(_name, name);
+ _offset = offset;
+ _next = next;
+ }
+
+ char* get_name() const { return _name; }
+ int get_offset() const { return _offset; }
+ CDSOffsets* next() const { return _next; }
+ void add_end(CDSOffsets* n);
+
+ static int find_offset(const char* name);
+};
+#endif // SHARE_PRIMS_CDSOFFSETS_HPP
--- a/src/hotspot/share/prims/whitebox.cpp Mon Nov 27 20:35:56 2017 -0500
+++ b/src/hotspot/share/prims/whitebox.cpp Mon Nov 27 20:21:34 2017 -0800
@@ -61,6 +61,9 @@
#include "utilities/debug.hpp"
#include "utilities/exceptions.hpp"
#include "utilities/macros.hpp"
+#if INCLUDE_CDS
+#include "prims/cdsoffsets.hpp"
+#endif // INCLUDE_CDS
#if INCLUDE_ALL_GCS
#include "gc/g1/concurrentMarkThread.hpp"
#include "gc/g1/g1CollectedHeap.inline.hpp"
@@ -1730,6 +1733,18 @@
#endif
WB_END
+
+#if INCLUDE_CDS
+
+WB_ENTRY(jint, WB_GetOffsetForName(JNIEnv* env, jobject o, jstring name))
+ ResourceMark rm;
+ char* c_name = java_lang_String::as_utf8_string(JNIHandles::resolve_non_null(name));
+ int result = CDSOffsets::find_offset(c_name);
+ return (jint)result;
+WB_END
+
+#endif // INCLUDE_CDS
+
WB_ENTRY(jint, WB_HandshakeWalkStack(JNIEnv* env, jobject wb, jobject thread_handle, jboolean all_threads))
class TraceSelfClosure : public ThreadClosure {
jint _num_threads_completed;
@@ -1918,6 +1933,9 @@
{CC"runMemoryUnitTests", CC"()V", (void*)&WB_RunMemoryUnitTests},
{CC"readFromNoaccessArea",CC"()V", (void*)&WB_ReadFromNoaccessArea},
{CC"stressVirtualSpaceResize",CC"(JJJ)I", (void*)&WB_StressVirtualSpaceResize},
+#if INCLUDE_CDS
+ {CC"getOffsetForName0", CC"(Ljava/lang/String;)I", (void*)&WB_GetOffsetForName},
+#endif
#if INCLUDE_ALL_GCS
{CC"g1InConcurrentMark", CC"()Z", (void*)&WB_G1InConcurrentMark},
{CC"g1IsHumongous0", CC"(Ljava/lang/Object;)Z", (void*)&WB_G1IsHumongous },
--- a/src/hotspot/share/runtime/arguments.cpp Mon Nov 27 20:35:56 2017 -0500
+++ b/src/hotspot/share/runtime/arguments.cpp Mon Nov 27 20:21:34 2017 -0800
@@ -3880,6 +3880,14 @@
vm_exit(0);
}
#endif
+
+ if (match_option(option, "-XX:+UseAppCDS")) {
+ Flag* flag = Flag::find_flag("SharedArchiveFile", 17, true, true);
+ if (flag->is_diagnostic()) {
+ flag->clear_diagnostic();
+ }
+ continue;
+ }
}
return JNI_OK;
}
--- a/src/hotspot/share/runtime/arguments_ext.hpp Mon Nov 27 20:35:56 2017 -0500
+++ b/src/hotspot/share/runtime/arguments_ext.hpp Mon Nov 27 20:21:34 2017 -0800
@@ -36,7 +36,6 @@
// Otherwise returns false.
static inline bool process_options(const JavaVMOption *option) { return false; }
static inline void report_unsupported_options() { }
- static inline bool using_AppCDS() { return false; }
};
void ArgumentsExt::set_gc_specific_flags() {
--- a/src/hotspot/share/runtime/globals.hpp Mon Nov 27 20:35:56 2017 -0500
+++ b/src/hotspot/share/runtime/globals.hpp Mon Nov 27 20:21:34 2017 -0800
@@ -3932,6 +3932,13 @@
"Address to allocate shared memory region for class data") \
range(0, SIZE_MAX) \
\
+ product(bool, UseAppCDS, false, \
+ "Enable Application Class Data Sharing when using shared spaces") \
+ writeable(CommandLineOnly) \
+ \
+ product(ccstr, SharedArchiveConfigFile, NULL, \
+ "Data to add to the CDS archive file") \
+ \
product(uintx, SharedSymbolTableBucketSize, 4, \
"Average number of symbols per bucket in shared table") \
range(2, 246) \
--- a/test/hotspot/jtreg/TEST.groups Mon Nov 27 20:35:56 2017 -0500
+++ b/test/hotspot/jtreg/TEST.groups Mon Nov 27 20:21:34 2017 -0800
@@ -189,12 +189,27 @@
-runtime/Unsafe/RangeCheck.java \
-runtime/containers/ \
sanity/ \
- testlibrary_tests/TestMutuallyExclusivePlatformPredicates.java
+ testlibrary_tests/TestMutuallyExclusivePlatformPredicates.java \
+ -:hotspot_tier1_runtime_appcds_exclude
hotspot_cds = \
runtime/SharedArchiveFile/ \
runtime/CompressedOops/
+# AppCDS
+# If modifying AppCDS it is also recommended to run the open hotspot_cds group
+hotspot_appcds = \
+ runtime/appcds/
+
+# A subset of AppCDS tests to be run in JPRT push
+hotspot_tier1_runtime_appcds = \
+ runtime/appcds/HelloTest.java \
+ runtime/appcds/sharedStrings/SharedStringsBasic.java \
+ runtime/appcds/ClassLoaderTest.java
+
+hotspot_tier1_runtime_appcds_exclude = \
+ runtime/appcds/ \
+ -:hotspot_tier1_runtime_appcds
hotspot_tier1_serviceability = \
serviceability/dcmd/compiler \
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/AppCDSOptions.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,45 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+import jdk.test.lib.cds.CDSOptions;
+
+// This class represents options used for
+// during creation of the archive and/or running JVM with archive
+
+public class AppCDSOptions extends CDSOptions {
+ public String appJar;
+
+ // Application classes to be archived
+ public String[] appClasses;
+
+ public AppCDSOptions setAppJar(String appJar) {
+ this.appJar = appJar;
+ return this;
+ }
+
+ public AppCDSOptions setAppClasses(String[] appClasses) {
+ this.appClasses = appClasses;
+ return this;
+ }
+
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/AppendClasspath.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,87 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary At run time, it is OK to append new elements to the classpath that was used at dump time.
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java
+ * @compile test-classes/HelloMore.java
+ * @run main AppendClasspath
+ */
+
+import java.io.File;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class AppendClasspath {
+
+ public static void main(String[] args) throws Exception {
+ String appJar = JarBuilder.getOrCreateHelloJar();
+ String appJar2 = JarBuilder.build("AppendClasspath_HelloMore", "HelloMore");
+
+ // Dump an archive with a specified JAR file in -classpath
+ TestCommon.testDump(appJar, TestCommon.list("Hello"));
+
+ // PASS: 1) runtime with classpath containing the one used in dump time
+ OutputAnalyzer output = TestCommon.execCommon(
+ "-cp", appJar + File.pathSeparator + appJar2,
+ "HelloMore");
+ TestCommon.checkExec(output);
+
+ final String errorMessage1 = "Unable to use shared archive";
+ final String errorMessage2 = "shared class paths mismatch";
+ // FAIL: 2) runtime with classpath different from the one used in dump time
+ // (runtime has an extra jar file prepended to the class path)
+ output = TestCommon.execCommon(
+ "-cp", appJar2 + File.pathSeparator + appJar,
+ "HelloMore");
+ output.shouldContain(errorMessage1);
+ output.shouldContain(errorMessage2);
+ output.shouldHaveExitValue(1);
+
+ // FAIL: 3) runtime with classpath part of the one used in dump time
+ TestCommon.testDump(appJar + File.pathSeparator + appJar2,
+ TestCommon.list("Hello"));
+ output = TestCommon.execCommon(
+ "-cp", appJar2,
+ "Hello");
+ output.shouldContain(errorMessage1);
+ output.shouldContain(errorMessage2);
+ output.shouldHaveExitValue(1);
+
+ // FAIL: 4) runtime with same set of jar files in the classpath but
+ // with different order
+ output = TestCommon.execCommon(
+ "-cp", appJar2 + File.pathSeparator + appJar,
+ "HelloMore");
+ output.shouldContain(errorMessage1);
+ output.shouldContain(errorMessage2);
+ output.shouldHaveExitValue(1);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/BootClassPathMismatch.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,108 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary bootclasspath mismatch test.
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java
+ * @run main BootClassPathMismatch
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+import java.io.File;
+import java.nio.file.Files;
+import java.nio.file.FileAlreadyExistsException;
+import java.nio.file.StandardCopyOption;
+import java.nio.file.Paths;
+
+
+public class BootClassPathMismatch {
+ private static final String mismatchMessage = "shared class paths mismatch";
+
+ public static void main(String[] args) throws Exception {
+ JarBuilder.getOrCreateHelloJar();
+ copyHelloToNewDir();
+
+ BootClassPathMismatch test = new BootClassPathMismatch();
+ test.testBootClassPathMismatch();
+ test.testBootClassPathMatch();
+ }
+
+ /* Error should be detected if:
+ * dump time: -Xbootclasspath/a:${testdir}/hello.jar
+ * run-time : -Xbootclasspath/a:${testdir}/newdir/hello.jar
+ */
+ public void testBootClassPathMismatch() throws Exception {
+ String appJar = JarBuilder.getOrCreateHelloJar();
+ String appClasses[] = {"Hello"};
+ OutputAnalyzer dumpOutput = TestCommon.dump(
+ appJar, appClasses, "-Xbootclasspath/a:" + appJar);
+ String testDir = TestCommon.getTestDir("newdir");
+ String otherJar = testDir + File.separator + "hello.jar";
+ OutputAnalyzer execOutput = TestCommon.exec(
+ appJar, "-verbose:class", "-Xbootclasspath/a:" + otherJar, "Hello");
+ try {
+ TestCommon.checkExec(execOutput, mismatchMessage);
+ } catch (java.lang.RuntimeException re) {
+ String cause = re.getMessage();
+ if (!mismatchMessage.equals(cause)) {
+ throw re;
+ }
+ }
+ }
+
+ /* No error if:
+ * dump time: -Xbootclasspath/a:${testdir}/hello.jar
+ * run-time : -Xbootclasspath/a:${testdir}/hello.jar
+ */
+ public void testBootClassPathMatch() throws Exception {
+ String appJar = TestCommon.getTestJar("hello.jar");
+ String appClasses[] = {"Hello"};
+ OutputAnalyzer dumpOutput = TestCommon.dump(
+ appJar, appClasses, "-Xbootclasspath/a:" + appJar);
+ OutputAnalyzer execOutput = TestCommon.exec(
+ appJar, "-verbose:class",
+ "-Xbootclasspath/a:" + appJar, "Hello");
+ TestCommon.checkExec(execOutput,
+ "[class,load] Hello source: shared objects file");
+ }
+
+ private static void copyHelloToNewDir() throws Exception {
+ String classDir = System.getProperty("test.classes");
+ String dstDir = classDir + File.separator + "newdir";
+ try {
+ Files.createDirectory(Paths.get(dstDir));
+ } catch (FileAlreadyExistsException e) { }
+
+ Files.copy(Paths.get(classDir, "hello.jar"),
+ Paths.get(dstDir, "hello.jar"),
+ StandardCopyOption.REPLACE_EXISTING);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/CaseSensitiveClassPath.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,92 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+
+/*
+ * @test
+ * @summary Test case sensitive aspect of comparing class paths
+ * between dump time and archive use time
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @requires os.family != "mac"
+ * @compile test-classes/Hello.java
+ * @run main CaseSensitiveClassPath
+ */
+
+import java.nio.file.FileAlreadyExistsException;
+import java.nio.file.Files;
+import java.nio.file.Path;
+import java.nio.file.Paths;
+import java.nio.file.StandardCopyOption;
+import jdk.test.lib.Platform;
+import jdk.test.lib.process.OutputAnalyzer;
+
+
+// Excluded from running on MAC: a more comprehensive case sensitivity detection
+// and fix mechanism is needed, which is planned to be implemented in the future.
+public class CaseSensitiveClassPath {
+ public static void main(String[] args) throws Exception {
+ String appJar = JarBuilder.getOrCreateHelloJar();
+ String appJarUpper = appJar.replace("hello", "Hello");
+
+ OutputAnalyzer out = TestCommon.dump(appJar, TestCommon.list("Hello"));
+ TestCommon.checkDump(out);
+
+ Path jarPath = Paths.get(appJar);
+ Path jarPathUpper = null;
+
+ boolean fileExists = false;
+ try {
+ jarPathUpper = Files.createFile(Paths.get(appJarUpper));
+ } catch (FileAlreadyExistsException faee) {
+ fileExists = true;
+ }
+
+ if (!fileExists) {
+ try {
+ Files.copy(jarPath, jarPathUpper, StandardCopyOption.REPLACE_EXISTING);
+ } catch (Exception e) {
+ throw new java.lang.RuntimeException(
+ "Failed copying file from " + appJar + " to " + appJarUpper + ".", e);
+ }
+ } else {
+ jarPathUpper = Paths.get(appJarUpper);
+ }
+
+ out = TestCommon.exec(appJarUpper, "Hello", "-Xlog:class+path=info",
+ "-Xlog:cds");
+ if (TestCommon.isUnableToMap(out))
+ return;
+
+ if (Files.isSameFile(jarPath, jarPathUpper)) {
+ TestCommon.checkExec(out, "Hello World");
+ } else {
+ out.shouldContain("shared class paths mismatch")
+ .shouldHaveExitValue(1);
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/ClassLoaderTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,93 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Initiating and defining classloader test.
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java
+ * @compile test-classes/HelloWB.java
+ * @compile test-classes/ForNameTest.java
+ * @compile test-classes/BootClassPathAppendHelper.java
+ * @build sun.hotspot.WhiteBox
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @run main ClassLoaderTest
+ */
+
+import java.io.File;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class ClassLoaderTest {
+ public static void main(String[] args) throws Exception {
+ JarBuilder.build(true, "ClassLoaderTest-WhiteBox", "sun/hotspot/WhiteBox");
+ JarBuilder.getOrCreateHelloJar();
+ JarBuilder.build("ClassLoaderTest-HelloWB", "HelloWB");
+ JarBuilder.build("ClassLoaderTest-ForName", "ForNameTest");
+ ClassLoaderTest test = new ClassLoaderTest();
+ test.testBootLoader();
+ test.testDefiningLoader();
+ }
+
+ public void testBootLoader() throws Exception {
+ String appJar = TestCommon.getTestJar("ClassLoaderTest-HelloWB.jar");
+ String appClasses[] = {"HelloWB"};
+ String whiteBoxJar = TestCommon.getTestJar("ClassLoaderTest-WhiteBox.jar");
+ String bootClassPath = "-Xbootclasspath/a:" + appJar +
+ File.pathSeparator + whiteBoxJar;
+
+ TestCommon.dump(appJar, appClasses, bootClassPath);
+
+ OutputAnalyzer runtimeOutput = TestCommon.execCommon(
+ "-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI",
+ "-cp", appJar, bootClassPath, "-Xlog:class+load", "HelloWB");
+
+ if (!TestCommon.isUnableToMap(runtimeOutput)) {
+ runtimeOutput.shouldNotContain(
+ "[class,load] HelloWB source: shared objects file by jdk/internal/misc/ClassLoaders$AppClassLoader");
+ runtimeOutput.shouldContain("[class,load] HelloWB source: shared objects file");
+ }
+ }
+
+ public void testDefiningLoader() throws Exception {
+ // The boot loader should be used to load the class when it's
+ // on the bootclasspath, regardless who is the initiating classloader.
+ // In this test case, the AppClassLoader is the initiating classloader.
+ String helloJar = TestCommon.getTestJar("hello.jar");
+ String appJar = helloJar + System.getProperty("path.separator") +
+ TestCommon.getTestJar("ClassLoaderTest-ForName.jar");
+ String whiteBoxJar = TestCommon.getTestJar("ClassLoaderTest-WhiteBox.jar");
+ String bootClassPath = "-Xbootclasspath/a:" + helloJar +
+ File.pathSeparator + whiteBoxJar;
+
+ TestCommon.dump(helloJar, TestCommon.list("Hello"), bootClassPath);
+
+ TestCommon.execCommon("-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI",
+ "-cp", appJar, bootClassPath, "-XX:+TraceClassPaths", "ForNameTest");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/ClassPathAttr.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,106 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Class-Path: attribute in MANIFEST file
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @run main ClassPathAttr
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+import java.io.File;
+import java.nio.file.Files;
+import java.nio.file.FileAlreadyExistsException;
+import java.nio.file.StandardCopyOption;
+import java.nio.file.Paths;
+
+
+public class ClassPathAttr {
+
+ public static void main(String[] args) throws Exception {
+ buildCpAttr("cpattr1", "cpattr1.mf", "CpAttr1", "CpAttr1");
+ buildCpAttr("cpattr1_long", "cpattr1_long.mf", "CpAttr1", "CpAttr1");
+ buildCpAttr("cpattr2", "cpattr2.mf", "CpAttr2", "CpAttr2");
+ buildCpAttr("cpattr3", "cpattr3.mf", "CpAttr3", "CpAttr2", "CpAttr3");
+ buildCpAttr("cpattr4", "cpattr4.mf", "CpAttr4",
+ "CpAttr2", "CpAttr3", "CpAttr4", "CpAttr5");
+ buildCpAttr("cpattr5_123456789_223456789_323456789_423456789_523456789_623456789", "cpattr5_extra_long.mf", "CpAttr5", "CpAttr5");
+
+ for (int i=1; i<=2; i++) {
+ String jar1 = TestCommon.getTestJar("cpattr1.jar");
+ String jar4 = TestCommon.getTestJar("cpattr4.jar");
+ if (i == 2) {
+ // Test case #2 -- same as #1, except we use cpattr1_long.jar, which has a super-long
+ // Class-Path: attribute.
+ jar1 = TestCommon.getTestJar("cpattr1_long.jar");
+ }
+ String cp = jar1 + File.pathSeparator + jar4;
+
+ TestCommon.testDump(cp, TestCommon.list("CpAttr1",
+ "CpAttr2",
+ "CpAttr3",
+ "CpAttr4",
+ "CpAttr5"));
+
+ OutputAnalyzer output = TestCommon.execCommon(
+ "-cp", cp,
+ "CpAttr1");
+ TestCommon.checkExec(output);
+
+ // Logging test for class+path.
+ output = TestCommon.execCommon(
+ "-Xlog:class+path",
+ "-cp", cp,
+ "CpAttr1");
+ if (!TestCommon.isUnableToMap(output)){
+ output.shouldMatch("checking shared classpath entry: .*cpattr2.jar");
+ output.shouldMatch("checking shared classpath entry: .*cpattr3.jar");
+ }
+ // Make sure aliased TraceClassPaths still works
+ output = TestCommon.execCommon(
+ "-XX:+TraceClassPaths",
+ "-cp", cp,
+ "CpAttr1");
+ if (!TestCommon.isUnableToMap(output)){
+ output.shouldMatch("checking shared classpath entry: .*cpattr2.jar");
+ output.shouldMatch("checking shared classpath entry: .*cpattr3.jar");
+ }
+ }
+ }
+
+ private static void buildCpAttr(String jarName, String manifest, String enclosingClassName, String ...testClassNames) throws Exception {
+ String jarClassesDir = System.getProperty("test.classes") + File.separator + jarName + "_classes";
+ try { Files.createDirectory(Paths.get(jarClassesDir)); } catch (FileAlreadyExistsException e) { }
+
+ JarBuilder.compile(jarClassesDir, System.getProperty("test.src") + File.separator +
+ "test-classes" + File.separator + enclosingClassName + ".java");
+ JarBuilder.buildWithManifest(jarName, manifest, jarClassesDir, testClassNames);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/CommandLineFlagCombo.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,128 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test CommandLineFlagCombo
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.gc=="null") & ((vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true))
+ * @summary Test command line flag combinations that
+ * could likely affect the behaviour of AppCDS
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java
+ * @run main/timeout=240 CommandLineFlagCombo
+ */
+
+import jdk.test.lib.BuildHelper;
+import jdk.test.lib.Platform;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class CommandLineFlagCombo {
+
+ // shared base address test table
+ private static final String[] testTable = {
+ "-XX:+UseG1GC", "-XX:+UseSerialGC", "-XX:+UseParallelGC", "-XX:+UseConcMarkSweepGC",
+ "-XX:+FlightRecorder",
+ "-XX:+UseLargePages", // may only take effect on machines with large-pages
+ "-XX:+UseCompressedClassPointers",
+ "-XX:+UseCompressedOops",
+ "-XX:ObjectAlignmentInBytes=16",
+ "-XX:ObjectAlignmentInBytes=32",
+ "-XX:ObjectAlignmentInBytes=64"
+ };
+
+ public static void main(String[] args) throws Exception {
+ String appJar = JarBuilder.getOrCreateHelloJar();
+ String classList[] = {"Hello"};
+
+ for (String testEntry : testTable) {
+ System.out.println("CommandLineFlagCombo = " + testEntry);
+
+ if (skipTestCase(testEntry))
+ continue;
+
+ OutputAnalyzer dumpOutput;
+
+ if (testEntry.equals("-XX:+FlightRecorder")) {
+ dumpOutput = TestCommon.dump(appJar, classList, "-XX:+UnlockCommercialFeatures", testEntry);
+ } else {
+ dumpOutput = TestCommon.dump(appJar, classList, testEntry);
+ }
+
+ TestCommon.checkDump(dumpOutput, "Loading classes to share");
+
+ OutputAnalyzer execOutput;
+ if (testEntry.equals("-XX:+FlightRecorder")) {
+ execOutput = TestCommon.exec(appJar, "-XX:+UnlockCommercialFeatures", testEntry, "Hello");
+ } else {
+ execOutput = TestCommon.exec(appJar, testEntry, "Hello");
+ }
+ TestCommon.checkExec(execOutput, "Hello World");
+ }
+
+ for (int i=0; i<2; i++) {
+ String g1Flag, serialFlag;
+
+ // Interned strings are supported only with G1GC. However, we should not crash if:
+ // 0: archive has shared strings, but run time doesn't support shared strings
+ // 1: archive has no shared strings, but run time supports shared strings
+
+ String dump_g1Flag = "-XX:" + (i == 0 ? "+" : "-") + "UseG1GC";
+ String run_g1Flag = "-XX:" + (i != 0 ? "+" : "-") + "UseG1GC";
+ String dump_serialFlag = "-XX:" + (i != 0 ? "+" : "-") + "UseSerialGC";
+ String run_serialFlag = "-XX:" + (i == 0 ? "+" : "-") + "UseSerialGC";
+
+ OutputAnalyzer dumpOutput = TestCommon.dump(
+ appJar, classList, dump_g1Flag, dump_serialFlag);
+
+ TestCommon.checkDump(dumpOutput, "Loading classes to share");
+
+ OutputAnalyzer execOutput = TestCommon.exec(appJar, run_g1Flag, run_serialFlag, "Hello");
+ TestCommon.checkExec(execOutput, "Hello World");
+ }
+ }
+
+ private static boolean skipTestCase(String testEntry) throws Exception {
+ if (Platform.is32bit())
+ {
+ if (testEntry.equals("-XX:+UseCompressedOops") ||
+ testEntry.equals("-XX:+UseCompressedClassPointers") ||
+ testEntry.contains("ObjectAlignmentInBytes") )
+ {
+ System.out.println("Test case not applicable on 32-bit platforms");
+ return true;
+ }
+ }
+
+ if (!BuildHelper.isCommercialBuild() && testEntry.equals("-XX:+FlightRecorder"))
+ {
+ System.out.println("Test case not applicable on non-commercial builds");
+ return true;
+ }
+
+ return false;
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/CommandLineFlagComboNegative.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,101 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test CommandLineFlagComboNegative
+ * @summary Test command line flag combinations that differ between
+ * the dump and execute steps, in such way that they cause errors
+ * E.g. use compressed oops for creating and archive, but then
+ * execute w/o compressed oops
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java
+ * @run main CommandLineFlagComboNegative
+ */
+
+import java.util.ArrayList;
+import jdk.test.lib.Platform;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class CommandLineFlagComboNegative {
+
+ private class TestVector {
+ public String testOptionForDumpStep;
+ public String testOptionForExecuteStep;
+ public String expectedErrorMsg;
+ public int expectedErrorCode;
+
+ public TestVector(String testOptionForDumpStep, String testOptionForExecuteStep,
+ String expectedErrorMsg, int expectedErrorCode) {
+ this.testOptionForDumpStep=testOptionForDumpStep;
+ this.testOptionForExecuteStep=testOptionForExecuteStep;
+ this.expectedErrorMsg=expectedErrorMsg;
+ this.expectedErrorCode=expectedErrorCode;
+ }
+ }
+
+ private ArrayList<TestVector> testTable = new ArrayList<TestVector>();
+
+ private void initTestTable() {
+ // These options are not applicable on 32-bit platforms
+ if (Platform.is64bit()) {
+ testTable.add( new TestVector("-XX:ObjectAlignmentInBytes=8", "-XX:ObjectAlignmentInBytes=16",
+ "An error has occurred while processing the shared archive file", 1) );
+ testTable.add( new TestVector("-XX:ObjectAlignmentInBytes=64", "-XX:ObjectAlignmentInBytes=32",
+ "An error has occurred while processing the shared archive file", 1) );
+ testTable.add( new TestVector("-XX:+UseCompressedOops", "-XX:-UseCompressedOops",
+ "Class data sharing is inconsistent with other specified options", 1) );
+ testTable.add( new TestVector("-XX:+UseCompressedClassPointers", "-XX:-UseCompressedClassPointers",
+ "Class data sharing is inconsistent with other specified options", 1) );
+ }
+ }
+
+ private void runTests() throws Exception
+ {
+ for (TestVector testEntry : testTable) {
+ System.out.println("CommandLineFlagComboNegative: dump = " + testEntry.testOptionForDumpStep);
+ System.out.println("CommandLineFlagComboNegative: execute = " + testEntry.testOptionForExecuteStep);
+
+ String appJar = JarBuilder.getOrCreateHelloJar();
+ OutputAnalyzer dumpOutput = TestCommon.dump(
+ appJar, new String[] {"Hello"}, testEntry.testOptionForDumpStep);
+
+ TestCommon.checkDump(dumpOutput, "Loading classes to share");
+
+ OutputAnalyzer execOutput = TestCommon.exec(appJar, testEntry.testOptionForExecuteStep, "Hello");
+ execOutput.shouldContain(testEntry.expectedErrorMsg);
+ execOutput.shouldHaveExitValue(testEntry.expectedErrorCode);
+ }
+ }
+
+ public static void main(String[] args) throws Exception {
+ CommandLineFlagComboNegative thisClass = new CommandLineFlagComboNegative();
+ thisClass.initTestTable();
+ thisClass.runTests();
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/CompilerUtils.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,80 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import javax.tools.JavaCompiler;
+import javax.tools.StandardJavaFileManager;
+import javax.tools.StandardLocation;
+import javax.tools.ToolProvider;
+import java.io.IOException;
+import java.nio.file.Files;
+import java.nio.file.Path;
+import java.util.Arrays;
+import java.util.List;
+import java.util.stream.Collectors;
+
+/**
+ * This class consists exclusively of static utility methods for invoking the
+ * java compiler.
+ *
+ * This class will eventually move to jdk.testlibrary.
+ */
+
+public final class CompilerUtils {
+ private CompilerUtils() { }
+
+ /**
+ * Compile all the java sources in {@code <source>/**} to
+ * {@code <destination>/**}. The destination directory will be created if
+ * it doesn't exist.
+ *
+ * All warnings/errors emitted by the compiler are output to System.out/err.
+ *
+ * @return true if the compilation is successful
+ *
+ * @throws IOException if there is an I/O error scanning the source tree or
+ * creating the destination directory
+ */
+ public static boolean compile(Path source, Path destination, String ... options)
+ throws IOException
+ {
+ JavaCompiler compiler = ToolProvider.getSystemJavaCompiler();
+ StandardJavaFileManager jfm = compiler.getStandardFileManager(null, null, null);
+
+ List<Path> sources
+ = Files.find(source, Integer.MAX_VALUE,
+ (file, attrs) -> (file.toString().endsWith(".java")))
+ .collect(Collectors.toList());
+
+ Files.createDirectories(destination);
+ jfm.setLocationFromPaths(StandardLocation.CLASS_OUTPUT,
+ Arrays.asList(destination));
+
+ List<String> opts = Arrays.asList(options);
+ JavaCompiler.CompilationTask task
+ = compiler.getTask(null, jfm, null, opts, null,
+ jfm.getJavaFileObjectsFromPaths(sources));
+
+ return task.call();
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/DumpClassList.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,103 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary DumpLoadedClassList should exclude generated classes, classes in bootclasspath/a and
+ * --patch-module.
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/ArrayListTest.java
+ * @run main DumpClassList
+ */
+
+import jdk.test.lib.compiler.InMemoryJavaCompiler;
+import jdk.test.lib.process.OutputAnalyzer;
+import jdk.test.lib.process.ProcessTools;
+
+public class DumpClassList {
+ public static void main(String[] args) throws Exception {
+ // build The app
+ String[] appClass = new String[] {"ArrayListTest"};
+ String classList = "app.list";
+
+ JarBuilder.build("app", appClass[0]);
+ String appJar = TestCommon.getTestJar("app.jar");
+
+ // build patch-module
+ String source = "package java.lang; " +
+ "public class NewClass { " +
+ " static { " +
+ " System.out.println(\"NewClass\"); "+
+ " } " +
+ "}";
+
+ ClassFileInstaller.writeClassToDisk("java/lang/NewClass",
+ InMemoryJavaCompiler.compile("java.lang.NewClass", source, "--patch-module=java.base"),
+ System.getProperty("test.classes"));
+
+ String patchJar = JarBuilder.build("javabase", "java/lang/NewClass");
+
+ // build bootclasspath/a
+ String source2 = "package boot.append; " +
+ "public class Foo { " +
+ " static { " +
+ " System.out.println(\"Foo\"); " +
+ " } " +
+ "}";
+
+ ClassFileInstaller.writeClassToDisk("boot/append/Foo",
+ InMemoryJavaCompiler.compile("boot.append.Foo", source2),
+ System.getProperty("test.classes"));
+
+ String appendJar = JarBuilder.build("bootappend", "boot/append/Foo");
+
+ // dump class list
+ ProcessBuilder pb = ProcessTools.createJavaProcessBuilder(
+ true,
+ "-XX:DumpLoadedClassList=" + classList,
+ "--patch-module=java.base=" + patchJar,
+ "-Xbootclasspath/a:" + appendJar,
+ "-cp",
+ appJar,
+ appClass[0]);
+ OutputAnalyzer output = TestCommon.executeAndLog(pb, "dumpClassList");
+ TestCommon.checkExecReturn(output, 0, true,
+ "hello world",
+ "skip writing class java/lang/NewClass") // skip classes outside of jrt image
+ .shouldNotContain("skip writing class boot/append/Foo"); // but classes on -Xbootclasspath/a should not be skipped
+
+ output = TestCommon.createArchive(appJar, appClass,
+ "-Xbootclasspath/a:" + appendJar,
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+PrintSystemDictionaryAtExit",
+ "-XX:SharedClassListFile=" + classList);
+ TestCommon.checkDump(output)
+ .shouldNotContain("Preload Warning: Cannot find java/lang/invoke/LambdaForm")
+ .shouldNotContain("Preload Warning: Cannot find boot/append/Foo")
+ .shouldContain("boot.append.Foo, loader <shared, not restored>");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/ExtraSymbols.invalid_1.txt Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,11 @@
+VERSION: 1.0
+@SECTION: Symbol
+0 -1:
+41 -1: (Ljava/util/Set<TE;>;Ljava/lang/Object;)V
+11 -1 linkMethod
+18 -1: type can't be null
+20 -1: isAlphaNumericString
+43 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;)Z
+1 -1: \t
+15 -1: IntCumulateTask
+1 -1: \n
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/ExtraSymbols.invalid_2.txt Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,5 @@
+@SECTION: Symbol
+20 -1: isAlphaNumericString
+43 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;)Z
+15 -1: IntCumulateTask
+1 -1: \n
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/ExtraSymbols.invalid_3.txt Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,13 @@
+VERSION: 1.0
+@SECTION: Symbol
+11 -1: linkMethod
+18 -1: isAlphaNumericString
+33 -1: java/util/Locale$LocaleNameGetter
+23 -1: sun/invoke/util/Wrapper
+12 -1: reduceToLong
+11 -1: setReadOnly
+8 -1: endsWith
+55 -1: <T:Ljava/lang/Object;>(Ljava/lang/ClassValue<TT;>;TT;)V
+20 -1: createAnnotationData
+6 -1: OfLong
+17 -1: getClassSignature
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/ExtraSymbols.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,89 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Adding extra symbols into CDS archive using -XX:SharedArchiveConfigFile
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java
+ * @run main ExtraSymbols
+ */
+
+import java.io.*;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class ExtraSymbols {
+ public static void main(String[] args) throws Exception {
+ String appJar = JarBuilder.getOrCreateHelloJar();
+
+ // 1. Dump without extra symbols.
+ OutputAnalyzer output = TestCommon.dump(appJar, TestCommon.list("Hello"));
+ checkOutput(output);
+ int numEntries1 = numOfEntries(output);
+
+ // 2. Dump an archive with extra symbols. All symbols in
+ // ExtraSymbols.symbols.txt are valid. Dumping should succeed.
+ output = TestCommon.dump(appJar, TestCommon.list("Hello"),
+ "-XX:SharedArchiveConfigFile=" + TestCommon.getSourceFile("ExtraSymbols.symbols.txt"));
+ checkOutput(output);
+ int numEntries2 = numOfEntries(output);
+ if (numEntries2 <= numEntries1) {
+ throw new RuntimeException("No extra symbols added to archive");
+ }
+ output = TestCommon.exec(appJar, "Hello");
+ TestCommon.checkExec(output);
+
+ // 3. Dump with invalid symbol files. Dumping should fail.
+ String invalid_symbol_files[] = {"ExtraSymbols.invalid_1.txt",
+ "ExtraSymbols.invalid_2.txt",
+ "ExtraSymbols.invalid_3.txt"};
+ String err_msgs[] = {"Corrupted at line",
+ "wrong version of hashtable dump file",
+ "Corrupted at line"};
+ for (int i = 0; i < invalid_symbol_files.length; i++) {
+ output = TestCommon.dump(appJar, TestCommon.list("Hello"),
+ "-XX:SharedArchiveConfigFile=" +
+ TestCommon.getSourceFile(invalid_symbol_files[i]));
+ output.shouldContain("Error occurred during initialization of VM");
+ output.shouldContain(err_msgs[i]);
+ }
+ }
+
+ static int numOfEntries(OutputAnalyzer output) {
+ String s = output.firstMatch("Number of entries : .*");
+ String subs[] = s.split("[:]");
+ int numEntries = Integer.parseInt(subs[1].trim());
+ return numEntries;
+ }
+
+ static void checkOutput(OutputAnalyzer output) throws Exception {
+ output.shouldContain("Loading classes to share");
+ output.shouldContain("Shared symbol table stats -------- base:");
+ output.shouldHaveExitValue(0);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/ExtraSymbols.symbols.txt Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,10826 @@
+VERSION: 1.0
+@SECTION: Symbol
+69 -1: ------------------------------------------------------------123456789
+68 -1: # The values in this file are only used for testing the operation of
+63 -1: # adding extra symbols into the CDS archive. None of the values
+70 -1: # are interpreted in any way. So even if they contain names of classes
+70 -1: # that have been renamed or removed, or string literals that have been
+66 -1: # changed or remove from Java source code, it would not affect the
+26 -1: # correctness of the test.
+0 -1:
+41 -1: (Ljava/util/Set<TE;>;Ljava/lang/Object;)V
+11 -1: linkMethod
+18 -1: type can't be null
+20 -1: isAlphaNumericString
+43 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;)Z
+72 -1: (Ljava/lang/String;[Ljava/lang/String;Ljava/io/File;)Ljava/lang/Process;
+1 -1: \t
+15 -1: IntCumulateTask
+1 -1: \n
+33 -1: java/util/Locale$LocaleNameGetter
+23 -1: sun/invoke/util/Wrapper
+57 -1: (Ljava/io/InputStream;Ljava/nio/charset/CharsetDecoder;)V
+12 -1: reduceToLong
+11 -1: setReadOnly
+34 -1: (Ljava/lang/reflect/Executable;)[B
+54 -1: ([Ljava/net/URL;Ljava/security/AccessControlContext;)V
+15 -1: LegacyMergeSort
+8 -1: endsWith
+55 -1: <T:Ljava/lang/Object;>(Ljava/lang/ClassValue<TT;>;TT;)V
+20 -1: createAnnotationData
+6 -1: OfLong
+90 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/Map<TK;TV;>;)Ljava/util/Map<TK;TV;>;
+1 -1:
+17 -1: getClassSignature
+1 -1: "
+1 -1: #
+1 -1: (
+21 -1: MethodHandleImpl.java
+10 -1: getUTF8At0
+1 -1: )
+1 -1: *
+1 -1: +
+1 -1: ,
+1 -1: -
+1 -1: .
+18 -1: unsignedEntryNames
+1 -1: /
+1 -1: 0
+19 -1: java/io/InputStream
+38 -1: java/util/concurrent/ThreadLocalRandom
+1 -1: :
+1 -1: ;
+1 -1: <
+13 -1: getAndAddLong
+1 -1: =
+1 -1: >
+1 -1: ?
+20 -1: getMethodAtIfLoaded0
+1 -1: @
+1 -1: A
+7 -1: isAlive
+1 -1: B
+10 -1: checkIndex
+1 -1: C
+1 -1: D
+1 -1: E
+1 -1: F
+1 -1: I
+30 -1: sun/misc/JavaUtilZipFileAccess
+11 -1: classloader
+1 -1: J
+1 -1: L
+14 -1: packageEnabled
+8 -1: ([BIII)V
+24 -1: Ljava/io/BufferedWriter;
+1 -1: S
+32 -1: (Ljava/util/function/Consumer;)V
+11 -1: refKindName
+1 -1: U
+1 -1: V
+3 1: yyy
+18 -1: JavaNetAccess.java
+1 -1: Z
+7 -1: members
+1 -1: [
+1 -1: ]
+13 -1: ShortLanguage
+1 -1: _
+9 -1: invoke__L
+28 -1: (D)Ljava/lang/StringBuilder;
+15 -1: isInvokeSpecial
+1 -1: c
+17 -1: subListRangeCheck
+1 -1: e
+29 -1: Ljava/security/AllPermission;
+27 -1: (C)Ljava/lang/StringBuffer;
+28 -1: ([Ljava/lang/Comparable;II)V
+50 -1: (Ljava/util/zip/ZipFile;Ljava/util/zip/Inflater;)V
+9 -1: invoke__V
+1 -1: m
+101 -1: (Ljava/io/OutputStream;Ljava/lang/Object;Ljava/nio/charset/CharsetEncoder;)Lsun/nio/cs/StreamEncoder;
+13 -1: MAX_SURROGATE
+18 -1: Ljava/lang/String;
+21 -1: ensureProtectedAccess
+18 -1: getIfModifiedSince
+1 -1: r
+9 -1: setExtra0
+1 -1: s
+47 -1: Ljava/lang/Enum<Lsun/launcher/LauncherHelper;>;
+1 -1: x
+1 -1: {
+7 -1: getLast
+1 -1: |
+1 -1: }
+1 -1: ~
+71 -1: (Ljava/lang/Object;)Ljava/util/concurrent/ConcurrentHashMap$KeySetView;
+34 -1: (Ljava/nio/charset/Charset;[BII)[C
+10 -1: DST_NSHIFT
+25 -1: ForEachTransformedKeyTask
+26 -1: Ljava/nio/charset/Charset;
+56 -1: (Ljava/lang/reflect/Method;)Lsun/reflect/MethodAccessor;
+22 -1: StackTraceElement.java
+24 -1: sun.zip.zipFile.openTime
+27 -1: JNI_COPY_TO_ARRAY_THRESHOLD
+26 -1: java/lang/ClassValue$Entry
+19 -1: [Ljava/lang/Thread;
+56 -1: (Ljava/lang/ClassLoader$NativeLibrary;)Ljava/lang/Class;
+7 -1: message
+18 -1: parameterToArgSlot
+20 -1: [[Ljava/lang/String;
+11 -1: bumpVersion
+26 -1: Ljava/lang/reflect/Method;
+9 -1: getMethod
+6 -1: (I)TE;
+49 -1: (Ljava/lang/String;)Ljava/lang/invoke/MemberName;
+33 -1: sun/misc/URLClassPath$JarLoader$1
+57 -1: (BLjava/lang/Class;Ljava/lang/String;Ljava/lang/Object;)V
+33 -1: sun/misc/URLClassPath$JarLoader$2
+33 -1: sun/misc/URLClassPath$JarLoader$3
+87 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/HashMap$Node;)Ljava/util/HashMap$Node;
+19 -1: FileDescriptor.java
+12 -1: forEachValue
+36 -1: (Ljava/util/List;)[Ljava/lang/Class;
+53 -1: (Ljava/lang/CharSequence;II)Ljava/lang/StringBuilder;
+8 -1: hasArray
+4 -1: ROWS
+10 -1: linkMethod
+9 -1: remaining
+23 -1: ARRAY_FLOAT_BASE_OFFSET
+35 -1: java/lang/reflect/ReflectPermission
+24 -1: ()Ljava/net/InetAddress;
+7 -1: ngroups
+81 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction<Ljava/lang/Class<*>;>;
+10 -1: putTreeVal
+4 -1: list
+5 -1: trace
+7 -1: blocker
+21 -1: reset() not supported
+8 -1: JAPANESE
+11 -1: PRIVATE_USE
+53 -1: (Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodHandle;
+32 -1: Invalid JavaFX launch parameters
+15 -1: SECONDS_PER_DAY
+11 -1: UTF_16.java
+24 -1: sun/nio/cs/UTF_8$Encoder
+102 -1: (Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;[Ljava/security/Permission;)V
+20 -1: (Lsun/misc/Signal;)V
+22 -1: MagicAccessorImpl.java
+84 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;Ljava/security/CodeSource;)Ljava/lang/Class;
+14 -1: altMetafactory
+13 -1: queryOverflow
+30 -1: exists, but is not accessible
+3 -1: edt
+14 -1: MAX_ARRAY_SIZE
+20 -1: aliases_UTF_16LE_BOM
+34 -1: Ljava/lang/reflect/Constructor<*>;
+20 -1: (S)Ljava/lang/Short;
+6 -1: STRICT
+19 -1: internalCallerClass
+27 -1: java/nio/DirectLongBufferRU
+13 -1: TIMED_WAITING
+15 -1: toGenericString
+6 -1: client
+10 -1: attachImpl
+22 -1: ReflectionFactory.java
+8 -1: jsse.jar
+37 -1: (IZ)Ljava/lang/AbstractStringBuilder;
+41 -1: java/util/LinkedHashMap$LinkedKeyIterator
+15 -1: computeIfAbsent
+10 -1: GET_TARGET
+53 -1: <E:Ljava/lang/Enum<TE;>;>(Ljava/lang/Class<TE;>;)[TE;
+35 -1: java/util/Collections$SingletonList
+7 -1: addYear
+35 -1: Ljava/lang/Class<Ljava/lang/Byte;>;
+65 -1: (Ljava/util/LinkedHashMap$Entry;Ljava/util/LinkedHashMap$Entry;)V
+14 -1: image/x-bitmap
+10 -1: (IIII[JI)V
+50 -1: (Lsun/misc/URLClassPath$JarLoader;Ljava/net/URL;)V
+13 -1: getLineNumber
+20 -1: toUpperCaseCharArray
+62 -1: (Ljava/util/concurrent/locks/Condition;)Ljava/util/Collection;
+11 -1: rotateRight
+10 -1: checkPtype
+85 -1: (JLjava/util/function/ToLongFunction<-TK;>;JLjava/util/function/LongBinaryOperator;)J
+81 -1: (Ljava/lang/Class;Ljava/lang/reflect/Constructor;)Ljava/lang/reflect/Constructor;
+15 -1: Illegal style:
+28 -1: (Ljava/lang/StringBuilder;)V
+41 -1: 1.8.0-internal-iklam_2013_11_27_21_25-b00
+25 -1: Invalid authority field:
+55 -1: (Ljava/lang/CharSequence;)Ljava/util/function/Supplier;
+12 -1: staticOffset
+32 -1: java/util/HashMap$KeySpliterator
+13 -1: javaNioAccess
+24 -1: (Ljava/util/SortedSet;)V
+17 -1: thenComparingLong
+2 -1: \n\n
+22 -1: registerFieldsToFilter
+34 -1: java/lang/invoke/LambdaMetafactory
+225 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceMappingsTask;Ljava/util/function/BiFunction;Ljava/util/function/BiFunction;)V
+26 -1: [[Ljava/lang/CharSequence;
+32 -1: java/util/Collections$CheckedMap
+147 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractSequentialList<TE;>;Ljava/util/List<TE;>;Ljava/util/Deque<TE;>;Ljava/lang/Cloneable;Ljava/io/Serializable;
+204 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/CallSite;
+27 -1: sun/nio/cs/UTF_16BE$Decoder
+12 -1: getZoneInfo0
+77 -1: (Ljava/lang/Class;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodType;
+9 -1: Traverser
+35 -1: Ljava/lang/ref/ReferenceQueue<TT;>;
+27 -1: lambda$comparing$ea9a8b3a$1
+7 -1: ([CI)[C
+6 -1: getenv
+9 -1: newMethod
+52 -1: <T:Ljava/lang/Object;>Ljava/lang/reflect/Executable;
+164 -1: (Ljava/security/ProtectionDomain;Ljava/security/DomainCombiner;Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;[Ljava/security/Permission;)V
+40 -1: (Ljava/lang/String;)Ljava/util/TimeZone;
+11 -1: countTokens
+202 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/concurrent/ConcurrentHashMap$CollectionView<TK;TV;Ljava/util/Map$Entry<TK;TV;>;>;Ljava/util/Set<Ljava/util/Map$Entry<TK;TV;>;>;Ljava/io/Serializable;
+78 -1: <T:Ljava/lang/Object;>(Ljava/util/Collection<TT;>;)Ljava/util/Collection<TT;>;
+34 -1: (Ljava/lang/reflect/Constructor;)I
+15 -1: comparingDouble
+24 -1: ()Ljava/util/Collection;
+14 -1: invokeFinalize
+14 -1: encodeISOArray
+77 -1: (Ljava/lang/ref/Reference;Ljava/lang/ref/Reference;)Ljava/lang/ref/Reference;
+11 -1: bad index:
+34 -1: (Ljava/lang/reflect/Constructor;)V
+68 -1: (Ljava/util/jar/JarEntry;Lsun/security/util/ManifestEntryVerifier;)V
+53 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;IIIJ)V
+27 -1: ([CII)Ljava/nio/CharBuffer;
+6 -1: setOut
+41 -1: (ILjava/lang/Object;Ljava/lang/Object;I)V
+12 -1: MIN_EXPONENT
+30 -1: PrivilegedExceptionAction.java
+18 -1: key cannot be null
+6 -1: CENHDR
+73 -1: (ITK;TV;Ljava/util/HashMap$Node<TK;TV;>;)Ljava/util/HashMap$Node<TK;TV;>;
+23 -1: java/lang/reflect/Array
+8 -1: AF_LIMIT
+2 -1: \r\n
+11 -1: getFileName
+10 -1: parseShort
+22 -1: java/lang/LinkageError
+15 -1: FT_LAST_WRAPPER
+32 -1: java/util/ArrayDeque$DeqIterator
+24 -1: pc-multilingual-850+euro
+3 -1: zfc
+14 -1: incrementExact
+38 -1: (IIII)Lsun/util/calendar/CalendarDate;
+8 -1: (II[BI)V
+8 -1: isLocked
+13 -1: ZoneInfo.java
+36 -1: (Lsun/util/calendar/CalendarDate;J)V
+35 -1: java/lang/invoke/MethodHandleImpl$1
+31 -1: (Ljava/util/Comparator<-TE;>;)V
+19 -1: CharsetEncoder.java
+52 -1: <T:Ljava/lang/Object;>()Ljava/util/Enumeration<TT;>;
+44 -1: (Ljava/io/InputStream;)Ljava/io/InputStream;
+7 -1: field
+5 -1: abort
+25 -1: java/lang/SecurityManager
+66 -1: java/util/concurrent/ConcurrentHashMap$MapReduceValuesToDoubleTask
+1316 -1: \xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe5\xa0\x80\xe4\x80\x8f\xe5\x80\x80\xe4\x80\x8f\xe5\xa0\x80\xe4\x80\x8f\xe6\x80\x80\xe4\x80\x8f\xe5\x80\x80\xe4\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe5\x80\x80\xe4\x80\x8f\xe5\x80\x80\xe4\x80\x8f\xe5\x80\x80\xe4\x80\x8f\xe5\xa0\x80\xe4\x80\x8f\xe6\x80\x80\xe4\x80\x8c\xe6\xa0\x80\x18\xe6\xa0\x80\x18\xe2\xa0\x80\x18\xe2\xa0\x80\xe6\x80\x9a\xe2\xa0\x80\x18\xe6\xa0\x80\x18\xe6\xa0\x80\x18\xee\xa0\x80\x15\xee\xa0\x80\x16\xe6\xa0\x80\x18\xe2\x80\x80\x19\xe3\xa0\x80\x18\xe2\x80\x80\x14\xe3\xa0\x80\x18\xe3\xa0\x80\x18\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe1\xa0\x80\xe3\x98\x89\xe3\xa0\x80\x18\xe6\xa0\x80\x18\xee\xa0\x80\x19\xe6\xa0\x80\x19\xee\xa0\x80\x19\xe6\xa0\x80\x18\xe6\xa0\x80\x18\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xc2\x82\xe7\xbf\xa1\xee\xa0\x80\x15\xe6\xa0\x80\x18\xee\xa0\x80\x16\xe6\xa0\x80\x1b\xe6\xa0\x80\xe5\x80\x97\xe6\xa0\x80\x1b\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xc2\x81\xe7\xbf\xa2\xee\xa0\x80\x15\xe6\xa0\x80\x19\xee\xa0\x80\x16\xe6\xa0\x80\x19\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe5\x80\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe4\xa0\x80\xe1\x80\x8f\xe3\xa0\x80\x0c\xe6\xa0\x80\x18\xe2\xa0\x80\xe6\x80\x9a\xe2\xa0\x80\xe6\x80\x9a\xe2\xa0\x80\xe6\x80\x9a\xe2\xa0\x80\xe6\x80\x9a\xe6\xa0\x80\x1c\xe6\xa0\x80\x18\xe6\xa0\x80\x1b\xe6\xa0\x80\x1c\xc0\x80\xe7\x80\x85\xee\xa0\x80\x1d\xe6\xa0\x80\x19\xe4\xa0\x80\xe1\x80\x90\xe6\xa0\x80\x1c\xe6\xa0\x80\x1b\xe2\xa0\x80\x1c\xe2\xa0\x80\x19\xe1\xa0\x80\xd8\x8b\xe1\xa0\x80\xd8\x8b\xe6\xa0\x80\x1b\xdf\xbd\xe7\x80\x82\xe6\xa0\x80\x18\xe6\xa0\x80\x18\xe6\xa0\x80\x1b\xe1\xa0\x80\xd4\x8b\xc0\x80\xe7\x80\x85\xee\xa0\x80\x1e\xe6\xa0\x80\xe0\xa0\x8b\xe6\xa0\x80\xe0\xa0\x8b\xe6\xa0\x80\xe0\xa0\x8b\xe6\xa0\x80\x18\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xe6\xa0\x80\x19\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xc2\x82\xe7\x80\x81\xdf\xbd\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xe6\xa0\x80\x19\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xc2\x81\xe7\x80\x82\xd8\x9d\xe7\x80\x82
+6 -1: (J[I)I
+162 -1: (Ljava/util/List<Ljava/util/Locale$LanguageRange;>;Ljava/util/Collection<Ljava/util/Locale;>;Ljava/util/Locale$FilteringMode;)Ljava/util/List<Ljava/util/Locale;>;
+21 -1: getQualifiedFieldName
+46 -1: Ljava/util/Set<Ljava/util/Map$Entry<TK;TV;>;>;
+47 -1: (Ljava/util/Collection;Ljava/util/Collection;)Z
+10 -1: getRuntime
+30 -1: threadLocalRandomSecondarySeed
+18 -1: (Ljava/io/File;I)J
+10 -1: methodName
+34 -1: sun/reflect/generics/tree/TypeTree
+35 -1: (Ljava/io/File;)[Ljava/lang/String;
+31 -1: java/util/Collections$EmptyList
+15 -1: LF_INVINTERFACE
+9 -1: notifyAll
+18 -1: (Ljava/io/File;I)V
+94 -1: (Ljava/lang/String;[BIILjava/security/ProtectionDomain;Ljava/lang/String;)Ljava/lang/Class<*>;
+45 -1: (Ljava/lang/String;)Ljava/net/ContentHandler;
+3 -1: enc
+3 -1: end
+18 -1: (Ljava/io/File;I)Z
+47 -1: (Ljava/lang/Object;Ljava/lang/reflect/Method;)V
+76 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Z)V
+19 -1: getURLStreamHandler
+46 -1: (Ljava/lang/ClassLoader;Ljava/lang/Class<*>;)V
+17 -1: COMPILE_THRESHOLD
+15 -1: charset is null
+7 -1: ibm-912
+10 -1: basicTypes
+7 -1: ibm-914
+78 -1: (Ljava/lang/Class;Ljava/lang/ref/SoftReference;Ljava/lang/ref/SoftReference;)Z
+7 -1: ibm-915
+12 -1: JarFileEntry
+12 -1: setThreshold
+22 -1: (ILjava/lang/Object;)V
+55 -1: <T::Lsun/reflect/generics/tree/Tree;>Ljava/lang/Object;
+16 -1: Unknown signal:
+3 -1: zip
+13 -1: CR_UNMAPPABLE
+19 -1: getClassAtIfLoaded0
+21 -1: WindowsClientCounters
+29 -1: Ljava/lang/invoke/MethodType;
+91 -1: <E:Ljava/lang/Object;>Ljava/util/Collections$UnmodifiableList<TE;>;Ljava/util/RandomAccess;
+23 -1: StackOverflowError.java
+13 -1: Launcher.java
+9 -1: Signature
+7 -1: ibm-920
+153 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>([Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;ILjava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;)V
+13 -1: setExtensions
+26 -1: [Ljava/lang/ref/Reference;
+7 -1: ibm-923
+12 -1: BMH.reinvoke
+34 -1: java/lang/IllegalArgumentException
+53 -1: (Ljava/lang/String;)Ljava/lang/NumberFormatException;
+5 -1: .dirs
+13 -1: finishToArray
+22 -1: (ZI)Ljava/lang/String;
+84 -1: (Ljava/lang/String;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/RuntimeException;
+15 -1: charsetProvider
+24 -1: ()Ljava/lang/Class<TT;>;
+10 -1: wordsInUse
+26 -1: (Ljava/io/ExpiringCache;)I
+53 -1: ()Ljava/util/Iterator<Ljava/util/Map$Entry<TK;TV;>;>;
+25 -1: com/sun/management/GcInfo
+26 -1: getCompatibilityExtensions
+69 -1: (Ljava/lang/ref/ReferenceQueue;Ljava/util/concurrent/ConcurrentMap;)V
+15 -1: getConstantPool
+24 -1: [[Ljava/lang/Comparable;
+26 -1: (Ljava/io/ExpiringCache;)V
+8 -1: getTable
+53 -1: sun/reflect/generics/repository/ConstructorRepository
+5 -1: range
+36 -1: (Ljava/lang/String;)Ljava/lang/Byte;
+72 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class;)V
+60 -1: <T:Ljava/lang/Object;>([TT;TT;Ljava/util/Comparator<-TT;>;)I
+20 -1: (Ljava/nio/Bits$1;)V
+30 -1: ()Ljava/util/Spliterator<TK;>;
+6 -1: ([BB)I
+53 -1: (Ljava/lang/ref/Finalizer;Lsun/misc/JavaLangAccess;)V
+11 -1: memberTypes
+45 -1: (ILjava/lang/String;)Ljava/lang/StringBuffer;
+12 -1: OTHER_SYMBOL
+65 -1: (Ljava/lang/Class;Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
+43 -1: (Ljava/util/Set;)[Ljava/lang/reflect/Field;
+30 -1: (Ljava/lang/ref/Reference$1;)V
+18 -1: GREGORIAN_INSTANCE
+31 -1: Ljava/lang/FunctionalInterface;
+57 -1: (Ljava/lang/Error;Ljava/lang/Exception;)Ljava/lang/Error;
+54 -1: ([Ljava/lang/reflect/Field;)[Ljava/lang/reflect/Field;
+14 -1: not an array:
+6 -1: ([BB)V
+9 -1: ISO8859_1
+8 -1: addTrans
+27 -1: getFunctionalInterfaceClass
+29 -1: lambda$comparingInt$7b0bb60$1
+8 -1: TreeNode
+138 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/Dictionary<TK;TV;>;Ljava/util/Map<TK;TV;>;Ljava/lang/Cloneable;Ljava/io/Serializable;
+3 -1: era
+22 -1: fakeMethodHandleInvoke
+9 -1: addToList
+39 -1: (Ljava/lang/Class;[Ljava/lang/String;)V
+17 -1: launchApplication
+21 -1: randomNumberGenerator
+51 -1: Ljava/lang/ThreadLocal<Ljava/lang/ThreadLocal<*>;>;
+35 -1: java/io/ObjectOutputStream$PutField
+42 -1: (ILjava/util/function/IntBinaryOperator;)I
+3 -1: err
+13 -1: cachedDecoder
+32 -1: sun/util/calendar/ZoneInfoFile$1
+23 -1: doIntersectionPrivilege
+19 -1: cspc850multilingual
+56 -1: Ljava/util/Map<Ljava/lang/Class<*>;[Ljava/lang/String;>;
+11 -1: loader_data
+27 -1: (Ljava/util/jar/Manifest;)V
+5 -1: files
+90 -1: Ljava/util/concurrent/ConcurrentMap<Ljava/lang/String;Lsun/util/calendar/CalendarSystem;>;
+36 -1: [[Ljava/lang/invoke/LambdaForm$Name;
+5 -1: lines
+55 -1: (Lsun/misc/URLClassPath$JarLoader;)Lsun/misc/MetaIndex;
+9 -1: ansi-1251
+15 -1: refKindIsMethod
+29 -1: java/lang/reflect/Constructor
+3 -1: est
+19 -1: Lsun/misc/Launcher;
+109 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedExceptionAction<TT;>;Ljava/security/AccessControlContext;)TT;
+10 -1: getOffsets
+9 -1: removeAll
+23 -1: java/util/regex/Matcher
+8 -1: sumCount
+7 -1: implies
+10 -1: MAIN_CLASS
+75 -1: (Ljava/util/List<Lsun/launcher/LauncherHelper$StdArg;>;)[Ljava/lang/String;
+11 -1: getISO3Code
+4 -1: high
+53 -1: (TK;Ljava/util/function/BiFunction<-TK;-TV;+TV;>;)TV;
+17 -1: setNormalizedDate
+23 -1: AbstractRepository.java
+28 -1: java/util/LinkedList$ListItr
+8 -1: isFrozen
+38 -1: (Ljava/lang/String;Z)Ljava/lang/Class;
+16 -1: ReflectUtil.java
+30 -1: ()Ljava/util/stream/IntStream;
+57 -1: (Ljava/lang/Object;JLjava/lang/Object;)Ljava/lang/Object;
+11 -1: getResource
+16 -1: ThreadDeath.java
+24 -1: unmodifiableNavigableSet
+59 -1: (Ljava/lang/String;)Ljava/util/Enumeration<Ljava/net/URL;>;
+24 -1: java.security.auth.debug
+58 -1: (Ljava/io/FileInputStream;)Ljava/nio/channels/FileChannel;
+25 -1: ()Ljava/util/Enumeration;
+11 -1: getInstance
+6 -1: MONDAY
+15 -1: jdkMinorVersion
+16 -1: newThreadWithAcc
+6 -1: CENHOW
+32 -1: Max. Heap Size (Estimated):
+61 -1: (Ljava/lang/invoke/MethodType;Z)Ljava/lang/invoke/LambdaForm;
+11 -1: windows-932
+7 -1: Index:
+11 -1: composeList
+6 -1: utf-16
+6 -1: ibm437
+10 -1: getJarFile
+8 -1: , rem =
+13 -1: multiNewArray
+14 -1: getDefaultPort
+39 -1: Ljava/security/cert/CertificateFactory;
+10 -1: L_RESERVED
+19 -1: getMethodAtIfLoaded
+8 -1: needCast
+8 -1: IS_FIELD
+15 -1: ClassValue.java
+31 -1: ()Ljava/util/function/Supplier;
+125 -1: (Ljava/lang/Class<*>;)Ljava/util/Map<Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;Ljava/lang/annotation/Annotation;>;
+34 -1: lambda$comparingByValue$827a17d5$1
+4 -1: NONE
+21 -1: java/nio/DoubleBuffer
+33 -1: ()Lsun/reflect/LangReflectAccess;
+26 -1: invalid compression method
+6 -1: (TK;)Z
+16 -1: FT_UNCHECKED_REF
+14 -1: getGenericType
+17 -1: pathSeparatorChar
+8 -1: writeUTF
+8 -1: NO_PROXY
+188 -1: (Ljava/lang/String;Ljava/util/Map<Ljava/lang/String;Ljava/lang/String;>;Ljava/util/Map<Ljava/lang/String;Ljava/lang/String;>;Ljava/util/Map<Ljava/lang/String;Ljava/nio/charset/Charset;>;)V
+13 -1: finalRefCount
+12 -1: NF_checkCast
+6 -1: utf-32
+26 -1: (Ljava/util/ArrayDeque;I)Z
+19 -1: prefetchWriteStatic
+14 -1: computeInvoker
+5 -1: cap=
+19 -1: generateCertificate
+15 -1: methodModifiers
+3 -1: exc
+27 -1: ()Lsun/misc/JavaLangAccess;
+5 -1: State
+14 -1: NullComparator
+10 -1: getClassAt
+15 -1: printProperties
+110 -1: (Ljava/lang/Class;[Ljava/lang/Class;[Ljava/lang/Class;IILjava/lang/String;[B[B)Ljava/lang/reflect/Constructor;
+40 -1: (Ljava/util/List<*>;Ljava/util/Random;)V
+63 -1: ()[Ljava/lang/reflect/TypeVariable<Ljava/lang/reflect/Method;>;
+28 -1: (I)Ljava/lang/StringBuilder;
+48 -1: ([DIILjava/util/function/DoubleBinaryOperator;)V
+3 -1: exp
+11 -1: interpret_L
+17 -1: Serializable.java
+8 -1: FJDouble
+12 -1: HashMap.java
+9 -1: sys_paths
+17 -1: getMainAttributes
+14 -1: asDoubleBuffer
+10 -1: buildNames
+26 -1: TOPLEVEL_WINDOW_PERMISSION
+4 -1: Type
+31 -1: (Ljava/util/Collection<+TE;>;)V
+64 -1: (Ljava/lang/String;ZLjava/lang/ClassLoader;)Ljava/lang/Class<*>;
+100 -1: <E:Ljava/lang/Object;>(Ljava/util/Collection<TE;>;Ljava/lang/Class<TE;>;)Ljava/util/Collection<TE;>;
+10 -1: checkError
+31 -1: (Ljava/util/Collection<+TE;>;)Z
+31 -1: java/lang/NoSuchMethodException
+6 -1: attach
+87 -1: (BLjava/lang/Class;Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle;
+9 -1: writeChar
+44 -1: java/util/ArraysParallelSortHelpers$FJObject
+34 -1: (Ljava/lang/Class;Ljava/io/File;)Z
+21 -1: java/util/zip/ZipFile
+5 -1: dirty
+6 -1: (JIZ)V
+12 -1: leftoverChar
+39 -1: is being loaded in another classloader
+10 -1: writeBytes
+6 -1: unlink
+41 -1: (TT;Ljava/lang/ref/ReferenceQueue<TT;>;)V
+21 -1: getBootstrapResources
+95 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/AbstractMap<TK;TV;>;Ljava/io/Serializable;
+10 -1: PathStatus
+25 -1: java/io/InputStreamReader
+15 -1: ISO_8859-9:1989
+37 -1: java/lang/ExceptionInInitializerError
+14 -1: exceptionTypes
+19 -1: BufferedReader.java
+34 -1: Could not create SecurityManager:
+13 -1: definePackage
+12 -1: getAndAddInt
+50 -1: (Ljava/lang/Class;)Ljava/lang/invoke/MethodHandle;
+30 -1: (Ljava/lang/SecurityManager;)V
+12 -1: fxLaunchName
+22 -1: BINARYSEARCH_THRESHOLD
+29 -1: JVMTI_THREAD_STATE_TERMINATED
+9 -1: fullFence
+60 -1: (Ljava/lang/String;Z)Ljava/util/Enumeration<Ljava/net/URL;>;
+29 -1: java/lang/Thread$WeakClassKey
+47 -1: (Ljava/nio/charset/Charset;Ljava/lang/String;)V
+8 -1: (TV;)TV;
+60 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Object;I)V
+47 -1: java/security/cert/CertificateEncodingException
+12 -1: BA_DIRECTORY
+53 -1: (Ljava/lang/Class;ZLjava/lang/Class;)Ljava/util/List;
+9 -1: checkRead
+6 -1: <init>
+4 -1: args
+17 -1: genericMethodType
+10 -1: writeFloat
+26 -1: Can't handle static method
+49 -1: (Ljava/lang/String;)Ljava/lang/invoke/MethodType;
+22 -1: MapReduceKeysToIntTask
+17 -1: jvm_micro_version
+29 -1: (Ljava/util/Map<+TK;+TV;>;Z)V
+40 -1: ([Ljava/lang/Object;Ljava/lang/Object;)I
+7 -1: vmindex
+22 -1: maybeCompileToBytecode
+89 -1: Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater$AtomicReferenceFieldUpdaterImpl;
+11 -1: getLauncher
+17 -1: jvm_major_version
+36 -1: ([IIII)Ljava/util/Spliterator$OfInt;
+40 -1: ([Ljava/lang/Object;Ljava/lang/Object;)V
+33 -1: IllegalMonitorStateException.java
+73 -1: ([ILjava/util/function/IntUnaryOperator;)Ljava/util/function/IntConsumer;
+39 -1: (Ljava/lang/String;)Ljava/lang/Package;
+29 -1: java/lang/CharacterDataLatin1
+52 -1: (Ljava/lang/annotation/Annotation;)Ljava/lang/Class;
+49 -1: (Ljava/lang/CharSequence;II)Ljava/nio/CharBuffer;
+53 -1: (Ljava/lang/Object;)Ljava/nio/charset/CharsetDecoder;
+22 -1: Ljava/net/FileNameMap;
+16 -1: isAnonymousClass
+4 -1: item
+7 -1: compute
+12 -1: user.country
+22 -1: malformed context url:
+16 -1: jvm_build_number
+69 -1: (Ljava/lang/ThreadLocal;)Ljava/lang/ThreadLocal$ThreadLocalMap$Entry;
+17 -1: getDirectionality
+4 -1: save
+8 -1: UNMARKED
+58 -1: (Ljava/lang/String;Ljava/lang/Object;[Ljava/lang/Object;)V
+12 -1: searchFields
+9 -1: frequency
+23 -1: getLocalizedInputStream
+2 -1:
+126 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Object;ILjava/lang/Class<*>;)Ljava/util/List<Ljava/lang/invoke/MemberName;>;
+39 -1: (Ljava/lang/String;Z)Ljava/lang/String;
+7 -1: setZone
+2 -1: "
+9 -1: checkRef(
+11 -1: loadFromXML
+49 -1: (Ljava/util/jar/JarFile;Ljava/util/Enumeration;)V
+68 -1: (IILsun/util/calendar/CalendarDate;)Lsun/util/calendar/CalendarDate;
+2 -1: (
+54 -1: (Ljava/util/TimeZone;)Lsun/util/calendar/CalendarDate;
+6 -1: rewind
+13 -1: getAndSetLong
+30 -1: java/lang/invoke/MethodHandles
+11 -1: ListPattern
+97 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractList<TE;>;Ljava/util/RandomAccess;Ljava/io/Serializable;
+25 -1: (Ljava/io/InputStream;I)V
+9 -1: setMethod
+10 -1: H_REG_NAME
+39 -1: ([Ljava/lang/Object;)Ljava/lang/Object;
+16 -1: AbstractMap.java
+68 -1: Ljava/util/Hashtable<Ljava/lang/String;Ljava/net/URLStreamHandler;>;
+58 -1: (Ljava/lang/String;[Ljava/lang/String;)Ljava/lang/Process;
+23 -1: getFileSystemAttributes
+12 -1: toSurrogates
+2 -1: !/
+5 -1: empty
+24 -1: isUnicodeIdentifierStart
+35 -1: sun/nio/cs/StandardCharsets$Classes
+27 -1: [Ljava/security/Permission;
+13 -1: getDefinition
+11 -1: permission=
+42 -1: (ILjava/lang/String;)Ljava/nio/ByteBuffer;
+69 -1: (Ljava/util/List<Ljava/lang/Class<*>;>;)Ljava/lang/invoke/MethodType;
+3 1: zzz
+17 -1: hasLongPrimitives
+2 -1: !=
+13 -1: getInterfaces
+2 -1: "
+11 -1: noInflation
+14 -1: aliases_UTF_16
+2 -1: ")
+17 -1: ()Ljava/util/Map;
+55 -1: ()Ljava/util/Map<Ljava/lang/String;Ljava/lang/String;>;
+6 -1: charAt
+12 -1: getStringAt0
+10 -1: superClone
+28 -1: Ljava/util/AbstractSet<TK;>;
+40 -1: java/lang/ref/Reference$ReferenceHandler
+22 -1: NaturalOrderComparator
+9 -1: markValue
+9 -1: getRegion
+26 -1: null permissions parameter
+17 -1: Ljava/util/Stack;
+14 -1: codebase=<URL>
+36 -1: (Ljava/util/List;)Ljava/lang/Object;
+17 -1: setJavaLangAccess
+16 -1: hasQueuedThreads
+5 -1: (CC)I
+8 -1: toString
+5 -1: (CC)J
+11 -1: permissions
+10 -1: getHeaders
+27 -1: java/io/BufferedInputStream
+21 -1: unicodelittleunmarked
+51 -1: (Ljava/net/URLClassLoader;Ljava/util/Enumeration;)V
+14 -1: generateMethod
+11 -1: skipForward
+55 -1: java/util/concurrent/ConcurrentHashMap$ForEachEntryTask
+5 -1: (CC)Z
+15 -1: getURLClassPath
+84 -1: Ljava/lang/invoke/MethodType$ConcurrentWeakInternSet<Ljava/lang/invoke/MethodType;>;
+23 -1: primitiveParameterCount
+8 -1: security
+14 -1: aliases_UTF_32
+22 -1: ()Ljava/util/Set<TK;>;
+9 -1: listFiles
+15 -1: insertElementAt
+42 -1: Ljava/util/Comparator<Ljava/lang/String;>;
+11 -1: getUserInfo
+46 -1: ([JIILjava/util/function/LongBinaryOperator;)V
+23 -1: (Ljava/util/Iterator;)V
+46 -1: ([Ljava/lang/Object;II)Ljava/util/Spliterator;
+67 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Object;)Ljava/lang/Object;
+14 -1: normalizeMonth
+13 -1: getStackTrace
+51 -1: java/lang/invoke/MethodType$ConcurrentWeakInternSet
+8 -1: makeChar
+2 -1: %%
+9 -1: getTarget
+21 -1: packageDefinitionLock
+52 -1: java/util/concurrent/ConcurrentHashMap$ValueIterator
+12 -1: OTHER_NUMBER
+22 -1: java/util/jar/JarEntry
+11 -1: access$1000
+16 -1: NON_SPACING_MARK
+13 -1: last-modified
+68 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction<Ljava/lang/Void;>;
+16 -1: Australia/Darwin
+55 -1: (Ljava/lang/management/ThreadInfo;[Ljava/lang/Object;)V
+29 -1: Ljava/lang/ref/WeakReference;
+19 -1: expungeStaleEntries
+41 -1: Ljava/security/PrivilegedActionException;
+6 -1: update
+23 -1: (Ljava/lang/Object;JB)V
+10 -1: newUpdater
+39 -1: (Ljava/net/URL;)Ljava/util/jar/JarFile;
+25 -1: Ljava/net/ContentHandler;
+21 -1: ARRAY_INT_INDEX_SCALE
+13 -1: hasSurrogates
+27 -1: (Ljava/lang/ThreadGroup;Z)Z
+20 -1: createGCNotification
+21 -1: negative day of week
+11 -1: getInIfOpen
+22 -1: java/util/RandomAccess
+24 -1: available locales =
+21 -1: AccessController.java
+44 -1: can not access a protected member of class
+4 -1: LONG
+15 -1: objectOnlyTypes
+75 -1: (Ljava/io/InputStream;Ljava/lang/Object;Ljava/nio/charset/CharsetDecoder;)V
+14 -1: getFindClasses
+10 -1: storeFence
+16 -1: asNormalOriginal
+45 -1: (Ljava/lang/String;)Ljava/lang/StringBuilder;
+6 -1: millis
+16 -1: America/St_Johns
+38 -1: ()Ljava/lang/IllegalArgumentException;
+37 -1: DIRECTIONALITY_POP_DIRECTIONAL_FORMAT
+15 -1: implReplaceWith
+29 -1: ([C)Ljava/lang/StringBuilder;
+15 -1: Appendable.java
+41 -1: (Ljava/lang/String;)Ljava/io/InputStream;
+26 -1: Illegal Initial Capacity:
+9 -1: checkBase
+7 -1: setYear
+15 -1: DISPLAY_VARIANT
+7 -1: getType
+31 -1: Ljava/lang/ref/Reference<+TT;>;
+15 -1: isFieldOrMethod
+35 -1: appendToClassPathForInstrumentation
+16 -1: LocaleNameGetter
+7 -1: compact
+55 -1: ()Ljava/util/Map<Ljava/lang/String;Ljava/lang/Object;>;
+10 -1: dummyQueue
+3 -1: ROC
+2 -1: ("
+15 -1: checkPermission
+38 -1: java/util/zip/ZipFile$ZipEntryIterator
+8 -1: hexDigit
+8 -1: pairs:
+2 -1: ()
+2 -1: )\n
+43 -1: handler for url different from this handler
+15 -1: isAutoDetecting
+37 -1: (Ljava/util/LinkedList$Node<TE;>;)TE;
+11 -1: Unsafe.java
+12 -1: windows-1250
+39 -1: java/util/Collections$CheckedCollection
+12 -1: windows-1251
+15 -1: codePointAtImpl
+12 -1: windows-1252
+12 -1: windows-1253
+12 -1: windows-1254
+58 -1: (Ljava/lang/String;Ljava/lang/Integer;)Ljava/lang/Integer;
+5 -1: deref
+12 -1: windows-1255
+12 -1: windows-1256
+12 -1: windows-1257
+12 -1: windows-1258
+14 -1: FT_CHECKED_REF
+47 -1: (Ljava/util/Hashtable;Ljava/util/Hashtable$1;)V
+37 -1: (J)Lsun/util/calendar/Gregorian$Date;
+19 -1: checkPropertyAccess
+4 -1: file
+17 -1: emptyListIterator
+26 -1: sun/util/calendar/ZoneInfo
+14 -1: file.separator
+4 -1: fill
+62 -1: (Ljava/util/Spliterator$OfLong;Z)Ljava/util/stream/LongStream;
+18 -1: java/util/Iterator
+20 -1: reduceValuesToDouble
+12 -1: LF_CS_LINKER
+26 -1: java/util/Arrays$ArrayList
+45 -1: Ljava/util/concurrent/ConcurrentHashMap$Node;
+6 -1: skipLF
+2 -1: )=
+39 -1: (I[Ljava/lang/invoke/LambdaForm$Name;)I
+90 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;)V
+18 -1: parameterModifiers
+31 -1: (Ljava/util/Collection<+TK;>;)Z
+21 -1: proxy can not be null
+22 -1: java/io/FileDescriptor
+6 -1: Loader
+21 -1: numberOfTrailingZeros
+10 -1: addMapping
+39 -1: (I[Ljava/lang/invoke/LambdaForm$Name;)Z
+30 -1: java/util/Locale$LanguageRange
+20 -1: getReflectionFactory
+16 -1: shouldMeterInput
+56 -1: ([Ljava/lang/reflect/Method;)[Ljava/lang/reflect/Method;
+23 -1: sun/net/ProgressMonitor
+510 -1: \xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\x01\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\x01\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80\xc0\x80
+28 -1: java/util/Spliterator$OfLong
+24 -1: SynchronizedNavigableMap
+4 -1: find
+6 -1: unsafe
+31 -1: java/nio/ByteBufferAsIntBufferB
+2 -1: ,\n
+6 -1: [ call
+14 -1: registerFilter
+10 -1: ValuesView
+9 -1: untreeify
+59 -1: ([Ljava/lang/Object;IILjava/util/function/BinaryOperator;)V
+13 -1: getSimpleName
+41 -1: (Ljava/util/Vector;Ljava/util/Vector$1;)V
+31 -1: java/nio/ByteBufferAsIntBufferL
+45 -1: (Ljava/lang/reflect/Field;)Ljava/lang/Object;
+13 -1: getDefaultRef
+18 -1: mapAlternativeName
+30 -1: setDefaultAllowUserInteraction
+13 -1: cannotCastMsg
+4 -1: )=>{
+7 -1: println
+2 -1: ,
+70 -1: (Ljava/nio/Buffer;IILjava/nio/Buffer;II)Ljava/nio/charset/CoderResult;
+32 -1: (ILjava/util/Collection<+TE;>;)Z
+9 -1: interpret
+104 -1: <E:Ljava/lang/Object;>(Ljava/util/NavigableSet<TE;>;Ljava/lang/Class<TE;>;)Ljava/util/NavigableSet<TE;>;
+7 -1: advance
+86 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction<Ljava/lang/reflect/Field;>;
+11 -1: Stack trace
+6 -1: raise0
+68 -1: ()Ljava/util/Collections$UnmodifiableNavigableMap$EmptyNavigableMap;
+32 -1: sun/util/calendar/Gregorian$Date
+33 -1: java/lang/ref/ReferenceQueue$Lock
+19 -1: constructorAccessor
+6 -1: IBM367
+18 -1: CharacterData.java
+8 -1: parseURL
+32 -1: java/io/FilePermissionCollection
+7 -1: ([JI)[J
+9 -1: JIS_X0201
+2 -1: -1
+8 -1: encoding
+63 -1: ([Ljava/util/WeakHashMap$Entry;[Ljava/util/WeakHashMap$Entry;)V
+9 -1: localhost
+66 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;Ljava/lang/ThreadLocal$1;)V
+54 -1: (II[Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
+67 -1: (Ljava/lang/Class;Ljava/lang/Class;)Ljava/lang/invoke/MethodHandle;
+14 -1: containsAllPDs
+23 -1: setAllowUserInteraction
+30 -1: Ljava/security/DomainCombiner;
+26 -1: Ljava/security/Permission;
+30 -1: serializePropertiesToByteArray
+112 -1: (Ljava/util/Iterator<Ljava/nio/charset/Charset;>;Ljava/util/Map<Ljava/lang/String;Ljava/nio/charset/Charset;>;)V
+2 -1: ..
+6 -1: LOCEXT
+2 -1: ./
+26 -1: (Ljava/nio/ByteBuffer;II)V
+18 -1: (Ljava/io/File;J)Z
+45 -1: (Ljava/lang/StringBuffer;Ljava/lang/String;)V
+17 -1: asCollectorChecks
+7 -1: actions
+5 -1: ([I)I
+20 -1: asChange_otherthread
+20 -1: forInputStreamReader
+69 -1: java/util/concurrent/locks/AbstractQueuedSynchronizer$ConditionObject
+5 -1: FINAL
+17 -1: staticPermissions
+44 -1: (Ljava/lang/Object;)Ljava/lang/StringBuffer;
+5 -1: ([I)V
+4 -1: swap
+10 -1: readOffset
+2 -1: /*
+112 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<-TK;+TU;>;Ljava/util/function/BiFunction<-TU;-TU;+TU;>;)TU;
+12 -1: isAsciiDigit
+2 -1: /-
+2 -1: /.
+2 -1: //
+5 -1: zones
+37 -1: (ILjava/lang/Object;)Ljava/util/List;
+17 -1: SHUFFLE_THRESHOLD
+32 -1: java/lang/CharacterDataUndefined
+23 -1: sun.reflect.noInflation
+11 -1: Can not set
+36 -1: (Ljava/util/Properties$LineReader;)V
+9 -1: debugName
+78 -1: (Ljava/util/HashMap$Node;Ljava/util/HashMap$Node;)Ljava/util/HashMap$TreeNode;
+6 -1: (III)J
+58 -1: (Ljava/util/List;Ljava/util/Collection;)Ljava/lang/String;
+19 -1: BufferedWriter.java
+148 -1: <T:Ljava/lang/Object;>(Ljava/lang/Class<TT;>;[Ljava/lang/Class<*>;[Ljava/lang/Class<*>;IILjava/lang/String;[B[B)Ljava/lang/reflect/Constructor<TT;>;
+6 -1: printf
+7 -1: signers
+2 -1: 0.
+4 -1: Date
+15 -1: findReplacement
+6 -1: (III)V
+32 -1: java/nio/ReadOnlyBufferException
+92 -1: ([Ljava/lang/String;)Ljava/util/Map<Ljava/lang/String;Ljava/util/List<Ljava/lang/String;>;>;
+6 -1: (III)Z
+43 -1: (Ljava/lang/ClassValue;Ljava/lang/Object;)V
+32 -1: java/nio/ByteBufferAsLongBufferB
+16 -1: Constructor.java
+10 -1: removeLast
+9 -1: ([CII[B)I
+40 -1: ()Ljava/util/List<Ljava/lang/Class<*>;>;
+2 -1: 1.
+7 -1: VARARGS
+32 -1: java/nio/ByteBufferAsLongBufferL
+18 -1: java/lang/Shutdown
+40 -1: not supported, using ISO-8859-1 instead
+40 -1: Ljava/util/Collections$EmptyEnumeration;
+146 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/SortedMap<TK;TV;>;Ljava/lang/Class<TK;>;Ljava/lang/Class<TV;>;)Ljava/util/SortedMap<TK;TV;>;
+20 -1: aliases_UTF_32LE_BOM
+23 -1: getEnclosingConstructor
+2 -1: 0X
+11 -1: NO_TIMEZONE
+37 -1: ()Lsun/misc/JavaNioAccess$BufferPool;
+18 -1: printXUsageMessage
+9 -1: isPrivate
+63 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/invoke/MethodHandle;)V
+17 -1: maxSkipBufferSize
+76 -1: (Ljava/io/OutputStream;Ljava/lang/Object;Ljava/nio/charset/CharsetEncoder;)V
+40 -1: (Ljava/lang/String;II)Ljava/lang/String;
+17 -1: selectAlternative
+53 -1: [Ljava/util/concurrent/ConcurrentHashMap$CounterCell;
+87 -1: <S:Ljava/lang/Object;>(Ljava/util/function/Supplier<+TS;>;)Ljava/lang/ThreadLocal<TS;>;
+40 -1: Ljava/util/concurrent/ConcurrentHashMap;
+41 -1: (Ljava/lang/Character;)Ljava/lang/String;
+19 -1: getMemberRefInfoAt0
+14 -1: reduceToDouble
+18 -1: SUPPRESSED_CAPTION
+6 -1: CANADA
+64 -1: (IZ[Ljava/lang/Class<*>;[Ljava/lang/Class<*>;)Ljava/lang/String;
+12 -1: UnicodeBlock
+2 -1: 0x
+44 -1: (Ljava/lang/CharSequence;II)Ljava/io/Writer;
+23 -1: getPermissionCollection
+19 -1: threadLocalHashCode
+9 -1: createMap
+25 -1: checkForSpecialAttributes
+12 -1: Mark invalid
+36 -1: java/lang/CharSequence$1CharIterator
+11 -1: local time
+16 -1: Enumeration.java
+27 -1: (Ljava/util/zip/ZipEntry;)V
+11 -1: MATH_SYMBOL
+8 -1: filename
+24 -1: (Ljava/util/List<*>;II)V
+9 -1: bindCache
+18 -1: java/io/FileFilter
+12 -1: checkInvoker
+18 -1: OSEnvironment.java
+8 -1: EmptyMap
+11 -1: getIterator
+35 -1: java/util/function/IntUnaryOperator
+35 -1: java/util/WeakHashMap$EntryIterator
+90 -1: <E:Ljava/lang/Object;>(Ljava/util/Queue<TE;>;Ljava/lang/Class<TE;>;)Ljava/util/Queue<TE;>;
+8 -1: batchFor
+16 -1: isValidCodePoint
+27 -1: ([Lsun/util/calendar/Era;)V
+16 -1: ThreadGroup.java
+33 2: sun/net/www/protocol/file/Handler
+7 -1: isField
+22 -1: sun/misc/OSEnvironment
+38 -1: Ljava/lang/Class<Ljava/lang/Boolean;>;
+12 -1: ADDRESS_SIZE
+8 -1: forDigit
+49 -1: (Ljava/lang/Object;)Ljava/util/WeakHashMap$Entry;
+13 -1: getCodeSource
+41 -1: ([Ljava/lang/Class<*>;)Ljava/lang/String;
+39 -1: (Ljava/util/function/Predicate<-TE;>;)Z
+13 -1: asFloatBuffer
+34 -1: ()Lsun/reflect/generics/tree/Tree;
+3 -1: ftp
+18 -1: maybeReBoxElements
+82 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/Class;)[[Ljava/lang/annotation/Annotation;
+48 -1: ()Ljava/util/Set<Ljava/util/Map$Entry<TK;TV;>;>;
+27 -1: (Ljava/util/NavigableMap;)V
+18 -1: parameterSlotCount
+20 -1: NF_getCallSiteTarget
+16 -1: aliases_US_ASCII
+13 -1: NF_staticBase
+31 -1: sun/reflect/ConstructorAccessor
+26 -1: guessContentTypeFromStream
+10 -1: Deprecated
+35 -1: System initialization has completed
+11 -1: initialized
+7 -1: compare
+15 -1: maxDirectMemory
+19 -1: setLastModifiedTime
+7 -1: (J[BZ)J
+12 -1: readEpochSec
+66 -1: (Ljava/lang/String;Ljava/lang/String;)Lsun/util/locale/BaseLocale;
+69 -1: ()Lsun/misc/JavaSecurityProtectionDomainAccess$ProtectionDomainCache;
+9 -1: Constants
+11 -1: valueOffset
+62 -1: (Ljava/util/Hashtable<Ljava/lang/String;Ljava/lang/Object;>;)V
+33 -1: java/lang/CharacterDataPrivateUse
+21 -1: Exception in thread "
+40 -1: ()Ljava/util/Set<Ljava/lang/Character;>;
+12 -1: Asia/Yerevan
+40 -1: (Ljava/lang/Throwable;)Ljava/lang/Error;
+25 -1: (IS)Ljava/nio/ByteBuffer;
+7 -1: (I[CI)I
+45 -1: java/nio/charset/UnmappableCharacterException
+23 -1: java/util/WeakHashMap$1
+21 -1: setFXLaunchParameters
+1250 -1: ADANDAEAREAFAFGAGATGAIAIAALALBAMARMANANTAOAGOAQATAARARGASASMATAUTAUAUSAWABWAXALAAZAZEBABIHBBBRBBDBGDBEBELBFBFABGBGRBHBHRBIBDIBJBENBLBLMBMBMUBNBRNBOBOLBQBESBRBRABSBHSBTBTNBVBVTBWBWABYBLRBZBLZCACANCCCCKCDCODCFCAFCGCOGCHCHECICIVCKCOKCLCHLCMCMRCNCHNCOCOLCRCRICUCUBCVCPVCWCUWCXCXRCYCYPCZCZEDEDEUDJDJIDKDNKDMDMADODOMDZDZAECECUEEESTEGEGYEHESHERERIESESPETETHFIFINFJFJIFKFLKFMFSMFOFROFRFRAGAGABGBGBRGDGRDGEGEOGFGUFGGGGYGHGHAGIGIBGLGRLGMGMBGNGINGPGLPGQGNQGRGRCGSSGSGTGTMGUGUMGWGNBGYGUYHKHKGHMHMDHNHNDHRHRVHTHTIHUHUNIDIDNIEIRLILISRIMIMNININDIOIOTIQIRQIRIRNISISLITITAJEJEYJMJAMJOJORJPJPNKEKENKGKGZKHKHMKIKIRKMCOMKNKNAKPPRKKRKORKWKWTKYCYMKZKAZLALAOLBLBNLCLCALILIELKLKALRLBRLSLSOLTLTULULUXLVLVALYLBYMAMARMCMCOMDMDAMEMNEMFMAFMGMDGMHMHLMKMKDMLMLIMMMMRMNMNGMOMACMPMNPMQMTQMRMRTMSMSRMTMLTMUMUSMVMDVMWMWIMXMEXMYMYSMZMOZNANAMNCNCLNENERNFNFKNGNGANINICNLNLDNONORNPNPLNRNRUNUNIUNZNZLOMOMNPAPANPEPERPFPYFPGPNGPHPHLPKPAKPLPOLPMSPMPNPCNPRPRIPSPSEPTPRTPWPLWPYPRYQAQATREREUROROURSSRBRURUSRWRWASASAUSBSLBSCSYCSDSDNSESWESGSGPSHSHNSISVNSJSJMSKSVKSLSLESMSMRSNSENSOSOMSRSURSSSSDSTSTPSVSLVSXSXMSYSYRSZSWZTCTCATDTCDTFATFTGTGOTHTHATJTJKTKTKLTLTLSTMTKMTNTUNTOTONTRTURTTTTOTVTUVTWTWNTZTZAUAUKRUGUGAUMUMIUSUSAUYURYUZUZBVAVATVCVCTVEVENVGVGBVIVIRVNVNMVUVUTWFWLFWSWSMYEYEMYTMYTZAZAFZMZMBZWZWE
+60 -1: Ljava/util/Set<Ljava/lang/Class<+Ljava/lang/ClassLoader;>;>;
+24 -1: ()Ljava/security/Policy;
+7 -1: initted
+44 -1: java/util/Collections$UnmodifiableCollection
+12 -1: Pacific/Apia
+23 -1: checkProxyPackageAccess
+7 -1: (I[CI)V
+64 -1: ([Ljava/lang/Object;IILjava/lang/Object;Ljava/util/Comparator;)I
+16 -1: getJavaNioAccess
+7 -1: reverse
+7 -1: nocerts
+16 -1: activeGroupCount
+34 -1: java/util/jar/JarFile$JarFileEntry
+7 -1: loaders
+9 -1: toRadians
+24 -1: java/util/HashMap$KeySet
+37 -1: (Ljava/lang/Class;)Ljava/lang/Object;
+6 -1: getRef
+6 -1: H_DASH
+17 -1: LinkageError.java
+66 -1: (Ljava/lang/invoke/MethodTypeForm;)Ljava/lang/invoke/MethodHandle;
+41 -1: (Ljava/nio/ByteBuffer;)Ljava/util/BitSet;
+10 -1: addMinutes
+58 -1: <T:Ljava/lang/Object;>([TT;II)Ljava/util/Spliterator<TT;>;
+9 -1: parseJars
+13 -1: getUnsignedCS
+28 -1: (Ljava/util/AbstractList;I)V
+22 -1: threadLocalRandomProbe
+19 -1: newDirectByteBuffer
+27 -1: Filter already registered:
+8 -1: unescape
+31 -1: sun/misc/URLClassPath$JarLoader
+6 -1: TAIWAN
+53 -1: <T:Ljava/lang/Object;>()Ljava/util/ListIterator<TT;>;
+17 -1: REVERSE_THRESHOLD
+31 -1: Java(TM) SE Runtime Environment
+7 -1: SECONDS
+70 -1: (Ljava/util/function/ToLongFunction<-TT;>;)Ljava/util/Comparator<TT;>;
+7 -1: BLOCKED
+6 -1: Caches
+63 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MethodHandle;)V
+2 -1: :
+210 -1: (Ljava/util/Map<Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;Ljava/lang/annotation/Annotation;>;Ljava/util/Map<Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;Ljava/lang/annotation/Annotation;>;I)V
+153 -1: (JLjava/util/function/BiFunction<Ljava/util/Map$Entry<TK;TV;>;Ljava/util/Map$Entry<TK;TV;>;+Ljava/util/Map$Entry<TK;TV;>;>;)Ljava/util/Map$Entry<TK;TV;>;
+22 -1: ()Ljava/lang/Class<*>;
+28 -1: Ljava/lang/OutOfMemoryError;
+19 -1: writeFileDescriptor
+39 -1: Ljava/util/LinkedHashMap$Entry<TK;TV;>;
+26 -1: (ILjava/util/Collection;)Z
+18 -1: getEncodedInternal
+16 -1: ForEachValueTask
+23 -1: (Ljava/util/List<*>;I)V
+19 -1: SharedArchiveLoader
+20 -1: probeBackupLocations
+24 -1: java/lang/StringCoding$1
+28 -1: lookupContentHandlerClassFor
+36 -1: ()Lsun/misc/Launcher$ExtClassLoader;
+27 -1: reflectionFactoryAccessPerm
+14 -1: ACCESSOR_FORMS
+35 -1: ([JII)Ljava/util/stream/LongStream;
+34 -1: ISO-8859-1 charset not available:
+8 -1: cscesu-8
+2 -1: ;/
+17 -1: typeToPackageName
+34 -1: (Ljava/net/URL;)Ljava/lang/String;
+5 -1: (IZ)V
+25 -1: Prohibited package name:
+51 -1: (Ljava/lang/Object;Ljava/lang/ref/ReferenceQueue;)V
+108 -1: (JLjava/util/function/ToIntFunction<Ljava/util/Map$Entry<TK;TV;>;>;ILjava/util/function/IntBinaryOperator;)I
+12 -1: soleInstance
+27 -1: (Ljava/io/BufferedReader;)V
+71 -1: (Ljava/nio/charset/CodingErrorAction;)Ljava/nio/charset/CharsetDecoder;
+17 -1: Ljava/lang/Class;
+38 -1: (Ljava/lang/String;)Ljava/lang/Double;
+10 -1: viewAsType
+22 -1: (Ljava/io/DataInput;)I
+22 -1: (Ljava/io/DataInput;)J
+105 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/WrongMethodTypeException;
+16 -1: setJavaNetAccess
+73 -1: (ILjava/lang/Object;Ljava/lang/Object;ZZ)Ljava/util/HashMap$Node<TK;TV;>;
+22 -1: (Ljava/io/DataInput;)V
+14 -1: getHostAddress
+37 -1: sun/reflect/annotation/TypeAnnotation
+14 -1: ENCLOSING_MARK
+5 -1: FALSE
+14 -1: preDefineClass
+9 -1: newKeySet
+18 -1: getWaitQueueLength
+32 -1: ()Lsun/misc/URLClassPath$Loader;
+54 -1: (Ljava/nio/CharBuffer;I)Ljava/nio/charset/CoderResult;
+3 -1: SEP
+45 -1: (ITK;TV;Ljava/util/Hashtable$Entry<TK;TV;>;)V
+17 -1: getDeclaredFields
+7 -1: getDate
+10 -1: getClasses
+240 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceEntriesToIntTask;Ljava/util/function/ToIntFunction;ILjava/util/function/IntBinaryOperator;)V
+12 -1: WeakClassKey
+14 -1: LF_GEN_INVOKER
+25 -1: Ljava/lang/StringBuilder;
+2 -1: >
+9 -1: getJarMap
+4 -1: asin
+37 -1: (Ljava/net/URLStreamHandlerFactory;)V
+30 -1: not a constructor type or name
+4 -1: main
+22 -1: java/io/FilenameFilter
+22 -1: sun.java.launcher.diag
+30 -1: ()Ljava/util/Spliterator<TE;>;
+57 -1: <T::Ljava/lang/Comparable<-TT;>;>(Ljava/util/List<TT;>;)V
+86 -1: <T:Ljava/lang/Object;>(Ljava/lang/ThreadLocal<Ljava/lang/ref/SoftReference<TT;>;>;)TT;
+18 -1: canBeCalledVirtual
+9 -1: Shift_JIS
+24 -1: ()Ljava/util/ArrayDeque;
+32 -1: (Ljava/lang/Class$MethodArray;)V
+22 -1: java/lang/StringCoding
+33 -1: sun/util/locale/LocaleObjectCache
+20 -1: Sorry, deque too big
+38 -1: java/lang/Throwable$WrappedPrintWriter
+25 -1: (Ljava/io/InputStream;J)J
+44 -1: (Ljava/security/Permission;)Ljava/util/List;
+5 -1: thunk
+5 -1: props
+15 -1: getLastModified
+120 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/util/HashMap<Ljava/lang/String;Ljava/util/LinkedList<Ljava/lang/String;>;>;)V
+146 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MemberName;Ljava/lang/Class;Ljava/lang/invoke/MethodHandleImpl$1;)V
+27 -1: parseExtensionsDependencies
+10 -1: getRawType
+39 -1: (Ljava/nio/charset/CodingErrorAction;)V
+22 -1: ObjectStreamField.java
+6 -1: handle
+11 -1: hasPrevious
+18 -1: instanceof Float:
+52 -1: (ZLjava/io/OutputStream;Ljava/nio/charset/Charset;)V
+4 -1: make
+13 -1: isIdeographic
+26 -1: java/util/HashMap$EntrySet
+51 -1: (Ljava/util/Hashtable;)[Ljava/util/Hashtable$Entry;
+91 -1: (Ljava/lang/CharSequence;Ljava/lang/Iterable<+Ljava/lang/CharSequence;>;)Ljava/lang/String;
+13 -1: makeAllocator
+10 -1: , headless
+20 -1: expungeStaleElements
+58 -1: sun/reflect/annotation/TypeAnnotation$TypeAnnotationTarget
+41 -1: ([Ljava/lang/Object;Ljava/lang/Class$1;)V
+50 -1: <T:Ljava/lang/Object;>(I)Ljava/util/Iterator<TT;>;
+7 -1: TreeBin
+21 -1: Ljava/io/IOException;
+56 -1: (I[Ljava/lang/Class;)[Ljava/lang/invoke/LambdaForm$Name;
+6 -1: LOCFLG
+6 -1: DIRECT
+3 -1: SIG
+37 -1: java/security/NoSuchProviderException
+39 -1: " with illegal data type conversion to
+16 -1: getCodeSourceURL
+51 -1: java/util/concurrent/ConcurrentHashMap$EntrySetView
+47 -1: (Ljava/util/ArrayList;Ljava/util/ArrayList$1;)V
+6 -1: delete
+38 -1: sun/reflect/UnsafeFieldAccessorFactory
+11 -1: isDestroyed
+140 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;ILjava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$Node;)Z
+9 -1: unaligned
+36 -1: ()Lsun/misc/Launcher$AppClassLoader;
+57 -1: (Ljava/lang/String;Ljava/util/Locale;)[Ljava/lang/String;
+37 -1: sun/reflect/annotation/AnnotationType
+49 -1: <T:Ljava/lang/Object;>([TT;)Ljava/util/List<TT;>;
+24 -1: (S)Ljava/nio/ByteBuffer;
+6 -1: ([DD)I
+9 -1: setTarget
+29 -1: (IF)Ljava/lang/StringBuilder;
+12 -1: forBasicType
+10 -1: (IIII[BI)V
+8 -1: ([DIID)I
+9 -1: BASE_YEAR
+19 -1: ()Ljava/lang/Error;
+42 -1: (Ljava/util/Map<TE;Ljava/lang/Boolean;>;)V
+6 -1: ([DD)V
+14 -1: Illegal size:
+8 -1: ([DIID)V
+7 -1: (II[I)I
+17 -1: java_profile_name
+28 -1: java/util/AbstractCollection
+43 -1: (Ljava/net/URL;)[Ljava/security/CodeSource;
+62 -1: (Lsun/misc/URLClassPath$JarLoader;)Ljava/net/URLStreamHandler;
+33 -1: [Ljava/util/HashMap$Node<TK;TV;>;
+15 -1: (Native Method)
+11 -1: fileNameMap
+26 -1: ()Ljava/util/ListIterator;
+25 -1: java/util/LinkedList$Node
+18 -1: SELECT_ALTERNATIVE
+35 -1: (Ljava/lang/Object;)Ljava/util/Set;
+19 -1: java/io/IOException
+16 -1: : already loaded
+9 -1: image/gif
+6 -1: (TE;)I
+25 -1: (Ljava/util/Properties;)V
+40 -1: (Ljava/lang/String;)Ljava/nio/file/Path;
+19 -1: checkedNavigableMap
+9 -1: checkInt(
+17 -1: getContentTypeFor
+26 -1: ()Ljava/io/FileDescriptor;
+69 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/ref/ReferenceQueue;)V
+6 -1: (TE;)V
+25 -1: WARNING: Default charset
+14 -1: ZipFile closed
+2 -1: CA
+6 -1: (TE;)Z
+64 -1: java/util/concurrent/ConcurrentHashMap$MapReduceValuesToLongTask
+15 -1: FileSystem.java
+75 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)V
+10 -1: FileLoader
+44 -1: (Lsun/util/PreHashedMap;)[Ljava/lang/Object;
+19 -1: availableProcessors
+2 -1: CN
+36 -1: ([JII)Ljava/util/Spliterator$OfLong;
+11 -1: access$1100
+18 -1: getFieldAtIfLoaded
+30 -1: PrivilegedActionException.java
+6 -1: EUC-JP
+20 -1: (F)Ljava/lang/Float;
+22 -1: unable to instantiate
+31 -1: java/lang/reflect/ReflectAccess
+23 -1: (Ljava/lang/Object;JC)V
+3 -1: get
+59 -1: <T:Ljava/lang/Object;>([TT;IILjava/util/Comparator<-TT;>;)V
+2 -1: DE
+13 -1: GMT_ID_LENGTH
+7 -1: execute
+12 -1: MethodHandle
+18 -1: AllPermission.java
+54 -1: (Ljava/util/Locale;)Lsun/util/locale/LocaleExtensions;
+23 -1: MapReduceKeysToLongTask
+12 -1: varargsArray
+23 -1: java/util/jar/JarFile$1
+23 -1: java/util/jar/JarFile$2
+23 -1: java/util/jar/JarFile$3
+12 -1: getAndUpdate
+13 -1: reserveMemory
+17 -1: expungeStaleEntry
+6 -1: EUC-KR
+120 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/lang/ref/WeakReference<Ljava/lang/Object;>;Ljava/util/Map$Entry<TK;TV;>;
+69 -1: (Ljava/lang/StringBuffer;Ljava/lang/String;)Ljava/util/regex/Matcher;
+26 -1: ()Ljava/util/NavigableMap;
+7 -1: L_PCHAR
+23 -1: (Ljava/lang/String$1;)V
+4 -1: KEYS
+37 -1: (Ljava/util/List;Ljava/lang/Object;)I
+31 -1: Ljava/lang/ArithmeticException;
+15 -1: [Ljava/net/URL;
+37 -1: (Ljava/util/List;Ljava/lang/Object;)V
+18 -1: MAX_HIGH_SURROGATE
+6 -1: (JCZ)V
+4 -1: mark
+17 -1: setMethodAccessor
+21 -1: java/io/ExpiringCache
+21 -1: PrivilegedAction.java
+21 -1: MappedByteBuffer.java
+2 -1: FR
+10 -1: copyMemory
+8 -1: L_SERVER
+13 -1: assertionLock
+12 -1: searchValues
+46 -1: (Ljava/util/Collection<*>;Ljava/lang/Object;)I
+21 -1: ProtectionDomainCache
+32 -1: USE_PREDEFINED_INTERPRET_METHODS
+2 -1: GB
+16 -1: getFinalRefCount
+23 -1: Ljava/lang/ClassLoader;
+4 -1: mask
+94 -1: <T:Ljava/lang/Object;>(Ljava/util/function/ToDoubleFunction<-TT;>;)Ljava/util/Comparator<TT;>;
+4 -1: bind
+41 -1: (Ljava/lang/Class<*>;I)Ljava/lang/Object;
+9 -1: COUNT_GWT
+16 -1: DASH_PUNCTUATION
+24 -1: UNICODE_LOCALE_EXTENSION
+15 -1: checkInvariants
+10 -1: stringSize
+12 -1: deepHashCode
+30 -1: java/security/cert/Certificate
+19 -1: America/Los_Angeles
+19 -1: unmappableForLength
+6 -1: UTF-16
+10 -1: methodType
+21 -1: sun/misc/URLClassPath
+19 -1: META-INF/INDEX.LIST
+10 -1: jniVersion
+6 -1: IBM437
+29 -1: sun/reflect/FieldAccessorImpl
+21 -1: ()Ljava/lang/Package;
+32 -1: java/security/SecurityPermission
+57 -1: (Lsun/util/calendar/Era;)Lsun/util/calendar/CalendarDate;
+34 -1: [Ljava/util/concurrent/locks/Lock;
+11 -1: replacement
+20 -1: ()Ljava/lang/String;
+6 -1: resize
+12 -1: UTF_32BE_BOM
+26 -1: (Ljava/util/jar/JarFile;)V
+24 -1: DEFAULT_INITIAL_CAPACITY
+87 -1: (ILjava/lang/Object;Ljava/lang/Class;)Ljava/util/concurrent/ConcurrentHashMap$TreeNode;
+74 -1: (Ljava/util/jar/JarFile;)Ljava/util/Enumeration<Ljava/util/jar/JarEntry;>;
+18 -1: parameterSlotDepth
+26 -1: (Ljava/util/jar/JarFile;)Z
+18 -1: makePlatformString
+24 -1: doPrivilegedWithCombiner
+48 -1: (Ljava/lang/String;)Lsun/util/calendar/ZoneInfo;
+27 -1: ()Ljava/lang/ref/Reference;
+40 -1: java/util/ArrayList$ArrayListSpliterator
+67 -1: ([Ljava/lang/Object;IILjava/util/Comparator;[Ljava/lang/Object;II)V
+2 -1: ID
+19 -1: stringPropertyNames
+28 -1: (Ljava/util/Collections$1;)V
+12 -1: STATE_YELLOW
+12 -1: isNormalized
+10 -1: fromIndex(
+16 -1: getFloatVolatile
+37 -1: Lsun/util/calendar/BaseCalendar$Date;
+10 -1: properties
+17 -1: peakFinalRefCount
+102 -1: (Ljava/util/HashMap$Node<TK;TV;>;Ljava/util/HashMap$Node<TK;TV;>;)Ljava/util/HashMap$TreeNode<TK;TV;>;
+68 -1: (Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/DirectMethodHandle;
+2 -1: IT
+9 -1: ([BI[BI)V
+51 -1: scl permissions SecureClassLoader assigns
+36 -1: (Ljava/util/Set;Ljava/lang/Object;)V
+11 -1: ([SII[SII)V
+21 -1: sun.io.useCanonCaches
+18 -1: Illegal capacity:
+22 -1: (Ljava/lang/Integer;)I
+83 -1: ([Ljava/lang/Object;Ljava/lang/StringBuilder;Ljava/util/Set<[Ljava/lang/Object;>;)V
+65 -1: (Ljava/util/HashMap<TK;TV;>;[Ljava/util/HashMap$Node<TK;TV;>;II)V
+17 -1: java/util/Objects
+48 -1: (ILjava/util/List;)Ljava/lang/invoke/LambdaForm;
+31 -1: java/util/Properties$XmlSupport
+10 -1: L_LOWALPHA
+13 -1: long overflow
+25 -1: NullPointerException.java
+32 -1: (I)Ljava/lang/StackTraceElement;
+34 -1: ()[Ljava/lang/reflect/Constructor;
+2 -1: JP
+3 -1: SST
+12 -1: ShortCountry
+48 -1: (Ljava/util/stream/Collector;)Ljava/lang/Object;
+29 -1: Lsun/reflect/CallerSensitive;
+10 -1: addElement
+12 -1: lastReturned
+6 -1: putInt
+34 -1: sun.misc.JarIndex.metaInfFilenames
+13 -1: getBaseLocale
+20 -1: StringTokenizer.java
+8 -1: entrySet
+11 -1: getTypeName
+17 -1: America/Sao_Paulo
+5 -1: \t...
+35 -1: (Lsun/util/calendar/CalendarDate;)I
+28 -1: java/lang/StackOverflowError
+35 -1: (Lsun/util/calendar/CalendarDate;)J
+10 -1: logicalAnd
+18 -1: csISOLatinCyrillic
+43 -1: (Ljava/lang/String;II)Ljava/nio/CharBuffer;
+73 -1: (Ljava/lang/Class<*>;[Ljava/lang/Class<*>;Z)Ljava/lang/invoke/MethodType;
+14 -1: aliases_MS1250
+14 -1: aliases_MS1251
+17 -1: getImplMethodKind
+17 -1: getLastAccessTime
+14 -1: aliases_MS1252
+14 -1: aliases_MS1253
+35 -1: (Lsun/util/calendar/CalendarDate;)V
+2 -1: KR
+14 -1: aliases_MS1254
+14 -1: getGenericInfo
+8 -1: utf_32be
+14 -1: aliases_MS1257
+35 -1: (Lsun/util/calendar/CalendarDate;)Z
+13 -1: StringEncoder
+7 -1: LDT2037
+7 -1: generic
+2 -1: L9
+45 -1: ([DLjava/util/function/IntToDoubleFunction;)V
+17 -1: isOtherAlphabetic
+9 -1: implWrite
+24 -1: PC-Multilingual-850+euro
+12 -1: valueMatches
+78 -1: (Ljava/lang/String;Lsun/util/locale/ParseStatus;)Lsun/util/locale/LanguageTag;
+3 -1: gmt
+19 -1: (Ljava/io/Reader;)V
+25 -1: (JJ)Ljava/nio/ByteBuffer;
+7 -1: val$url
+26 -1: (Ljava/nio/ByteBuffer;IJ)V
+10 -1: isImplicit
+19 -1: getDeclaredClasses0
+4 -1: (I)B
+4 -1: (I)C
+4 -1: (I)D
+9 -1: byteValue
+4 -1: (I)F
+5 -1: ([J)I
+6 -1: isLive
+5 -1: sleep
+4 -1: (I)I
+4 -1: (I)J
+6 -1: outBuf
+77 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractCollection<TE;>;Ljava/util/Set<TE;>;
+4 -1: (I)S
+5 -1: ([J)V
+4 -1: (I)V
+30 -1: (I[C)Ljava/lang/StringBuilder;
+14 -1: intBitsToFloat
+4 -1: (I)Z
+15 -1: MethodType.java
+14 -1: resolveSibling
+9 -1: Enum.java
+111 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;[Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;)V
+14 -1: IS_CONSTRUCTOR
+4 -1: bits
+34 -1: java/security/PermissionCollection
+9 -1: autoFlush
+21 -1: java/util/Collections
+12 -1: bindReceiver
+20 -1: DMH.invokeStaticInit
+11 -1: charsetName
+14 -1: x-utf-32be-bom
+5 -1: cause
+7 -1: handle0
+43 -1: ([I[C[Ljava/lang/invoke/LambdaForm$Name;I)Z
+30 -1: getDefaultAllowUserInteraction
+18 -1: ConcurrentMap.java
+35 -1: (Ljava/lang/String;Z)Ljava/net/URL;
+33 -1: Ljava/nio/charset/CharsetDecoder;
+36 -1: java/lang/invoke/MethodHandleStatics
+34 -1: java/util/concurrent/ConcurrentMap
+16 -1: collectArguments
+22 -1: packageAssertionStatus
+79 -1: (JLjava/util/function/ToLongFunction;JLjava/util/function/LongBinaryOperator;)J
+39 -1: Cannot reflectively create enum objects
+62 -1: attempt to add a Permission to a readonly PermissionCollection
+22 -1: FieldAccessorImpl.java
+9 -1: ByteCache
+4 -1: TRUE
+85 -1: Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/Comparable<Ljava/lang/Character;>;
+17 -1: java.library.path
+7 -1: encoder
+21 -1: default locale =
+11 -1: secondOfDay
+37 -1: (Lsun/util/calendar/ZoneInfoFile$1;)V
+35 -1: sun/reflect/UnsafeFieldAccessorImpl
+24 -1: (Ljava/lang/Object;JJJ)V
+16 -1: countStackFrames
+24 -1: (Ljava/lang/Object;JJJ)Z
+17 -1: nonfairTryAcquire
+20 -1: ArrayListSpliterator
+5 -1: /DMH=
+68 -1: (Ljava/lang/CharSequence;Ljava/lang/CharSequence;)Ljava/lang/String;
+2 -1: PI
+8 -1: cspcp852
+112 -1: (Ljava/util/List<Ljava/util/Locale$LanguageRange;>;Ljava/util/Collection<Ljava/util/Locale;>;)Ljava/util/Locale;
+8 -1: cspcp855
+58 -1: (Ljava/lang/Object;JLjava/lang/Object;Ljava/lang/Object;)Z
+33 -1: sun/misc/PerfCounter$CoreCounters
+6 -1: CESU_8
+7 -1: vmslots
+4 -1: Init
+7 -1: handler
+11 -1: getProperty
+10 -1: isVolatile
+8 -1: ([J[IJ)I
+25 -1: ()Ljava/lang/ClassLoader;
+8 -1: asChange
+81 -1: (Ljava/net/URLClassLoader;Ljava/lang/String;Lsun/misc/Resource;)Ljava/lang/Class;
+12 -1: naturalOrder
+8 -1: getState
+40 -1: (Ljava/lang/Object;I)[Ljava/lang/String;
+36 -1: java/security/AccessControlException
+10 -1: linkBefore
+48 -1: (Ljava/util/HashMap;[Ljava/util/HashMap$Node;Z)V
+26 -1: (Ljava/util/WeakHashMap;)V
+23 -1: bad method type alias:
+7 -1: putChar
+18 -1: basicTypeSignature
+33 -1: sun/misc/InvalidJarIndexException
+13 -1: getPrivateuse
+14 -1: isConstantZero
+24 -1: java/io/FilePermission$1
+9 -1: Long.java
+19 -1: getLocaleExtensions
+10 -1: discovered
+17 -1: Invalid file path
+12 -1: MAX_MH_ARITY
+20 -1: observesDaylightTime
+31 -1: Ljava/lang/invoke/MethodHandle;
+6 -1: , end
+24 -1: java/io/FileDescriptor$1
+12 -1: loadLibrary.
+11 -1: Method.java
+12 -1: loadLibrary0
+23 -1: java/util/stream/Stream
+37 -1: sun.lang.ClassLoader.allowArraySyntax
+8 -1: appClass
+15 -1: FileReader.java
+5 -1: (IF)I
+29 -1: [Ljava/lang/ClassValue$Entry;
+12 -1: (principals
+30 -1: jar jar verification
+22 -1: ARRAY_CHAR_BASE_OFFSET
+18 -1: newDirectoryStream
+4 -1: atan
+5 -1: (IF)V
+24 -1: (Ljava/lang/Character;)I
+2 -1: TH
+10 -1: startsWith
+9 -1: baseCount
+13 -1: canonicalize0
+47 -1: (Ljava/lang/ClassLoader;[Ljava/lang/Class<*>;)V
+22 -1: Ljava/io/OutputStream;
+2 -1: TW
+10 -1: H_RESERVED
+19 -1: URLClassLoader.java
+16 -1: isAccessibleFrom
+59 -1: Ljava/util/Hashtable<Ljava/lang/Object;Ljava/lang/Object;>;
+33 -1: java/lang/invoke/ConstantCallSite
+14 -1: Ljava/net/URL;
+12 -1: deleteOnExit
+20 -1: MAX_SKIP_BUFFER_SIZE
+30 -1: [Ljava/lang/ref/WeakReference;
+15 -1: contentPathProp
+9 -1: initCause
+53 -1: (Ljava/util/Queue;Ljava/lang/Class;)Ljava/util/Queue;
+20 -1: java/util/TimeZone$1
+2 -1: UK
+86 -1: (BLjava/lang/Class;Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/DirectMethodHandle;
+51 -1: (II[Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
+18 -1: Lsun/misc/Cleaner;
+31 -1: RuntimeInvisibleTypeAnnotations
+2 -1: US
+7 -1: makeInt
+40 -1: sun/reflect/annotation/AnnotationSupport
+28 -1: sun/reflect/misc/ReflectUtil
+8 -1: utf_32le
+40 -1: (Ljava/lang/Object;JLjava/lang/Object;)V
+24 -1: java/nio/file/WatchEvent
+66 -1: (Ljava/lang/Class;Ljava/lang/Object;)Ljava/lang/invoke/MethodType;
+91 -1: (Ljava/lang/String;[BIILjava/security/ProtectionDomain;Ljava/lang/String;)Ljava/lang/Class;
+114 -1: (Ljava/lang/ThreadLocal;ILjava/lang/ThreadLocal$ThreadLocalMap$Entry;)Ljava/lang/ThreadLocal$ThreadLocalMap$Entry;
+20 -1: internalWriteEntries
+79 -1: <T:Ljava/lang/Object;>(TT;Ljava/util/function/Supplier<Ljava/lang/String;>;)TT;
+14 -1: bitIndex < 0:
+88 -1: (Ljava/security/PrivilegedAction;Ljava/security/AccessControlContext;)Ljava/lang/Object;
+6 -1: , len
+28 -1: java/io/BufferedOutputStream
+11 -1: System.java
+11 -1: csISOLatin1
+11 -1: csISOLatin2
+28 -1: Ljava/io/OutputStreamWriter;
+27 -1: IllegalAccessException.java
+11 -1: csISOLatin4
+14 -1: isDaylightTime
+11 -1: csISOLatin5
+21 -1: getYearLengthInMonths
+13 -1: canonicalizes
+93 -1: "'s signer information does not match signer information of other classes in the same package
+32 -1: ()Lsun/management/GcInfoBuilder;
+37 -1: (IILjava/nio/charset/CoderResult$1;)V
+10 -1: stateNames
+46 -1: (Ljava/lang/String;)Ljava/nio/charset/Charset;
+21 -1: acquireMethodAccessor
+2 -1: X-
+32 -1: java/security/ProtectionDomain$1
+5 -1: atan2
+32 -1: java/security/ProtectionDomain$2
+32 -1: java/security/ProtectionDomain$3
+41 -1: malformed input: partial character at end
+18 -1: dropParameterTypes
+44 -1: (Ljava/lang/String;)Ljava/lang/StringBuffer;
+18 -1: CalendarUtils.java
+5 -1: month
+84 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction<Ljava/lang/ClassLoader;>;
+33 -1: sun/misc/JavaNioAccess$BufferPool
+18 -1: SearchMappingsTask
+38 -1: DelegatingConstructorAccessorImpl.java
+80 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Class<*>;)Ljava/lang/invoke/MemberName;
+8 -1: instance
+54 -1: Parameter annotations don't match number of parameters
+14 -1: createConstant
+35 -1: java/lang/invoke/MemberName$Factory
+4 -1: scrt
+34 -1: Ljava/lang/InstantiationException;
+20 -1: allowUserInteraction
+15 -1: java/util/Deque
+16 -1: forEachRemaining
+35 -1: (J)Lsun/util/calendar/CalendarDate;
+13 -1: no such field
+25 -1: java/nio/file/FileSystems
+16 -1: expectedModCount
+44 -1: (Ljava/io/File;ILjava/nio/charset/Charset;)V
+12 -1: createString
+15 -1: useDaylightTime
+31 -1: java/util/Properties$LineReader
+111 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/String;ILjava/lang/Class<*>;I[Ljava/lang/invoke/MemberName;)I
+16 -1: java/util/Locale
+26 -1: URLClassPath.getResource("
+58 -1: (Ljava/util/SortedMap;Ljava/lang/Class;Ljava/lang/Class;)V
+10 -1: appendTail
+7 -1: cleaner
+78 -1: (Lsun/nio/cs/FastCharsetProvider;Ljava/lang/String;)Ljava/nio/charset/Charset;
+18 -1: convertOldISOCodes
+4 -1: year
+38 -1: java/lang/ReflectiveOperationException
+28 -1: (Ljava/lang/StringBuffer;B)V
+27 -1: (D)Ljava/lang/StringBuffer;
+17 -1: emptyNavigableSet
+7 -1: indices
+10 -1: is sealed
+21 -1: SPECIFICATION_VERSION
+3 -1: TE;
+8 -1: addMonth
+24 -1: java/util/HashMap$Values
+17 -1: SEARCH_ALL_SUPERS
+18 -1: uncaught exception
+14 -1: declaredFields
+2 -1: [B
+2 -1: [C
+8 -1: ABSTRACT
+2 -1: [D
+2 -1: [F
+2 -1: [I
+2 -1: [J
+5 -1: false
+36 -1: (Ljava/net/URL;Ljava/lang/String;J)V
+12 -1: equalContext
+11 -1: VOID_RESULT
+2 -1: [S
+24 -1: (JLjava/lang/Object;JJ)V
+36 -1: Ljava/security/PermissionCollection;
+2 -1: [Z
+17 -1: floatToRawIntBits
+2 -1: []
+21 -1: ()[Ljava/lang/Thread;
+20 -1: [Ljava/lang/Integer;
+42 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Z)V
+19 -1: checkPrintJobAccess
+40 -1: (Ljava/lang/Object;)Ljava/lang/Class<*>;
+31 -1: (Lsun/reflect/FieldAccessor;Z)V
+10 -1: reallyPoll
+52 -1: (Ljava/lang/ref/Reference;)Ljava/lang/ref/Reference;
+100 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<-TV;+TU;>;Ljava/util/function/Consumer<-TU;>;)V
+19 -1: CheckedNavigableMap
+48 -1: (Ljava/lang/String;)Ljava/lang/RuntimeException;
+35 -1: java/util/Hashtable$ValueCollection
+89 -1: (JLjava/util/function/ToDoubleFunction<-TK;>;DLjava/util/function/DoubleBinaryOperator;)D
+10 -1: Stack.java
+57 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Object;I)V
+12 -1: getTimeOfDay
+12 -1: reduceValues
+22 -1: warnUnsupportedCharset
+34 -1: (Ljava/lang/ref/Reference<+TS;>;)Z
+31 -1: EEE, dd MMM yyyy HH:mm:ss 'GMT'
+19 -1: setCachedLambdaForm
+21 -1: (I)Ljava/lang/Object;
+85 -1: (Lsun/util/locale/BaseLocale;Lsun/util/locale/LocaleExtensions;Ljava/util/Locale$1;)V
+36 -1: java/security/AccessControlContext$1
+27 -1: Lsun/net/www/MessageHeader;
+23 -1: ()[Ljava/lang/Class<*>;
+14 -1: refKindIsValid
+41 -1: sun/reflect/NativeConstructorAccessorImpl
+6 -1: binary
+23 -1: ()Ljava/nio/CharBuffer;
+8 -1: getSpace
+45 -1: bootstrap method failed to produce a CallSite
+15 -1: getISO3Language
+17 -1: TRANSITION_NSHIFT
+163 -1: ([Ljava/lang/String;Ljava/util/Map<Ljava/lang/String;Ljava/util/List<Ljava/lang/String;>;>;)Ljava/util/Map<Ljava/lang/String;Ljava/util/List<Ljava/lang/String;>;>;
+7 -1: os.name
+38 -1: java/util/function/IntToDoubleFunction
+8 -1: checkInt
+21 -1: java/lang/VerifyError
+42 -1: sunpkcs11 SunPKCS11 provider debugging
+19 -1: URI is not absolute
+23 -1: java/io/DataInputStream
+53 -1: (Ljava/lang/Object;)Ljava/nio/charset/CharsetEncoder;
+2 -1: _#
+41 -1: (Ljava/io/FilenameFilter;)[Ljava/io/File;
+26 -1: Ljava/util/jar/Attributes;
+7 -1: collect
+17 -1: Lsun/misc/Unsafe;
+97 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodHandle;
+78 -1: <T:Ljava/lang/Object;>(Ljava/util/Enumeration<TT;>;)Ljava/util/ArrayList<TT;>;
+28 -1: (II)Ljava/lang/StringBuffer;
+54 -1: (Ljava/lang/reflect/Constructor<*>;)Ljava/lang/String;
+28 -1: ()Ljava/util/ResourceBundle;
+48 -1: java/util/ArraysParallelSortHelpers$FJInt$Sorter
+9 -1: no access
+57 -1: <S:Ljava/lang/Object;>Ljava/lang/ref/ReferenceQueue<TS;>;
+7 -1: getPerf
+11 -1: getClassAt0
+11 -1: rtypeOffset
+20 -1: thread can't be null
+12 -1: addArguments
+12 -1: utf_32le_bom
+21 -1: allowThreadSuspension
+25 -1: defaultExpectedLineLength
+11 -1: removeFirst
+13 -1: reduceEntries
+20 -1: Read-ahead limit < 0
+57 -1: <T:Ljava/lang/Object;>(Ljava/util/Collection<-TT;>;[TT;)Z
+39 -1: ()Ljava/lang/invoke/MemberName$Factory;
+13 -1: ZipCoder.java
+16 -1: java/lang/Thread
+27 -1: java/lang/NoSuchMethodError
+66 -1: (Ljava/util/jar/JarFile;Ljava/net/URL;)[Ljava/security/CodeSource;
+22 -1: java/lang/StringBuffer
+3 -1: TK;
+34 -1: (I)Ljava/lang/invoke/MethodHandle;
+30 -1: (Ljava/lang/reflect/Method;Z)V
+13 -1: file.encoding
+14 -1: removeTreeNode
+27 -1: sun/misc/JavaSecurityAccess
+58 -1: ([Ljava/lang/Object;ILjava/lang/Class;)[Ljava/lang/Object;
+19 -1: equalLimitedContext
+22 -1: appendVmSynonymMessage
+10 -1: applyAsInt
+23 -1: privateGetPublicMethods
+11 -1: dumpThreads
+25 -1: RuntimeVisibleAnnotations
+37 -1: (IF)Ljava/lang/AbstractStringBuilder;
+18 -1: getBooleanVolatile
+27 -1: (Ljava/util/zip/ZipFile;J)V
+25 -1: INITIAL_QUOTE_PUNCTUATION
+51 -1: (Ljava/util/Map;)[Ljava/lang/annotation/Annotation;
+54 -1: (ILjava/lang/Object;)Ljava/lang/AbstractStringBuilder;
+20 -1: reflectionDataOffset
+2 1: aa
+51 -1: (Ljava/util/jar/Attributes$Name;)Ljava/lang/String;
+13 -1: transferLinks
+18 -1: java/util/Vector$1
+10 -1: ensureOpen
+22 -1: getDeclaredConstructor
+2 -1: am
+19 -1: NF_allocateInstance
+66 -1: (Ljava/util/Spliterator$OfDouble;Z)Ljava/util/stream/DoubleStream;
+6 -1: ([SS)I
+17 -1: newReflectionData
+19 -1: subclassAuditsQueue
+11 -1: access$1200
+16 -1: ValueSpliterator
+18 -1: preparedLambdaForm
+38 -1: (Ljava/net/URL;)Ljava/net/InetAddress;
+14 -1: getMaxPriority
+32 -1: ()[Ljava/lang/StackTraceElement;
+67 -1: java/util/concurrent/ConcurrentHashMap$MapReduceEntriesToDoubleTask
+62 -1: (Ljava/util/Hashtable<Ljava/lang/String;Ljava/lang/String;>;)V
+6 -1: EXTHDR
+14 -1: java/util/Date
+2 -1: az
+6 -1: ([SS)V
+15 -1: arrayBaseOffset
+9 -1: isTrusted
+23 -1: (Ljava/lang/Object;JD)V
+2 -1: bb
+10 -1: ([BII[BI)V
+7 -1: toLower
+14 -1: invoke_LLLLL_L
+7 -1: jarfile
+42 -1: (Ljava/lang/String;)Lsun/misc/PerfCounter;
+28 -1: java/lang/ref/Reference$Lock
+16 -1: java/util/BitSet
+22 -1: jarfile parsing error!
+18 -1: jdk_update_version
+14 -1: invoke_LLLLL_V
+20 -1: java/util/LinkedList
+22 -1: erasedInvokerWithDrops
+25 -1: timeout value is negative
+21 -1: getCalendarProperties
+25 -1: not a method descriptor:
+2 -1: cb
+31 -1: (Lsun/misc/JavaUtilJarAccess;)V
+2 -1: cd
+43 -1: Lsun/util/PreHashedMap<Ljava/lang/String;>;
+12 -1: getEntrySize
+2 -1: ce
+24 -1: guessContentTypeFromName
+2 -1: ch
+14 -1: JulianCalendar
+22 -1: [Ljava/lang/Cloneable;
+122 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractCollection<TE;>;Ljava/util/Deque<TE;>;Ljava/lang/Cloneable;Ljava/io/Serializable;
+34 -1: Lsun/util/locale/BaseLocale$Cache;
+14 -1: LinkedEntrySet
+72 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractSet<TE;>;Ljava/io/Serializable;
+39 -1: ()Ljava/io/ObjectOutputStream$PutField;
+2 -1: cs
+8 -1: indexFor
+25 -1: (Ljava/util/List<+TE;>;)V
+7 -1: subpath
+11 -1: invokeExact
+14 -1: setFileNameMap
+22 -1: LangReflectAccess.java
+8 -1: referent
+34 -1: java/util/MissingResourceException
+77 -1: (Ljava/lang/String;Ljava/util/jar/Manifest;Ljava/net/URL;)Ljava/lang/Package;
+11 -1: ([FII[FII)V
+17 -1: getParameterCount
+18 -1: isMemberAccessible
+10 -1: getExtDirs
+69 -1: <T:Ljava/lang/Object;>(Ljava/util/List<-TT;>;Ljava/util/List<+TT;>;)V
+9 -1: getNextPC
+13 -1: setProperties
+2 -1: de
+16 -1: generateCertPath
+6 -1: decode
+16 -1: getDefaultParent
+50 -1: (Ljava/net/URL;[Ljava/security/cert/Certificate;)V
+24 -1: Certificate factory for
+35 -1: ()Ljava/lang/reflect/AnnotatedType;
+2 -1: ee
+12 -1: asLongBuffer
+7 -1: PRIVATE
+16 -1: aliases_UTF_32BE
+2 -1: en
+2 -1: eq
+7 -1: indexOf
+136 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class<+Ljava/lang/Throwable;>;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle;
+24 -1: (Ljava/lang/Class<*>;I)V
+72 -1: (Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/IllegalAccessException;
+35 -1: java/util/jar/JavaUtilJarAccessImpl
+24 -1: (Ljava/lang/Class<*>;I)Z
+2 -1: ex
+24 -1: getProtectionDomainCache
+101 -1: (Ljava/lang/ThreadGroup;Ljava/lang/Runnable;Ljava/lang/String;JLjava/security/AccessControlContext;)V
+3 -1: hit
+8 -1: UTF_16BE
+2 -1: fd
+16 -1: EmptyEnumeration
+4 -1: attr
+16 -1: fromIndex < -1:
+7 -1: getIntB
+22 -1: java/io/FilePermission
+2 -1: fr
+2 -1: fs
+7 -1: lazySet
+7 -1: getIntL
+37 -1: configfile JAAS ConfigFile loading
+24 -1: sun/nio/cs/StreamEncoder
+40 -1: (Ljava/time/ZoneId;)Ljava/util/TimeZone;
+132 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/BiConsumer;)V
+2 -1: gc
+18 -1: Ljava/lang/Thread;
+10 -1: cacheArray
+48 -1: (Ljava/util/jar/JarFile;)Ljava/util/jar/JarFile;
+61 -1: (Ljava/util/NavigableMap;Ljava/lang/Class;Ljava/lang/Class;)V
+8 -1: readByte
+7 -1: ([S[S)Z
+24 -1: findBootstrapClassOrNull
+2 -1: hb
+7 -1: REPLACE
+45 -1: ()Ljava/util/Enumeration<Ljava/lang/String;>;
+10 -1: isOverflow
+2 -1: he
+13 -1: getCachedJan1
+12 -1: getClassPath
+8 -1: leapYear
+31 -1: java/lang/invoke/MethodTypeForm
+10 -1: ANNOTATION
+20 -1: getGregorianCalendar
+11 -1: ISO_8859_13
+11 -1: ISO_8859_15
+6 -1: invoke
+2 -1: ht
+7 -1: ListItr
+15 -1: synchronizedMap
+7 -1: cleanup
+94 -1: (Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;)Lsun/reflect/annotation/AnnotationType;
+3 -1: TT;
+69 -1: (JLsun/util/calendar/CalendarDate;)Lsun/util/calendar/Gregorian$Date;
+81 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/HashMap$TreeNode<TK;TV;>;)Z
+20 -1: Min. Heap Size:
+33 -1: (IZ)Ljava/lang/invoke/MethodType;
+2 -1: id
+7 -1: ([DI)[D
+37 -1: (Ljava/lang/reflect/Constructor<*>;)I
+42 -1: <T::Ljava/lang/Comparable<-TT;>;>([TT;II)V
+13 -1: addSuppressed
+28 -1: internalMemberNameEnsureInit
+2 -1: in
+17 -1: getCompressedSize
+34 -1: sun/misc/Launcher$AppClassLoader$1
+88 -1: (Ljava/security/DomainCombiner;Ljava/lang/Class<*>;)Ljava/security/AccessControlContext;
+37 -1: (Ljava/lang/reflect/Constructor<*>;)V
+2 -1: is
+2 -1: it
+6 -1: ENDOFF
+4 -1: void
+2 -1: iw
+14 -1: emptySortedSet
+2 -1: ix
+17 -1: unicode-1-1-utf-8
+64 -1: (Ljava/lang/Class;Ljava/util/List;)Ljava/lang/invoke/MethodType;
+46 -1: (Lsun/misc/URLClassPath$Loader;)Ljava/net/URL;
+2 -1: ja
+13 -1: synchronized
+76 -1: ([DLjava/util/function/IntToDoubleFunction;)Ljava/util/function/IntConsumer;
+11 -1: wrapperType
+51 -1: <T:Ljava/lang/Object;>()Ljava/util/Comparator<TT;>;
+106 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;)Ljava/lang/Object;
+17 -1: removeAllElements
+2 -1: ji
+24 -1: java/util/Vector$ListItr
+14 -1: getNestedTypes
+6 -1: L_MARK
+27 -1: Source does not fit in dest
+2 -1: l1
+2 -1: jp
+2 -1: l2
+4 -1: (J)B
+57 -1: (Ljava/lang/String;Ljava/util/Locale;I)Ljava/lang/String;
+4 -1: (J)C
+27 -1: ForEachTransformedValueTask
+2 -1: l4
+26 -1: java/util/Hashtable$KeySet
+4 -1: (J)D
+2 -1: l5
+39 -1: java/security/BasicPermissionCollection
+4 -1: (J)F
+2 -1: jv
+29 -1: MapReduceMappingsToDoubleTask
+18 -1: copyFromShortArray
+2 -1: l9
+3 -1: TV;
+4 -1: (J)I
+4 -1: (J)J
+23 -1: Lsun/util/calendar/Era;
+8 -1: x-EUC-TW
+15 -1: checkSetFactory
+7 -1: Special
+4 -1: (J)S
+4 -1: (J)V
+7 -1: invoke_
+25 -1: (IC)Ljava/nio/ByteBuffer;
+68 -1: (JLjava/util/concurrent/TimeUnit;)Ljava/nio/file/attribute/FileTime;
+36 -1: ()Ljava/net/URLStreamHandlerFactory;
+4 -1: (J)Z
+181 -1: <T:Ljava/lang/Object;>(Ljava/lang/Class<*>;Ljava/lang/ref/SoftReference<Ljava/lang/Class$ReflectionData<TT;>;>;Ljava/lang/ref/SoftReference<Ljava/lang/Class$ReflectionData<TT;>;>;)Z
+9 -1: getOffset
+46 -1: (ILjava/lang/String;)Ljava/lang/StringBuilder;
+7 -1: element
+15 -1: createByteArray
+17 -1: uncaughtException
+2 -1: ko
+29 -1: java/nio/file/DirectoryStream
+15 -1: getISOCountries
+246 -1: <NoSuchMemberException:Ljava/lang/ReflectiveOperationException;>(BLjava/lang/invoke/MemberName;Ljava/lang/Class<*>;Ljava/lang/Class<TNoSuchMemberException;>;)Ljava/lang/invoke/MemberName;^Ljava/lang/IllegalAccessException;^TNoSuchMemberException;
+7 -1: invoker
+17 -1: langReflectAccess
+10 -1: bindSingle
+23 -1: java/lang/reflect/Proxy
+2 -1: lb
+2 -1: lc
+29 -1: CREATE_CLASSLOADER_PERMISSION
+5 -1: isSet
+18 -1: ([Ljava/io/File;)V
+15 -1: urlNoFragString
+21 -1: DirectByteBuffer.java
+15 -1: java.class.path
+15 -1: createDirectory
+4 -1: GMT
+37 -1: sun/reflect/annotation/ExceptionProxy
+28 -1: (Ljava/util/Map<+TK;+TV;>;)V
+17 -1: getContentHandler
+26 -1: GenericDeclRepository.java
+56 -1: (Ljava/lang/String;)Ljava/lang/IllegalArgumentException;
+15 -1: getJavaIOAccess
+39 -1: java/util/Collections$EmptyListIterator
+34 -1: java/lang/ConditionalSpecialCasing
+82 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/lang/management/GarbageCollectorMBean;
+58 -1: (Ljava/util/function/ToIntFunction;)Ljava/util/Comparator;
+21 -1: ()Lsun/misc/Launcher;
+2 -1: lt
+92 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;IIILjava/util/concurrent/ConcurrentHashMap;)V
+8 -1: disjoint
+62 -1: (Ljava/net/URL;Ljava/lang/String;Ljava/net/URLStreamHandler;)V
+24 -1: ([Ljava/lang/Object;)TT;
+4 -1: lmap
+8 -1: SATURDAY
+12 -1: toStringUTF8
+91 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/util/function/BinaryOperator;)Ljava/lang/Object;
+46 -1: pkcs11 PKCS11 session manager debugging
+27 -1: (Z)Ljava/lang/StringBuffer;
+7 -1: forEach
+17 -1: (Ljava/io/File;)I
+17 -1: (Ljava/io/File;)J
+5 -1: RESET
+6 -1: isFile
+14 -1: Exception.java
+8 -1: isPublic
+27 -1: computeInitialPreparedForms
+50 -1: (BZLjava/lang/Class;)Ljava/lang/invoke/LambdaForm;
+19 -1: getAvailableLocales
+17 -1: (Ljava/io/File;)V
+28 -1: ()Ljava/nio/charset/Charset;
+10 -1: appendNull
+17 -1: (Ljava/io/File;)Z
+23 -1: java/lang/InternalError
+2 -1: ne
+6 -1: radix
+8 -1: checksum
+66 -1: (Lsun/net/www/MessageHeader;Ljava/lang/String;Ljava/lang/Object;)V
+45 -1: (Ljava/io/FilenameFilter;)[Ljava/lang/String;
+8 -1: checkJar
+28 -1: default format locale =
+13 -1: normalizeTime
+26 -1: java/util/AbstractList$Itr
+30 -1: java/util/function/IntFunction
+7 -1: TIS-620
+12 -1: reverseBytes
+2 -1: of
+26 -1: java/lang/ClassFormatError
+109 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle;
+10 -1: delimiters
+20 -1: indexOfSupplementary
+16 -1: aliases_UTF_32LE
+134 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/Map<TK;TV;>;Ljava/lang/Class<TK;>;Ljava/lang/Class<TV;>;)Ljava/util/Map<TK;TV;>;
+17 -1: [Ljava/lang/Long;
+2 -1: or
+12 -1: getClassName
+31 -1: (Ljava/nio/charset/Charset;FF)V
+6 -1: ([FF)I
+39 -1: (Ljava/util/Locale;)[Ljava/lang/String;
+33 -1: java/util/WeakHashMap$KeyIterator
+8 -1: UTF_16LE
+12 -1: isISOControl
+75 -1: (Ljava/nio/CharBuffer;Ljava/nio/ByteBuffer;Z)Ljava/nio/charset/CoderResult;
+7 -1: ([I[I)Z
+28 -1: Self-causation not permitted
+6 -1: ([FF)V
+14 -1: defaultCharset
+12 -1: isJavaLetter
+2 -1: pm
+39 -1: cannot reflectively invoke MethodHandle
+20 -1: getSystemClassLoader
+42 -1: ([Ljava/lang/Object;IILjava/lang/Object;)I
+56 -1: (Ljava/lang/Object;Ljava/lang/String;)Ljava/lang/Object;
+42 -1: ([Ljava/lang/Object;IILjava/lang/Object;)V
+12 -1: ZipFile.java
+43 -1: (Ljava/util/zip/ZipFile;)Ljava/lang/String;
+22 -1: Ljava/net/InetAddress;
+15 -1: getCharVolatile
+32 -1: ()[Ljava/lang/reflect/Parameter;
+13 -1: delimsChanged
+13 -1: getFileSystem
+13 -1: METHOD_RETURN
+20 -1: sun/misc/PerfCounter
+61 -1: (Ljava/util/HashMap<TK;TV;>;)Ljava/util/HashMap$Node<TK;TV;>;
+8 -1: newIndex
+18 -1: getDisplayLanguage
+36 -1: (C)Ljava/lang/AbstractStringBuilder;
+36 -1: java/lang/StringCoding$StringEncoder
+12 -1: forEachEntry
+23 -1: [Ljava/io/Serializable;
+13 -1: totalCapacity
+26 -1: java/io/FileOutputStream$1
+14 -1: signatureArity
+90 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;[Ljava/security/cert/Certificate;)V
+17 -1: reflectionFactory
+6 -1: ibm737
+17 -1: fillInStackTrace0
+16 -1: allocateInstance
+52 -1: (Lsun/util/locale/BaseLocale$Key;)Ljava/lang/String;
+9 -1: addExtURL
+16 -1: copyFromIntArray
+65 -1: (Ljava/security/Permission;Z)Ljava/security/PermissionCollection;
+57 -1: java/util/concurrent/ConcurrentHashMap$SearchMappingsTask
+10 -1: toEpochDay
+4 -1: gate
+24 -1: sun/nio/cs/UTF_8$Decoder
+8 -1: entries2
+18 -1: isCharsetSupported
+10 -1: toCustomID
+2 -1: rw
+33 -1: java/nio/ByteBufferAsFloatBufferB
+25 -1: (ID)Ljava/nio/ByteBuffer;
+12 -1: addTimeOfDay
+61 -1: (Ljava/security/ProtectionDomain;Ljava/security/Permission;)Z
+2 -1: sd
+25 -1: (Ljava/net/InetAddress;)V
+33 -1: java/nio/ByteBufferAsFloatBufferL
+2 -1: se
+15 -1: hasQueuedThread
+24 -1: assertMemberIsConsistent
+37 -1: java/util/Collections$UnmodifiableMap
+2 -1: sp
+20 -1: setJavaUtilJarAccess
+96 -1: (Ljava/lang/String;[BIILjava/lang/ClassLoader;Ljava/security/ProtectionDomain;)Ljava/lang/Class;
+8 -1: language
+76 -1: <T:Ljava/lang/Object;>(Ljava/util/SortedSet<TT;>;)Ljava/util/SortedSet<TT;>;
+11 -1: findLibrary
+61 -1: (Ljava/lang/Class<*>;)Lsun/reflect/annotation/AnnotationType;
+6 -1: ([BZ)V
+24 -1: DEFAULT_BYTE_BUFFER_SIZE
+25 -1: (Ljava/util/ArrayList;I)V
+2 -1: th
+47 -1: (Ljava/util/Collection;)Ljava/util/Enumeration;
+49 -1: (Lsun/misc/URLClassPath$JarLoader;)Ljava/net/URL;
+7 -1: ([D[D)Z
+2 -1: to
+22 -1: java/util/Locale$Cache
+8 -1: iterator
+30 -1: (Ljava/lang/StringBuilder;IZ)V
+17 -1: ()Ljava/util/Set;
+2 -1: tr
+27 -1: (Ljava/nio/ByteBuffer;ISZ)V
+6 -1: method
+13 -1: allPermission
+9 -1: ruleArray
+8 -1: UTC_TIME
+10 -1: LF_COUNTER
+26 -1: Lsun/nio/cs/StreamDecoder;
+25 -1: ()Lsun/util/calendar/Era;
+6 -1: LOCHDR
+21 -1: sun/net/www/MimeTable
+12 -1: Cannot cast
+2 -1: us
+2 -1: ut
+52 -1: Ljava/lang/invoke/MethodHandle$PolymorphicSignature;
+6 -1: encode
+15 -1: CharBuffer.java
+24 -1: (C)Ljava/nio/ByteBuffer;
+56 -1: (Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;)V
+18 -1: getEnclosingMethod
+56 -1: (Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;)Z
+6 -1: ibm775
+9 -1: (IIIIII)I
+44 -1: ([JLjava/util/function/IntToLongFunction;I)V
+9 -1: (IIIIII)J
+64 -1: (Ljava/util/Locale$LocaleKey;)Lsun/util/locale/LocaleExtensions;
+2 -1: x-
+2 -1: vm
+5 -1: clock
+9 -1: (IIIIII)V
+10 -1: XmlSupport
+19 -1: sun/nio/cs/US_ASCII
+10 -1: toRealPath
+5 -1: cp367
+6 -1: ST_END
+58 -1: [Lsun/util/calendar/ZoneInfoFile$ZoneOffsetTransitionRule;
+12 -1: hasSameRules
+108 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)Lsun/util/locale/LocaleExtensions;
+22 -1: java/lang/Class$Atomic
+4 -1: sync
+6 -1: listen
+12 -1: firstElement
+142 -1: (Ljava/lang/Class;Ljava/lang/String;[Ljava/lang/Class;Ljava/lang/Class;[Ljava/lang/Class;IILjava/lang/String;[B[B[B)Ljava/lang/reflect/Method;
+18 -1: internalProperties
+28 -1: (Ljava/lang/StringBuffer;C)V
+7 -1: factory
+18 -1: ()Ljava/util/List;
+50 -1: (Ljava/util/concurrent/CountedCompleter;[D[DIIII)V
+44 -1: (Ljava/lang/Class;)Lsun/invoke/util/Wrapper;
+83 -1: (JLjava/util/function/ToDoubleFunction;DLjava/util/function/DoubleBinaryOperator;)D
+12 -1: erasedType:
+53 -1: (Ljava/util/AbstractList;Ljava/util/AbstractList$1;)V
+20 -1: Cannot find package
+27 -1: java/util/ArrayList$ListItr
+10 -1: copyMethod
+23 -1: java/lang/ThreadLocal$1
+16 -1: iso_646.irv:1983
+42 -1: (Ljava/lang/Thread;Ljava/lang/Throwable;)V
+19 -1: DEFAULT_LOAD_FACTOR
+40 -1: ([Ljava/lang/Object;)[Ljava/lang/Object;
+10 -1: (JJJ[BII)I
+12 -1: singletonMap
+8 -1: RESERVED
+9 -1: zipAccess
+21 -1: SynchronizedSortedMap
+4 -1: flag
+15 -1: UnmodifiableSet
+18 -1: WrappedPrintWriter
+7 -1: resume0
+2 -1: yi
+10 -1: erasedType
+31 -1: CHECK_AWT_EVENTQUEUE_PERMISSION
+8 -1: <clinit>
+59 -1: (Ljava/lang/String;)Ljava/security/cert/CertificateFactory;
+40 -1: java/lang/management/MemoryManagerMXBean
+33 -1: newGetIntIllegalArgumentException
+16 -1: iso_646.irv:1991
+58 -1: (Ljava/lang/ClassValue$Entry;)Ljava/lang/ClassValue$Entry;
+2 -1: zc
+26 -1: (Ljava/util/AbstractMap;)V
+6 -1: THROWS
+11 -1: toCharArray
+64 -1: (Ljava/lang/reflect/Constructor;)Ljava/lang/reflect/Constructor;
+2 -1: zh
+68 -1: Ljava/lang/ref/SoftReference<Ljava/lang/Class$ReflectionData<TT;>;>;
+25 -1: (Ljava/util/Collection;)V
+20 -1: getJdkSpecialVersion
+17 -1: getTypeParameters
+32 -1: [Ljava/lang/ClassValue$Entry<*>;
+25 -1: (Ljava/util/Collection;)Z
+26 -1: Lsun/nio/ch/Interruptible;
+5 -1: 0.0p0
+5 -1: CACHE
+7 -1: namesOK
+21 -1: Ljava/lang/Exception;
+51 -1: (Ljava/net/URL;Lsun/net/www/protocol/jar/Handler;)V
+19 -1: jdk_special_version
+66 -1: <T:Ljava/lang/Object;>(Ljava/util/List<TT;>;)Ljava/util/List<TT;>;
+75 -1: (Ljava/util/Comparator;Ljava/util/function/Function;)Ljava/util/Comparator;
+11 -1: Arrays.java
+19 -1: (Ljava/lang/Byte;)I
+17 -1: java/lang/Class$1
+17 -1: java/lang/Class$2
+17 -1: java/lang/Class$3
+47 -1: java/lang/invoke/MethodHandleImpl$WrappedMember
+17 -1: java/lang/Class$4
+44 -1: (Ljava/lang/Throwable;)Ljava/lang/Throwable;
+9 -1: charCount
+24 -1: ()Ljava/net/FileNameMap;
+44 -1: sun/util/locale/provider/TimeZoneNameUtility
+17 -1: not an array type
+2 -1: {}
+24 -1: (Lsun/misc/Launcher$1;)V
+12 -1: directMemory
+10 -1: parameters
+5 -1: java.
+14 -1: allocateDirect
+51 -1: (Ljava/lang/StringBuffer;)Ljava/lang/StringBuilder;
+23 -1: java/nio/file/Watchable
+37 -1: createDiagnosticFrameworkNotification
+54 -1: (Ljava/lang/Class<*>;Z)Ljava/lang/invoke/MethodHandle;
+35 -1: sun/nio/cs/StandardCharsets$Aliases
+9 -1: retDelims
+11 -1: MAX_ENTRIES
+12 -1: CumulateTask
+64 -1: java/util/concurrent/ConcurrentHashMap$ForEachTransformedKeyTask
+3 -1: iae
+12 -1: AF_PUTSTATIC
+21 -1: java/lang/Throwable$1
+45 -1: (Ljava/util/HashMap;)Ljava/util/HashMap$Node;
+77 -1: (JLjava/util/function/ToIntFunction;ILjava/util/function/IntBinaryOperator;)I
+5 -1: after
+29 -1: (Ljava/security/CodeSource;)Z
+248 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceValuesToDoubleTask;Ljava/util/function/ToDoubleFunction;DLjava/util/function/DoubleBinaryOperator;)V
+6 -1: H_URIC
+7 -1: L_DIGIT
+7 -1: toNanos
+24 -1: (D)Ljava/nio/ByteBuffer;
+25 -1: getDiagnosticCommandMBean
+6 2: [LFoo;
+14 -1: path.separator
+16 -1: toUnsignedString
+40 -1: DIRECTIONALITY_EUROPEAN_NUMBER_SEPARATOR
+87 -1: (Ljava/security/Permission;[Ljava/security/cert/Certificate;)Ljava/security/Permission;
+16 -1: inheritedChannel
+11 -1: audio/basic
+27 -1: sun.classloader.findClasses
+10 -1: queryCount
+20 -1: NF_ensureInitialized
+12 -1: getBufIfOpen
+23 -1: sun/nio/cs/UTF_16LE_BOM
+134 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;[Ljava/lang/Object;)Ljava/lang/invoke/CallSite;
+17 -1: getImplMethodName
+14 -1: linkMethod =>
+25 -1: Ljava/lang/invoke/Stable;
+32 -1: Ljava/lang/annotation/Retention;
+7 -1: doInput
+9 -1: -_.!~*'()
+62 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Class<*>;B)V
+18 -1: separateWithCommas
+43 -1: com/sun/crypto/provider/CipherBlockChaining
+14 -1: createTempFile
+9 -1: implFlush
+20 -1: getOffsetsByStandard
+21 -1: OutOfMemoryError.java
+7 -1: jce.jar
+46 -1: java/util/Collections$UnmodifiableNavigableMap
+30 -1: (Ljava/io/File;)Ljava/io/File;
+15 -1: LinkedList.java
+15 -1: iso_8859-9:1989
+50 -1: sun/reflect/generics/factory/CoreReflectionFactory
+10 -1: : JVM has
+19 -1: HeapByteBuffer.java
+6 -1: getURL
+37 -1: java/security/cert/CertificateFactory
+23 -1: getAllowUserInteraction
+12 -1: otherParents
+25 -1: ARRAY_BOOLEAN_BASE_OFFSET
+9 -1: L_UPALPHA
+41 -1: ([Ljava/util/Hashtable$Entry<**>;TK;TV;)V
+6 -1: LOCHOW
+11 -1: access$1300
+30 -1: sun/reflect/MethodAccessorImpl
+130 -1: (Ljava/util/List<Ljava/util/Locale$LanguageRange;>;Ljava/util/Collection<Ljava/util/Locale;>;)Ljava/util/List<Ljava/util/Locale;>;
+9 -1: MALFORMED
+38 -1: (Ljava/lang/String;I)Ljava/lang/Short;
+26 -1: File format not recognised
+12 -1: setTimeOfDay
+19 -1: java/lang/Exception
+15 -1: getOutputStream
+74 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
+41 -1: (Ljava/lang/String;Z)Ljava/util/TimeZone;
+49 -1: Lsun/reflect/generics/repository/ClassRepository;
+8 -1: getCerts
+90 -1: (Ljava/lang/Class<*>;ZLjava/lang/Class<*>;)Ljava/util/List<Ljava/lang/invoke/MemberName;>;
+5 -1: clone
+32 -1: ()Ljava/lang/ref/Reference$Lock;
+15 -1: caseIgnoreMatch
+23 -1: (Ljava/util/Set<TE;>;)V
+25 -1: enumerateStringProperties
+9 -1: inherited
+4 -1: flip
+8 -1: setMonth
+38 -1: (Ljava/util/function/Consumer<-TV;>;)V
+55 -1: java/util/concurrent/ConcurrentHashMap$ReduceValuesTask
+37 -1: getJavaSecurityProtectionDomainAccess
+67 -1: (Ljava/util/NavigableSet;Ljava/lang/Class;)Ljava/util/NavigableSet;
+10 -1: reduceKeys
+14 -1: MAX_CODE_POINT
+24 -1: getGenericExceptionTypes
+8 -1: fraction
+30 -1: java/lang/InterruptedException
+46 -1: (Ljava/lang/String;II[BI)Ljava/nio/ByteBuffer;
+114 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>([Ljava/util/HashMap$Node<TK;TV;>;Ljava/util/HashMap$TreeNode<TK;TV;>;)V
+66 -1: (Ljava/lang/String;Ljava/lang/Throwable;)Ljava/lang/InternalError;
+45 -1: (Ljava/lang/Object;)Ljava/lang/StringBuilder;
+8 -1: putLongB
+101 -1: (Ljava/nio/channels/ReadableByteChannel;Ljava/nio/charset/CharsetDecoder;I)Lsun/nio/cs/StreamDecoder;
+16 -1: standardProvider
+14 -1: parameterCount
+59 -1: (Ljava/lang/String;Ljava/lang/ClassLoader;)Ljava/util/List;
+8 -1: putLongL
+12 -1: (TT;TV;TV;)Z
+37 -1: Lsun/reflect/ConstructorAccessorImpl;
+11 -1: ([CII[CII)V
+14 -1: parameterArray
+15 -1: | interpretName
+62 -1: (JLjava/util/function/Function;Ljava/util/function/Consumer;)V
+30 -1: (Z)Lsun/reflect/FieldAccessor;
+19 -1: jvm_special_version
+22 -1: java/util/ArrayDeque$1
+12 -1: initVersions
+22 -1: java/lang/CharSequence
+21 -1: NF_internalMemberName
+5 -1: ()TE;
+97 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;IZ)Ljava/lang/invoke/MethodHandle;
+25 -1: java/nio/MappedByteBuffer
+6 -1: addURL
+17 -1: isConvertibleFrom
+14 -1: extendWithType
+9 -1: interrupt
+11 -1: floorDivide
+16 -1: x-ISO-2022-CN-GB
+12 -1: CheckedQueue
+7 -1: setLong
+64 -1: (Ljava/lang/ThreadGroup;Ljava/lang/Runnable;Ljava/lang/String;)V
+108 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/NavigableMap<TK;TV;>;)Ljava/util/NavigableMap<TK;TV;>;
+38 -1: java/nio/channels/spi/SelectorProvider
+17 -1: makeGuardWithTest
+20 -1: (Ljava/util/List;Z)V
+8 -1: val$path
+12 -1: Runtime.java
+7 -1: channel
+71 -1: <T:Ljava/lang/Object;>([TT;IILjava/util/function/BinaryOperator<TT;>;)V
+18 -1: initializedHeaders
+32 -1: ()[Lsun/launcher/LauncherHelper;
+13 -1: jvInitialized
+10 -1: getSeconds
+7 -1: Decoder
+20 -1: getYearFromFixedDate
+6 -1: PREFIX
+21 -1: sun.boot.library.path
+11 -1: FIXED_DATES
+33 -1: (JLjava/util/function/Consumer;)V
+27 -1: initializeJavaAssertionMaps
+13 -1: toOctalString
+9 -1: fixResult
+10 -1: typeParams
+94 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;I)Ljava/util/concurrent/ConcurrentHashMap$Node;
+4 -1: Help
+11 -1: setIfNotSet
+39 -1: java/lang/UnsupportedOperationException
+15 -1: zip file closed
+8 -1: floorDiv
+10 -1: canExecute
+10 -1: encodeLoop
+18 -1: addRequestProperty
+56 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/Object;I)V
+10 -1: superclass
+5 -1: close
+56 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/Object;I)Z
+6 -1: ignore
+32 -1: ()Ljava/lang/ref/ReferenceQueue;
+19 -1: java/util/Formatter
+27 -1: java/lang/ClassLoaderHelper
+23 -1: (Ljava/lang/Object;JZ)V
+29 -1: java/nio/file/WatchEvent$Kind
+6 -1: CENLEN
+4 -1: SIZE
+68 -1: <T:Ljava/lang/Object;>(Ljava/util/Deque<TT;>;)Ljava/util/Queue<TT;>;
+9 -1: isEscaped
+12 -1: LF_INTERPRET
+22 -1: (I)Ljava/lang/Integer;
+60 -1: (Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MemberName;
+49 -1: ([Ljava/lang/Class<*>;Ljava/lang/StringBuilder;)V
+11 -1: getZipEntry
+16 -1: metaInfFilenames
+27 -1: (Ljava/lang/StringBuffer;)V
+57 -1: (Ljava/lang/Object;)Ljava/util/WeakHashMap$Entry<TK;TV;>;
+76 -1: (Ljava/lang/String;[BIILjava/security/ProtectionDomain;)Ljava/lang/Class<*>;
+8 -1: ([CII)[B
+27 -1: (Ljava/lang/StringBuffer;)Z
+24 -1: getManifestFromReference
+8 -1: ([CII)[C
+10 -1: H_LOWALPHA
+18 -1: FileURLMapper.java
+12 -1: fxLaunchMode
+24 -1: isMethodHandleInvokeName
+17 -1: winTimeToFileTime
+19 -1: checkTopLevelWindow
+26 -1: MapReduceMappingsToIntTask
+13 -1: NORM_PRIORITY
+18 -1: lookupViaProviders
+30 -1: (I)Ljava/util/LinkedList$Node;
+3 -1: UTC
+10 -1: UNMAPPABLE
+68 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/invoke/MethodType;B)V
+9 -1: META-INF/
+13 -1: Iterable.java
+71 -1: ([Ljava/lang/reflect/Field;Ljava/lang/String;)Ljava/lang/reflect/Field;
+9 -1: setOffset
+8 -1: FJObject
+50 -1: (Ljava/lang/CharSequence;)Ljava/util/StringJoiner;
+23 -1: java/nio/HeapByteBuffer
+23 -1: sun/util/PreHashedMap$1
+23 -1: sun/util/PreHashedMap$2
+34 -1: newGetCharIllegalArgumentException
+40 -1: jca JCA engine class debugging
+39 -1: (Ljava/lang/Object;I)Ljava/lang/Object;
+42 -1: (Ljava/lang/String;)Ljava/net/InetAddress;
+25 -1: (Ljava/net/FileNameMap;)V
+44 -1: (Ljava/util/SortedMap;)Ljava/util/SortedMap;
+52 -1: (Ljava/lang/String;Ljava/lang/Long;)Ljava/lang/Long;
+27 -1: ()[Ljava/util/HashMap$Node;
+29 -1: java/util/EmptyStackException
+16 -1: not a field type
+14 -1: Ljava/io/File;
+28 -1: ()[Ljava/security/Principal;
+69 -1: (Ljava/io/OutputStream;Ljava/lang/Object;Ljava/nio/charset/Charset;)V
+5 -1: ()TK;
+10 -1: ISO8859-13
+40 -1: java/lang/invoke/DirectMethodHandle$Lazy
+30 -1: The object is not initialized.
+10 -1: ISO8859-15
+88 -1: <E:Ljava/lang/Object;>(Ljava/util/List<TE;>;Ljava/lang/Class<TE;>;)Ljava/util/List<TE;>;
+25 -1: (ZILjava/lang/String;II)Z
+9 -1: stackSize
+61 -1: (Ljava/util/Comparator;Ljava/lang/Object;Ljava/lang/Object;)I
+16 -1: synchronizedList
+90 -1: (Ljava/util/Comparator;Ljava/util/function/Function;Ljava/lang/Object;Ljava/lang/Object;)I
+9 -1: nullCheck
+174 -1: Ljava/util/concurrent/ConcurrentMap<Ljava/lang/invoke/MethodType$ConcurrentWeakInternSet$WeakEntry<TT;>;Ljava/lang/invoke/MethodType$ConcurrentWeakInternSet$WeakEntry<TT;>;>;
+14 -1: java/lang/Enum
+3 -1: int
+13 -1: detailMessage
+56 -1: java/util/concurrent/ConcurrentHashMap$SearchEntriesTask
+10 -1: ISO-8859-1
+10 -1: ISO-8859-2
+10 -1: ISO-8859-3
+10 -1: ISO-8859-4
+10 -1: ISO-8859-5
+10 -1: ISO-8859-6
+24 -1: ([Ljava/lang/Object;II)V
+10 -1: ISO-8859-7
+10 -1: ISO-8859-8
+139 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$Node;)[Ljava/util/concurrent/ConcurrentHashMap$Node;
+10 -1: ISO-8859-9
+5 -1: round
+25 -1: DIRECTIONALITY_WHITESPACE
+13 -1: NamedFunction
+10 -1: startAgent
+3 -1: ioe
+7 -1: closing
+24 -1: appendSchemeSpecificPart
+56 -1: sun/reflect/ReflectionFactory$GetReflectionFactoryAction
+83 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction<Lsun/reflect/ReflectionFactory;>;
+17 -1: isCharsetDetected
+11 -1: getJarFiles
+22 -1: getEnclosingMethodInfo
+11 -1: setReadable
+61 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;)V
+10 -1: attachment
+34 -1: (Ljava/io/File;)Ljava/lang/String;
+18 -1: ZipFileInputStream
+15 -1: CodeSource.java
+61 -1: (Ljava/util/jar/JarFile;)Ljava/util/List<Ljava/lang/Object;>;
+7 -1: cp00858
+108 -1: ([Ljava/lang/invoke/LambdaForm$Name;[Ljava/lang/invoke/LambdaForm$Name;II)Ljava/lang/invoke/LambdaForm$Name;
+38 -1: ([DII)Ljava/util/Spliterator$OfDouble;
+8 -1: val$name
+11 -1: LF_REINVOKE
+12 -1: validateTime
+17 -1: copyFromCharArray
+32 -1: throwSetIllegalArgumentException
+14 -1: fieldModifiers
+52 -1: (Ljava/lang/ClassValue;)Ljava/lang/ClassValue$Entry;
+58 -1: (Ljava/io/OutputStream;Ljava/nio/charset/CharsetEncoder;)V
+14 -1: generalInvoker
+11 -1: interrupted
+246 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceMappingsToLongTask;Ljava/util/function/ToLongBiFunction;JLjava/util/function/LongBinaryOperator;)V
+20 -1: java/util/Dictionary
+17 -1: getDoubleVolatile
+41 -1: (Ljava/lang/Class<*>;Ljava/lang/Object;)Z
+8 -1: intValue
+24 -1: (F)Ljava/nio/ByteBuffer;
+5 -1: reset
+54 -1: (ILjava/util/List;)[Ljava/lang/invoke/LambdaForm$Name;
+19 -1: [Ljava/util/Locale;
+43 -1: (Ljava/lang/String;II)Ljava/nio/ByteBuffer;
+38 -1: ()Ljava/io/ObjectInputStream$GetField;
+18 -1: [Locked by thread
+10 -1: checkedMap
+16 -1: checkedSortedMap
+14 -1: illegal symbol
+16 -1: TITLECASE_LETTER
+4 -1: root
+22 -1: (ZLjava/lang/String;)V
+27 -1: ([JII)Ljava/nio/LongBuffer;
+15 -1: printStackTrace
+30 -1: newConstructorForSerialization
+14 -1: getPermissions
+13 -1: toStringCache
+15 -1: equalParamTypes
+37 -1: throwFinalFieldIllegalAccessException
+35 -1: (Ljava/lang/String;Ljava/io/File;)V
+34 -1: java/nio/charset/CoderResult$Cache
+3 -1: .\n\n
+33 -1: Ljava/nio/charset/CharsetEncoder;
+11 -1: lambdaForms
+65 -1: <T::Ljava/lang/annotation/Annotation;>(Ljava/lang/Class<TT;>;)TT;
+39 -1: (CLjava/lang/Class;Ljava/lang/Object;)Z
+3 -1: ise
+14 -1: forLanguageTag
+45 -1: ([Ljava/lang/Class<*>;[Ljava/lang/Class<*>;)Z
+36 -1: RuntimeInvisibleParameterAnnotations
+12 -1: binarySearch
+24 -1: getAssociatedAnnotations
+10 -1: decoderFor
+6 -1: ibm813
+10 -1: logicalXor
+10 -1: setVarargs
+71 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class;Ljava/lang/Void;)V
+4 -1: cast
+6 -1: ibm819
+23 -1: getParentDelegationTime
+8 -1: ([FII)[F
+4 -1: .tmp
+6 -1: (JII)J
+27 -1: ()Ljava/lang/ref/Finalizer;
+9 -1: sunec.jar
+22 -1: java/net/URLConnection
+41 -1: (Ljava/lang/Runnable;Ljava/lang/String;)V
+20 -1: SecurityManager.java
+18 -1: getZipFileOpenTime
+7 -1: country
+13 -1: inflaterCache
+4 -1:
+17 -1: java/lang/Runtime
+125 -1: (Lsun/management/GcInfoBuilder;JJJ[Ljava/lang/management/MemoryUsage;[Ljava/lang/management/MemoryUsage;[Ljava/lang/Object;)V
+24 -1: java/util/ResourceBundle
+64 -1: Ljava/util/Hashtable<Lsun/misc/Signal;Lsun/misc/SignalHandler;>;
+79 -1: ([Ljava/util/WeakHashMap$Entry<TK;TV;>;[Ljava/util/WeakHashMap$Entry<TK;TV;>;)V
+8 -1: x-ibm737
+39 -1: (Ljava/security/AccessControlContext;)Z
+21 -1: (Ljava/lang/Class;I)V
+4 -1: -
+15 -1: calculateFields
+22 -1: Ljava/util/Properties;
+8 -1: getArray
+21 -1: (Ljava/lang/Class;I)Z
+41 -1: (Ljava/lang/ThreadGroup;)Ljava/lang/Void;
+17 -1: Ljava/io/Console;
+115 -1: (Ljava/security/PrivilegedAction;Ljava/security/AccessControlContext;[Ljava/security/Permission;)Ljava/lang/Object;
+12 -1: nextThreadID
+81 -1: (Ljava/net/URLClassLoader;Ljava/lang/SecurityManager;Ljava/security/Permission;)V
+23 -1: ARRAY_SHORT_BASE_OFFSET
+10 -1: interpret_
+144 -1: (Ljava/net/URL;Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)V
+20 -1: isIPv6LiteralAddress
+13 -1: launcher_name
+36 -1: java/util/function/IntToLongFunction
+38 -1: java/util/WeakHashMap$EntrySpliterator
+8 -1: copyInto
+3 -1: ACT
+11 -1: metafactory
+31 -1: ([BLjava/nio/charset/Charset;)V
+30 -1: java/lang/annotation/Retention
+13 -1: getYearLength
+42 -1: java/util/AbstractMap$SimpleImmutableEntry
+31 -1: ()Ljava/lang/invoke/MemberName;
+21 -1: sun/misc/JavaIOAccess
+16 -1: jdk_build_number
+8 -1: ST_RESET
+96 -1: (BLjava/lang/Class;Ljava/lang/String;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MemberName;
+13 -1: getTypeString
+15 -1: maxCharsPerByte
+8 -1: checkKey
+49 -1: (Ljava/nio/charset/Charset;Lsun/nio/cs/UTF_8$1;)V
+80 -1: (Ljava/lang/ClassValue;Ljava/lang/ClassValue$Entry;)Ljava/lang/ClassValue$Entry;
+32 -1: Ljava/security/ProtectionDomain;
+5 -1: ()TT;
+6 -1: insert
+10 -1: intersects
+38 -1: ([Ljava/lang/Class;Ljava/lang/Class;)V
+15 -1: java/lang/Class
+12 -1: getPublicKey
+37 -1: (ID)Ljava/lang/AbstractStringBuilder;
+6 -1: ibm850
+6 -1: locsig
+6 -1: ibm852
+19 -1: changeReferenceKind
+3 -1: AET
+42 -1: (Ljava/util/Collection;Ljava/lang/Class;)V
+6 -1: ibm855
+16 -1: getPolicyNoCheck
+39 -1: ([B)[[Ljava/lang/annotation/Annotation;
+6 -1: ibm857
+10 -1: Error.java
+38 -1: ()Ljava/util/List<Ljava/lang/Object;>;
+14 -1: createInstance
+5 -1: cp437
+28 -1: Lsun/util/locale/BaseLocale;
+17 -1: getStandardOffset
+29 -1: sun/nio/cs/StandardCharsets$1
+36 -1: Ljava/security/ProtectionDomain$Key;
+14 -1: ArrayList.java
+78 -1: (Ljava/lang/String;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MemberName;
+38 -1: java/lang/invoke/MethodHandleImpl$Lazy
+42 -1: (Ljava/util/LinkedHashMap$Entry<TK;TV;>;)V
+8 -1: getLongB
+7 -1: vmentry
+21 -1: lookupExtendedCharset
+32 -1: <T:Ljava/lang/Object;>([TT;)[TT;
+53 -1: Ljava/util/concurrent/ConcurrentHashMap$EntrySetView;
+6 -1: ibm862
+8 -1: getLongL
+32 -1: (Ljava/lang/invoke/MemberName;)J
+67 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction<Lsun/misc/Perf;>;
+6 -1: region
+6 -1: ibm866
+89 -1: (Ljava/lang/Class;[Ljava/lang/Class;[Ljava/lang/Class;I)Lsun/reflect/ConstructorAccessor;
+22 -1: java/util/ListIterator
+9 -1: wednesday
+16 -1: unsuspendThreads
+20 -1: Not a Proxy instance
+45 -1: Ljava/lang/reflect/InvocationTargetException;
+61 -1: (Ljava/lang/CharSequence;II)Ljava/lang/AbstractStringBuilder;
+5 -1: ()TV;
+32 -1: (Ljava/lang/invoke/MemberName;)V
+82 -1: (Ljava/util/jar/JarFile;Ljava/util/jar/JarEntry;)[Ljava/security/cert/Certificate;
+34 -1: java/lang/ClassValue$ClassValueMap
+32 -1: (Ljava/lang/invoke/MemberName;)Z
+15 -1: SPACE_SEPARATOR
+17 -1: caseIgnoreCompare
+58 -1: (Ljava/lang/Class;)Ljava/lang/invoke/MethodHandles$Lookup;
+4 -1: Code
+3 -1: AGT
+54 -1: (Ljava/lang/StringBuilder;II)Ljava/lang/StringBuilder;
+6 -1: ibm874
+15 -1: newMemberBuffer
+42 -1: (Ljava/nio/file/Path;)Ljava/nio/file/Path;
+33 -1: Ljava/lang/NumberFormatException;
+10 -1: Field.java
+67 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<-TK;+TU;>;)TU;
+4 -1: rows
+12 -1: MIN_PRIORITY
+25 -1: URI has a query component
+41 -1: provider security provider debugging
+29 -1: sun/nio/cs/ISO_8859_1$Encoder
+26 -1: (Ljava/util/zip/ZipFile;)I
+26 -1: (Ljava/util/zip/ZipFile;)J
+20 -1: Bad digit at end of
+29 -1: Ljava/lang/RuntimePermission;
+12 -1: initResolved
+9 -1: loadFence
+13 -1: fieldAccessor
+26 -1: (Ljava/util/zip/ZipFile;)V
+36 -1: java/lang/CloneNotSupportedException
+19 -1: getBasicConstraints
+16 -1: putOrderedObject
+26 -1: (Ljava/util/zip/ZipFile;)Z
+6 -1: target
+50 -1: (Ljava/util/concurrent/CountedCompleter;[I[IIIII)V
+16 -1: changeReturnType
+13 -1: CAUSE_CAPTION
+14 -1: checkExactType
+50 -1: sun/util/locale/provider/LocaleServiceProviderPool
+47 -1: java/lang/invoke/DirectMethodHandle$Constructor
+20 -1: CallerSensitive.java
+30 -1: java/security/ProtectionDomain
+26 -1: java.launcher.opt.vmselect
+4 -1: \tat
+42 -1: java/util/ArraysParallelSortHelpers$FJLong
+39 -1: (Ljava/lang/String;)[Ljava/lang/String;
+19 -1: sun.net.www.content
+34 -1: ([III)Ljava/util/stream/IntStream;
+20 -1: (Ljava/util/Deque;)V
+35 -1: (Ljava/lang/reflect/Constructor;)[B
+16 -1: WeakHashMap.java
+8 -1: ([III)[I
+46 -1: (Ljava/util/Properties;Ljava/io/InputStream;)V
+54 -1: (I)Ljava/util/concurrent/ConcurrentHashMap$KeySetView;
+65 -1: (ILjava/lang/Object;Ljava/lang/Object;ZZ)Ljava/util/HashMap$Node;
+27 -1: URI path component is empty
+3 -1: -1-
+32 -1: Ljava/io/InterruptedIOException;
+9 -1: setLocale
+7 -1: [^, ;]*
+6 -1: format
+61 -1: (Ljava/util/function/Supplier;IZ)Ljava/util/stream/IntStream;
+20 -1: getRequestProperties
+16 -1: reallocateMemory
+28 -1: java/lang/IllegalAccessError
+5 -1: query
+83 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class;II)Ljava/lang/invoke/MethodHandle;
+7 -1: threadQ
+6 -1: STATIC
+7 -1: enqueue
+21 -1: uninitializedCallSite
+3 -1: -2-
+26 -1: ()Ljava/util/NavigableSet;
+27 -1: getUncaughtExceptionHandler
+42 -1: ([Ljava/net/URL;)Ljava/net/URLClassLoader;
+30 -1: java/lang/UnsatisfiedLinkError
+39 -1: java/util/Collections$ReverseComparator
+7 -1: resolve
+4 -1: poll
+7 -1: (TE;I)V
+21 -1: : Unknown launch mode
+53 -1: (Ljava/lang/Class;)[Ljava/lang/annotation/Annotation;
+36 -1: sun.classloader.parentDelegationTime
+25 -1: java/net/URLStreamHandler
+39 -1: (Ljava/lang/Object;J)Ljava/lang/Object;
+53 -1: Ljava/util/Map<Ljava/lang/String;Ljava/lang/String;>;
+51 -1: java/util/ArraysParallelSortHelpers$FJDouble$Sorter
+26 -1: getAnnotatedParameterTypes
+18 -1: codePointCountImpl
+7 -1: threads
+12 -1: offsetBefore
+29 -1: ()Ljava/util/Collection<TV;>;
+58 -1: (Lsun/invoke/util/Wrapper;)Ljava/lang/invoke/MethodHandle;
+17 -1: DMH.invokeSpecial
+3 -1: -3-
+16 -1: decodeBufferLoop
+43 -1: java/util/concurrent/atomic/AtomicReference
+16 -1: reduceKeysToLong
+27 -1: newIllegalArgumentException
+3 -1: ALL
+5 -1: cache
+5 -1: queue
+4 -1: 8bit
+3 -1: -4-
+35 -1: Ljava/util/Set<Ljava/lang/String;>;
+9 -1: MIN_RADIX
+26 -1: ZipFileInflaterInputStream
+13 -1: MANIFEST_NAME
+18 -1: java/util/TimeZone
+175 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;Ljava/lang/invoke/MemberName;Ljava/lang/Class;Ljava/lang/invoke/DirectMethodHandle$1;)V
+16 -1: getContentLength
+11 -1: setDoOutput
+22 -1: (Ljava/io/Closeable;)V
+13 -1: TimeZone.java
+28 -1: sun/misc/ExtensionDependency
+6 -1: bindTo
+3 -1: -5-
+40 -1: ()[Ljava/util/WeakHashMap$Entry<TK;TV;>;
+20 -1: ()Lsun/misc/Cleaner;
+9 -1: compareTo
+68 -1: java/util/concurrent/ConcurrentHashMap$MapReduceMappingsToDoubleTask
+11 -1: checkedList
+14 -1: (ITK;TV;ZZ)TV;
+5 -1: greek
+3 -1: jar
+21 -1: (Ljava/lang/String;)B
+21 -1: (Ljava/lang/String;)C
+21 -1: (Ljava/lang/String;)D
+5 -1: (JS)V
+21 -1: (Ljava/lang/String;)F
+13 -1: LETTER_NUMBER
+14 -1: isAlphaNumeric
+21 -1: (Ljava/lang/String;)I
+73 -1: (Ljava/nio/charset/Charset;Ljava/lang/String;Ljava/lang/StringCoding$1;)V
+21 -1: (Ljava/lang/String;)J
+25 -1: makeExactOrGeneralInvoker
+3 -1: -6-
+25 -1: java/nio/StringCharBuffer
+21 -1: Ljava/util/Hashtable;
+8 -1: ENQUEUED
+8 -1: finalize
+22 -1: DirectLongBufferU.java
+21 -1: (Ljava/lang/String;)S
+10 -1: localhost:
+33 -1: isKnownNotToHaveSpecialAttributes
+21 -1: (Ljava/lang/String;)V
+45 -1: (Ljava/lang/Class<*>;[Ljava/lang/Class<*>;Z)V
+21 -1: (Ljava/lang/String;)Z
+22 -1: (Ljava/util/Vector;I)V
+44 -1: java/nio/charset/UnsupportedCharsetException
+23 -1: java/lang/CharacterName
+7 -1: checkIO
+33 -1: (I)Lsun/misc/URLClassPath$Loader;
+90 -1: (Ljava/lang/Class<*>;Ljava/lang/reflect/Constructor<*>;)Ljava/lang/reflect/Constructor<*>;
+18 -1: getHeaderFieldDate
+9 -1: MIN_VALUE
+95 -1: (Ljava/util/concurrent/locks/AbstractQueuedSynchronizer$ConditionObject;)Ljava/util/Collection;
+44 -1: (Ljava/lang/String;Z)Ljava/util/Enumeration;
+8 -1: NOVEMBER
+4 -1: gcal
+17 -1: getConnectTimeout
+124 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;[Ljava/lang/Object;)Ljava/lang/Object;
+24 -1: INDEXOFSUBLIST_THRESHOLD
+16 -1: isJulianLeapYear
+21 -1: reduceEntriesToDouble
+15 -1: getPrefixLength
+17 -1: is not param at
+14 -1: inDaylightTime
+39 -1: (Ljava/lang/Class;[I)Ljava/lang/Object;
+5 -1: force
+98 -1: (Ljava/lang/Class;Lsun/reflect/annotation/AnnotationType;Lsun/reflect/annotation/AnnotationType;)Z
+40 -1: (Lsun/reflect/ConstructorAccessorImpl;)V
+27 -1: RuntimeInvisibleAnnotations
+17 -1: checkTargetChange
+9 -1: skipBytes
+4 -1: port
+25 -1: sun/nio/cs/UTF_16$Encoder
+28 -1: MIN_SUPPLEMENTARY_CODE_POINT
+4 -1: node
+11 -1: not param:
+9 -1: debugInit
+6 -1: setURL
+14 -1: getMonthLength
+23 -1: ()Ljava/nio/ByteBuffer;
+17 -1: CALENDAR_JAPANESE
+11 -1: access$1400
+16 -1: ()Ljava/net/URI;
+29 -1: (IZ)Ljava/lang/StringBuilder;
+15 -1: Native Library
+30 -1: Invalid lambda deserialization
+14 -1: throwException
+18 -1: nothing to verify!
+23 -1: (Ljava/lang/Object;JF)V
+3 -1: ART
+16 -1: isExtClassLoader
+18 -1: Illegal Capacity:
+26 -1: java/util/zip/ZipException
+4 -1: /../
+34 -1: ([II)Ljava/util/Spliterator$OfInt;
+26 -1: (I)Ljava/util/Enumeration;
+60 -1: (Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodType;
+43 -1: not a field or nested class, no simple type
+12 -1: nextPutIndex
+15 -1: getConstructor0
+3 -1: AST
+11 -1: fromURIPath
+49 -1: (Ljava/util/Collections$UnmodifiableCollection;)V
+8 -1: makeImpl
+51 -1: (Ljava/util/WeakHashMap;Ljava/util/WeakHashMap$1;)V
+32 -1: (Ljava/util/function/Supplier;)V
+20 -1: namedFunctionInvoker
+37 -1: newGetBooleanIllegalArgumentException
+19 -1: (Ljava/io/File;ZI)V
+8 -1: NULL_KEY
+36 -1: Ljava/lang/reflect/Constructor<TT;>;
+21 -1: (Ljava/lang/Object;)B
+21 -1: (Ljava/lang/Object;)C
+21 -1: (Ljava/lang/Object;)D
+21 -1: (Ljava/lang/Object;)F
+30 -1: ()Lsun/util/locale/BaseLocale;
+21 -1: (Ljava/lang/Object;)I
+21 -1: (Ljava/lang/Object;)J
+10 -1: lineNumber
+95 -1: (JLjava/util/function/ToDoubleBiFunction<-TK;-TV;>;DLjava/util/function/DoubleBinaryOperator;)D
+16 -1: CoderResult.java
+44 -1: (Ljava/util/NavigableSet;Ljava/lang/Class;)V
+21 -1: (Ljava/lang/Object;)S
+13 -1: getNameString
+129 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;Ljava/lang/invoke/DirectMethodHandle$1;)V
+21 -1: (Ljava/lang/Object;)V
+21 -1: (Ljava/lang/Object;)Z
+81 -1: Ljava/util/HashMap<Ljava/lang/String;Ljava/util/LinkedList<Ljava/lang/String;>;>;
+49 -1: java/util/concurrent/locks/ReentrantLock$FairSync
+11 -1: csisolatin0
+11 -1: csisolatin1
+7 -1: isSpace
+10 -1: getDefault
+11 -1: csisolatin2
+16 -1: ()Ljava/net/URL;
+11 -1: csisolatin4
+14 -1: invokeExact_MT
+11 -1: csisolatin5
+28 -1: (Ljava/io/FileInputStream;)V
+11 -1: csisolatin9
+8 -1: isLetter
+15 -1: getConstructors
+21 -1: mainAppContextDefault
+29 -1: ()[Ljava/lang/reflect/Method;
+23 -1: Ljava/util/WeakHashMap;
+12 -1: LF_INVSTATIC
+17 -1: DirectBuffer.java
+10 -1: newEncoder
+10 -1: getVersion
+32 -1: java/lang/IllegalAccessException
+20 -1: java/util/Collection
+61 -1: (Ljava/util/concurrent/ConcurrentHashMap;Ljava/lang/Object;)V
+19 -1: $deserializeLambda$
+8 -1: removeIf
+25 -1: sun/reflect/FieldAccessor
+129 -1: <U::Ljava/lang/Comparable<-TU;>;>(Ljava/util/function/Function<-TT;+TU;>;Ljava/util/Comparator<-TU;>;)Ljava/util/Comparator<TT;>;
+17 -1: parseAbsoluteSpec
+37 -1: ([Ljava/util/HashMap$Node<TK;TV;>;I)V
+17 -1: java/util/HashSet
+13 -1: spreadInvoker
+20 -1: suppressAccessChecks
+32 -1: Ljava/lang/InterruptedException;
+11 -1: oldMappings
+9 -1: lookupTag
+16 -1: java/lang/System
+5 -1: LFI:
+6 -1: IBM737
+9 -1: SHORT_IDS
+45 -1: ([IIILjava/util/function/IntBinaryOperator;)V
+20 -1: getMetaInfEntryNames
+10 -1: isReadOnly
+50 -1: <E:Ljava/lang/Object;>()Ljava/util/SortedSet<TE;>;
+12 -1: java.vm.name
+30 -1: java/lang/Class$AnnotationData
+61 -1: (ILjava/lang/invoke/LambdaForm;)Ljava/lang/invoke/LambdaForm;
+7 -1: address
+44 -1: (Ljava/util/function/BiConsumer<-TK;-TV;>;)V
+58 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;I)V
+112 -1: (Ljava/lang/Object;TV;Ljava/lang/ref/ReferenceQueue<Ljava/lang/Object;>;ILjava/util/WeakHashMap$Entry<TK;TV;>;)V
+14 -1: aliases_KOI8_R
+3 -1: AWT
+14 -1: aliases_KOI8_U
+24 -1: ARRAY_DOUBLE_BASE_OFFSET
+23 -1: Ljava/util/jar/JarFile;
+91 -1: (Ljava/lang/Class<TT;>;[Ljava/lang/Class<*>;[Ljava/lang/Class<*>;IILjava/lang/String;[B[B)V
+14 -1: mappingAddress
+19 -1: [Ljava/lang/Object;
+17 -1: sun/misc/JarIndex
+9 -1: image/jpg
+49 -1: (Ljava/lang/String;I)Lsun/util/calendar/ZoneInfo;
+37 -1: java/lang/invoke/DirectMethodHandle$1
+34 -1: java/util/Collections$SingletonMap
+89 -1: (JLjava/util/function/ToIntBiFunction<-TK;-TV;>;ILjava/util/function/IntBinaryOperator;)I
+46 -1: (Ljava/util/Comparator;)Ljava/util/Comparator;
+11 -1: isTitleCase
+38 -1: java/lang/IllegalMonitorStateException
+33 -1: java/nio/BufferUnderflowException
+28 -1: java/lang/ClassValue$Version
+11 -1: printLocale
+13 -1: STORE_BARRIER
+42 -1: ([ILjava/util/function/IntUnaryOperator;)V
+26 -1: sun/util/locale/BaseLocale
+29 -1: java/io/ObjectStreamException
+41 -1: sun/reflect/UnsafeStaticFieldAccessorImpl
+60 -1: ([Ljava/lang/Object;Ljava/util/Iterator;)[Ljava/lang/Object;
+30 -1: (Ljava/nio/charset/Charset;)[B
+73 -1: ([Ljava/lang/String;[Ljava/lang/String;Ljava/io/File;)Ljava/lang/Process;
+3 -1: VST
+80 -1: Java(TM) SE Runtime Environment (build 1.8.0-internal-iklam_2013_11_27_21_25-b00
+85 -1: (Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/net/URLStreamHandler;)V
+20 -1: getStackTraceElement
+36 -1: java/util/LinkedHashMap$LinkedKeySet
+17 -1: getNormalizedYear
+15 -1: maxBytesPerChar
+16 -1: java/util/Random
+34 -1: (I[C)Ljava/lang/invoke/LambdaForm;
+11 -1: nbits < 0:
+7 -1: H_PCHAR
+29 -1: (Ljava/nio/charset/Charset;)I
+36 -1: (I[I[C)Ljava/lang/invoke/LambdaForm;
+23 -1: java/lang/ClassLoader$1
+23 -1: java/lang/ClassLoader$2
+23 -1: java/lang/ClassLoader$3
+9 -1: sizeTable
+36 -1: (Z)Ljava/lang/AbstractStringBuilder;
+29 -1: (Ljava/nio/charset/Charset;)V
+25 -1: ARRAY_BOOLEAN_INDEX_SCALE
+29 -1: (Ljava/nio/charset/Charset;)Z
+6 -1: keySet
+20 -1: declaredConstructors
+25 -1: oracle/jrockit/jfr/Timing
+12 -1: sizeIsSticky
+6 -1: IBM775
+17 -1: currentTimeMillis
+28 -1: java/nio/DirectDoubleBufferS
+71 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/invoke/MethodType;B)V
+28 -1: java/nio/DirectDoubleBufferU
+19 -1: cachedFixedDateJan1
+15 -1: getClassContext
+65 -1: (Ljava/security/CodeSource;Ljava/security/PermissionCollection;)V
+16 -1: unmodifiableList
+10 -1: getDoubleB
+82 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;)Ljava/lang/String;
+11 -1: getEntryCrc
+10 -1: getDoubleL
+20 -1: (C)Ljava/lang/Class;
+11 -1: Null action
+22 -1: java/io/BufferedWriter
+67 -1: (Ljava/lang/String;[Ljava/lang/Class<*>;)Ljava/lang/reflect/Method;
+22 -1: parseSelectAnnotations
+6 -1: rename
+20 -1: acquireFieldAccessor
+43 -1: (Ljava/util/Vector;[Ljava/lang/Object;III)V
+32 -1: Ljava/lang/NullPointerException;
+29 -1: (Ljava/lang/ThreadLocal<*>;)V
+18 -1: descendingIterator
+37 -1: java/util/Collections$SynchronizedSet
+24 -1: mark/reset not supported
+12 -1: ) > toIndex(
+13 -1: <<ALL FILES>>
+10 -1: fastRemove
+4 -1: load
+31 -1: sun/reflect/ReflectionFactory$1
+39 -1: (Ljava/util/List<*>;)Ljava/lang/Object;
+39 -1: Ljava/util/Map<TE;Ljava/lang/Boolean;>;
+9 -1: offerLast
+31 -1: ()Ljava/lang/invoke/MethodType;
+40 -1: <E:Ljava/lang/Object;>Ljava/lang/Object;
+17 -1: getObjectVolatile
+14 -1: suspendThreads
+55 -1: (Ljava/lang/String;ZLjava/util/Set;)Lsun/misc/Resource;
+75 -1: <T:Ljava/lang/Object;>(Ljava/util/List<+Ljava/lang/Comparable<-TT;>;>;TT;)I
+6 -1: Lookup
+20 -1: java/io/OutputStream
+41 -1: Could not create application class loader
+28 -1: Lsun/misc/JavaUtilJarAccess;
+46 -1: java/util/Collections$SynchronizedNavigableSet
+8 -1: override
+21 -1: threadLocalRandomSeed
+10 -1: TEXT_PLAIN
+22 -1: ([B)Ljava/lang/String;
+29 -1: java/nio/InvalidMarkException
+14 -1: Throwable.java
+27 -1: newWrongMethodTypeException
+6 -1: ptypes
+8 -1: bugLevel
+62 -1: (ILjava/lang/CharSequence;II)Ljava/lang/AbstractStringBuilder;
+37 -1: ()Ljava/util/Locale$LocaleNameGetter;
+14 -1: getEntryMethod
+7 -1: getByte
+12 -1: UTF-32BE-BOM
+4 -1: lock
+34 -1: java/security/AccessControlContext
+79 -1: (Ljava/lang/String;Ljava/lang/invoke/MethodType;I)Ljava/lang/invoke/MemberName;
+5 -1: DEBUG
+5 -1: unbox
+17 -1: CLASSPATH_OPTOSFT
+4 -1: cbrt
+21 -1: LocalizedObjectGetter
+21 -1: ProtectionDomain.java
+22 -1: ([J)Ljava/util/BitSet;
+17 -1: getUnresolvedName
+34 -1: (Ljava/util/Map;Ljava/util/Map;I)V
+7 -1: cskoi8r
+14 -1: getInterfaces0
+48 -1: (Lsun/net/www/MessageHeader;)[Ljava/lang/String;
+14 -1: getFileNameMap
+16 -1: preserveCombiner
+19 -1: getDefaultUseCaches
+57 -1: (Ljava/lang/Class;[B[Ljava/lang/Object;)Ljava/lang/Class;
+21 -1: (D)Ljava/lang/Double;
+15 -1: iso8859_15_fdis
+23 -1: java/util/regex/Pattern
+6 -1: ibm912
+14 -1: findBuiltinLib
+42 -1: java/lang/annotation/AnnotationFormatError
+6 -1: ibm914
+6 -1: ibm915
+44 -1: java/nio/charset/IllegalCharsetNameException
+22 -1: COMBINING_SPACING_MARK
+20 -1: ()Ljava/lang/Thread;
+8 -1: readLine
+12 -1: (unresolved
+65 -1: (Ljava/lang/String;Z)Ljava/util/Enumeration<Lsun/misc/Resource;>;
+41 -1: ([Ljava/lang/String;[Ljava/lang/String;)V
+30 -1: java/lang/Class$ReflectionData
+8 -1: requests
+52 -1: (Ljava/nio/charset/Charset;Lsun/nio/cs/US_ASCII$1;)V
+12 -1: ACCESS_WRITE
+6 -1: ibm920
+12 -1: CR_ERROR_MIN
+6 -1: jarMap
+6 -1: ibm923
+15 -1: java/lang/Error
+11 -1: VM_SETTINGS
+18 -1: name can't be null
+7 -1: PRESENT
+19 -1: setSecurityManager0
+101 -1: (Ljava/nio/channels/WritableByteChannel;Ljava/nio/charset/CharsetEncoder;I)Lsun/nio/cs/StreamEncoder;
+25 -1: ()Ljava/util/jar/JarFile;
+26 -1: java/io/ObjectOutputStream
+13 -1: no !/ in spec
+5 -1: (II)C
+12 -1: setPriority0
+30 -1: (Z)[Ljava/lang/reflect/Method;
+28 -1: sun/nio/cs/ThreadLocalCoders
+5 -1: (II)I
+22 -1: java/io/BufferedReader
+26 -1: ()Lsun/misc/JavaNetAccess;
+10 -1: Asia/Dhaka
+14 -1: parallelStream
+5 -1: (II)V
+5 -1: (II)Z
+31 -1: Ljava/lang/reflect/Constructor;
+21 -1: ()Ljava/time/Instant;
+31 -1: (Ljava/lang/String;III[J[I[IZ)V
+8 -1: Volatile
+23 -1: isUnicodeIdentifierPart
+27 -1: longPrimitiveParameterCount
+16 -1: Map is non-empty
+24 -1: getLocalizedOutputStream
+14 -1: java/lang/Byte
+10 -1: staticBase
+11 -1: lastElement
+17 -1: replaceStaleEntry
+17 -1: MAX_LOW_SURROGATE
+28 -1: java.launcher.X.macosx.usage
+20 -1: registerShutdownHook
+16 -1: SECOND_IN_MILLIS
+8 -1: Embedded
+16 -1: BootstrapMethods
+14 -1: numInvocations
+79 -1: <T:Ljava/lang/Object;>(Ljava/util/Collection<TT;>;)Ljava/util/Enumeration<TT;>;
+10 -1: rotateLeft
+46 -1: ([Ljava/lang/Object;)Ljava/util/stream/Stream;
+6 -1: verify
+17 -1: OTHER_PUNCTUATION
+26 -1: acquireConstructorAccessor
+38 -1: (Ljava/lang/String;I)Ljava/lang/Class;
+30 -1: java/net/UnknownContentHandler
+20 -1: PREFIX_LENGTH_OFFSET
+12 -1: nextGetIndex
+14 -1: standardOffset
+10 -1: entryNames
+15 -1: application/xml
+3 -1: BET
+39 -1: ([DIII)Ljava/util/Spliterator$OfDouble;
+83 -1: (JLjava/util/function/BiFunction;Ljava/util/function/BiFunction;)Ljava/lang/Object;
+10 -1: initMethod
+47 -1: (Ljava/util/LinkedList$Node;)Ljava/lang/Object;
+8 -1: isSealed
+12 -1: isAccessible
+11 -1: audio/x-wav
+46 -1: (Ljava/lang/String;)Ljava/util/jar/Attributes;
+24 -1: ()Ljava/io/OutputStream;
+15 -1: FIELD_MODIFIERS
+30 -1: sun/misc/URLClassPath$Loader$1
+20 -1: recursive invocation
+34 -1: (Ljava/lang/String;)Ljava/net/URL;
+12 -1: linkNodeLast
+34 -1: call site initialization exception
+17 -1: casAnnotationType
+8 -1: x-ibm874
+7 -1: isUpper
+58 -1: java/util/concurrent/ConcurrentHashMap$MapReduceValuesTask
+31 -1: Ill-formed Unicode locale key:
+12 -1: defineClass0
+12 -1: defineClass1
+12 -1: defineClass2
+59 -1: Can not call newInstance() on the Class for java.lang.Class
+10 -1: codePoints
+3 -1: ...
+14 -1: readAheadLimit
+14 -1: parallelSetAll
+41 -1: ([Ljava/lang/Object;I)[Ljava/lang/Object;
+148 -1: (Ljava/lang/Throwable$PrintStreamOrWriter;[Ljava/lang/StackTraceElement;Ljava/lang/String;Ljava/lang/String;Ljava/util/Set<Ljava/lang/Throwable;>;)V
+10 -1: Deque.java
+21 -1: Must be volatile type
+7 -1: setForm
+58 -1: Ljava/lang/Number;Ljava/lang/Comparable<Ljava/lang/Byte;>;
+47 -1: (Ljava/lang/String;Ljava/security/CodeSource;)V
+30 -1: java/io/InterruptedIOException
+44 -1: java/util/Collections$SynchronizedCollection
+16 -1: Invalid Jar file
+32 -1: sun/util/calendar/CalendarSystem
+67 -1: (JLsun/util/calendar/CalendarDate;)Lsun/util/calendar/CalendarDate;
+19 -1: DEFAULT_BUFFER_SIZE
+16 -1: readObjectNoData
+16 -1: setJavaNioAccess
+73 -1: (Ljava/lang/invoke/LambdaForm$Name;[Ljava/lang/Object;)Ljava/lang/Object;
+14 -1: copyToIntArray
+10 -1: hasWaiters
+20 -1: (I)Ljava/lang/Class;
+35 -1: all turn on all debugging
+14 -1: Invalid host:
+26 -1: Lsun/nio/cs/StreamEncoder;
+43 -1: sun/misc/JavaSecurityProtectionDomainAccess
+11 -1: getNamedCon
+8 -1: H_SERVER
+27 -1: java/util/function/Consumer
+12 -1: isLocalClass
+81 -1: (Ljava/util/LinkedHashMap$Entry<TK;TV;>;Ljava/util/LinkedHashMap$Entry<TK;TV;>;)V
+83 -1: Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/Comparable<Ljava/lang/Boolean;>;
+4 -1: exec
+43 -1: java/lang/reflect/InvocationTargetException
+35 -1: (Ljava/io/File;Ljava/lang/String;)V
+9 -1: modifiers
+35 -1: (Ljava/io/File;Ljava/lang/String;)Z
+9 -1: Byte.java
+12 -1: unknown mode
+18 -1: initializeVerifier
+24 -1: (Ljava/nio/ByteBuffer;)I
+22 -1: ([Ljava/lang/Object;)I
+11 -1: correctType
+6 -1: escape
+52 -1: (Ljava/security/ProtectionDomain;)Ljava/lang/String;
+11 -1: annotations
+121 -1: (Ljava/lang/Class;ILjava/lang/Class;Ljava/lang/String;Ljava/lang/Object;[Ljava/lang/Object;)Ljava/lang/invoke/MemberName;
+22 -1: using an instance of
+14 -1: getSpeciesData
+28 -1: ()Ljava/security/CodeSource;
+12 -1: JZENTRY_NAME
+24 -1: (Ljava/nio/ByteBuffer;)V
+4 -1: ZBSC
+22 -1: ([Ljava/lang/Object;)V
+7 -1: isParam
+165 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;Ljava/lang/String;)Ljava/lang/String;
+70 -1: (ILjava/util/List<Ljava/lang/Class<*>;>;)Ljava/lang/invoke/LambdaForm;
+24 -1: Ljava/io/FilePermission;
+22 -1: ([Ljava/lang/Object;)Z
+11 -1: mergeHeader
+11 -1: applyAsLong
+28 -1: (IJ)Ljava/lang/StringBuffer;
+10 -1: arityCheck
+52 -1: (ILjava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
+13 -1: toUpperCaseEx
+9 -1: nextIndex
+11 -1: start > end
+4 -1: long
+6 -1: Static
+27 -1: ()Ljava/lang/reflect/Field;
+10 -1: bufUpdater
+43 -1: averageBytesPerChar exceeds maxBytesPerChar
+105 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Lsun/util/locale/BaseLocale$1;)V
+23 -1: ARRAY_SHORT_INDEX_SCALE
+15 -1: getHeaderFields
+36 -1: java/util/HashMap$HashMapSpliterator
+10 -1: Guard.java
+29 -1: java/util/RandomAccessSubList
+6 -1: addAll
+7 -1: getTime
+16 -1: invokeHandleForm
+32 -1: sun/util/locale/LocaleExtensions
+16 -1: checkAndLoadMain
+19 -1: INTERFACE_MODIFIERS
+11 -1: resolveName
+20 -1: getContentLengthLong
+53 -1: (ICLjava/lang/Object;)Ljava/lang/invoke/MethodHandle;
+19 -1: name cannot be null
+23 -1: hasReceiverTypeDispatch
+12 -1: getExtension
+49 -1: Ljava/util/Set<Ljava/security/ProtectionDomain;>;
+114 -1: (Ljava/lang/String;[J[I[J[I[Lsun/util/calendar/ZoneInfoFile$ZoneOffsetTransitionRule;)Lsun/util/calendar/ZoneInfo;
+24 -1: NativeSignalHandler.java
+58 -1: (Ljava/lang/Thread;)Ljava/lang/ThreadLocal$ThreadLocalMap;
+10 -1: interface
+68 -1: (Ljava/lang/String;)Ljava/lang/invoke/BoundMethodHandle$SpeciesData;
+15 -1: addShutdownHook
+32 -1: java/security/AccessController$1
+10 -1: filterTags
+19 -1: [Ljava/lang/Number;
+92 -1: <T:Ljava/lang/Object;>(Ljava/util/function/ToLongFunction<-TT;>;)Ljava/util/Comparator<TT;>;
+43 -1: java/util/LinkedHashMap$LinkedEntryIterator
+5 -1: utf-8
+11 -1: iso-8859-13
+11 -1: iso-8859-15
+58 -1: (Lsun/misc/URLClassPath$JarLoader;)Ljava/util/jar/JarFile;
+41 -1: CertPathValidator debugging
+22 -1: ARRAY_LONG_BASE_OFFSET
+57 -1: (Ljava/lang/Object;[Ljava/lang/Object;)Ljava/lang/Object;
+13 -1: queuePrintJob
+14 -1: Watchable.java
+15 -1: jdkMajorVersion
+62 -1: (Ljava/lang/String;ZJJ)Ljava/lang/management/MemoryPoolMXBean;
+23 -1: twoToTheDoubleScaleDown
+22 -1: registerVMNotification
+30 -1: ()Lsun/misc/JavaUtilJarAccess;
+17 -1: getTargetVolatile
+4 -1: exit
+13 -1: StringDecoder
+12 -1: hasRemaining
+9 -1: bigEndian
+14 -1: checkMulticast
+13 -1: clearProperty
+18 -1: ForEachMappingTask
+15 -1: Collection.java
+55 -1: (Ljava/io/InputStream;)Ljava/security/cert/Certificate;
+5 -1: UTF-8
+11 -1: transitions
+7 -1: wrapAlt
+27 -1: ClassNotFoundException.java
+20 -1: UnresolvedPermission
+14 -1: charsetForName
+9 -1: getParent
+18 -1: [Ljava/lang/Short;
+24 -1: UnmodifiableNavigableMap
+5 -1: xflow
+10 -1: interfaces
+19 -1: doubleToRawLongBits
+73 -1: (Ljava/lang/reflect/Constructor<*>;[Ljava/lang/Object;)Ljava/lang/Object;
+10 -1: getInCheck
+21 -1: (Ljava/lang/Thread;)V
+15 -1: fromIndex < 0:
+63 -1: (ITK;TV;Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;)V
+9 -1: pollFirst
+21 -1: (Ljava/lang/Thread;)Z
+16 -1: checkProxyMethod
+39 -1: generateLambdaFormInterpreterEntryPoint
+15 -1: findLoadedClass
+6 -1: system
+5 -1: ITALY
+45 -1: combiner SubjectDomainCombiner debugging
+34 -1: NativeConstructorAccessorImpl.java
+22 -1: ([C)Ljava/lang/String;
+39 -1: (Ljava/lang/String;Ljava/lang/Class;Z)V
+18 -1: java/lang/Thread$1
+20 -1: window can't be null
+10 -1: Debug.java
+17 -1: singletonIterator
+53 -1: java/util/concurrent/ConcurrentHashMap$ForEachKeyTask
+20 -1: java/security/Policy
+13 -1: getDescriptor
+32 -1: (I)Ljava/lang/invoke/MethodType;
+15 -1: nativeLibraries
+27 -1: sun/util/locale/LanguageTag
+8 -1: priority
+12 -1: IntegerCache
+14 -1: connectTimeout
+9 -1: namePairs
+17 -1: vmAllowSuspension
+16 -1: METHOD_MODIFIERS
+51 -1: (Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
+20 -1: MIN_TREEIFY_CAPACITY
+13 -1: getEntryBytes
+33 -1: ()Lsun/reflect/ReflectionFactory;
+17 -1: getDisplayCountry
+13 -1: isWrapperType
+5 -1: utf16
+12 -1: parallelSort
+27 -1: (Ljava/nio/ByteBuffer;IIZ)V
+56 -1: (Ljava/lang/Class;Ljava/lang/Class;ILjava/lang/Class;I)Z
+9 -1: isDefined
+20 -1: sun/misc/FloatConsts
+10 -1: putDoubleB
+30 -1: java/lang/NoSuchFieldException
+27 -1: Value out of range. Value:"
+36 -1: sun/reflect/NativeMethodAccessorImpl
+7 -1: decoder
+38 -1: ([Ljava/lang/invoke/MutableCallSite;)V
+10 -1: putDoubleL
+68 -1: (Ljava/lang/reflect/Method;)Lsun/reflect/generics/scope/MethodScope;
+37 -1: java/lang/invoke/MethodHandles$Lookup
+9 -1: Void.java
+28 -1: sun/util/locale/BaseLocale$1
+10 -1: stackTrace
+7 -1: toClass
+11 -1: access$1500
+41 -1: (Ljava/lang/Object;I)Ljava/lang/Class<*>;
+148 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;Ljava/lang/Object;JLjava/lang/invoke/DirectMethodHandle$1;)V
+22 -1: ARRAY_BYTE_BASE_OFFSET
+13 -1: ZipEntry.java
+56 -1: (Ljava/util/List;Ljava/util/Collection;)Ljava/util/List;
+5 -1: utf32
+16 -1: ISO_646.irv:1991
+5 -1: p-126
+20 -1: sun.net.www.protocol
+3 -1: key
+20 -1: IMPLEMENTATION_TITLE
+93 -1: (Lsun/util/locale/BaseLocale;Lsun/util/locale/LocaleExtensions;)Lsun/util/locale/LanguageTag;
+66 -1: ([Ljava/lang/Object;[Ljava/lang/Object;IIILjava/util/Comparator;)V
+27 -1: java/nio/DirectFloatBufferS
+27 -1: java/nio/DirectFloatBufferU
+15 -1: JZENTRY_COMMENT
+8 -1: casTabAt
+10 -1: getVariant
+24 -1: Ljava/lang/Thread$State;
+35 -1: ()Ljava/lang/AbstractStringBuilder;
+114 -1: (Ljava/security/CodeSource;Ljava/security/PermissionCollection;Ljava/lang/ClassLoader;[Ljava/security/Principal;)V
+16 -1: getShortVolatile
+18 -1: SoftReference.java
+3 -1: BST
+12 -1: isCastableTo
+28 -1: sun.zip.disableMemoryMapping
+11 -1: copyOfRange
+17 -1: ()Lsun/misc/Perf;
+59 -1: (Ljava/lang/String;[Ljava/io/File;Ljava/lang/ClassLoader;)V
+27 -1: (Lsun/misc/JavaAWTAccess;)V
+8 -1: DECLARED
+18 -1: loadedLibraryNames
+6 -1: CENNAM
+7 -1: encprop
+5 -1: ABASE
+27 -1: java/util/WeakHashMap$Entry
+13 -1: wrapWithPrims
+5 -1: UTF32
+29 -1: Ljava/net/URISyntaxException;
+6 -1: groups
+65 -1: <T:Ljava/lang/Object;>(Ljava/util/Set<+TT;>;)Ljava/util/Set<TT;>;
+32 -1: lambda$comparingByKey$6d558cbf$1
+15 -1: removeElementAt
+49 -1: [Ljava/util/concurrent/ConcurrentHashMap$Segment;
+32 -1: Sign character in wrong position
+6 -1: IBM819
+39 -1: java/security/cert/CertificateException
+4 -1: join
+30 -1: Ljava/lang/invoke/ForceInline;
+14 -1: expandCapacity
+19 -1: Ljava/lang/Integer;
+11 -1: NUMBER_THAI
+10 -1: getExtURLs
+9 -1: retainAll
+21 -1: (S)Ljava/lang/String;
+8 -1: truncate
+51 -1: java/util/ArraysParallelSortHelpers$FJObject$Sorter
+28 -1: newIndexOutOfBoundsException
+26 -1: JavaUtilJarAccessImpl.java
+22 -1: (II)Ljava/util/BitSet;
+10 -1: getLongAt0
+65 -1: <A::Ljava/lang/annotation/Annotation;>(Ljava/lang/Class<TA;>;)TA;
+26 -1: (Ljava/lang/ThreadLocal;)I
+5 -1: (J)[B
+27 -1: Ljava/lang/CharacterData00;
+18 -1: sun/misc/Cleaner$1
+59 -1: (Ljava/util/List;Ljava/lang/Object;Ljava/util/Comparator;)I
+114 -1: (JLjava/util/function/ToDoubleFunction<Ljava/util/Map$Entry<TK;TV;>;>;DLjava/util/function/DoubleBinaryOperator;)D
+28 -1: java/lang/ClassCastException
+26 -1: (Ljava/lang/ThreadLocal;)V
+27 -1: ()[Ljava/lang/reflect/Type;
+13 -1: not invoker:
+56 -1: (Ljava/net/URL;Ljava/net/Proxy;)Ljava/net/URLConnection;
+6 -1: before
+37 -1: ([DII)Ljava/util/stream/DoubleStream;
+9 -1: logicalOr
+9 -1: IS_METHOD
+12 -1: SPACE_USABLE
+12 -1: lastModified
+10 -1: setSigners
+8 -1: Invokers
+7 -1: nCopies
+12 -1: utf-32le-bom
+7 -1: (IIII)J
+17 -1: jdkSpecialVersion
+26 -1: ()Ljava/lang/StringBuffer;
+17 -1: SearchEntriesTask
+14 -1: java/net/Parts
+20 -1: Ljava/lang/Runnable;
+35 -1: java/util/WeakHashMap$ValueIterator
+19 -1: FinalReference.java
+7 -1: (IIII)V
+23 -1: Ljava/lang/ThreadGroup;
+10 -1: nullsFirst
+8 -1: setCache
+55 -1: (Ljava/util/List;Ljava/lang/Object;Ljava/lang/Object;)Z
+24 -1: java/util/SimpleTimeZone
+6 -1: IBM850
+6 -1: IBM852
+25 -1: sun/net/www/MeteredStream
+4 -1: exts
+6 -1: IBM855
+16 -1: allocateElements
+6 -1: IBM857
+19 -1: setDefaultUseCaches
+6 -1: IBM858
+5 -1: slice
+9 -1: marklimit
+77 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction<Ljava/lang/Void;>;
+32 -1: java/util/Collections$CheckedSet
+12 -1: getModifiers
+8 -1: protocol
+10 -1: getInteger
+33 -1: ([J)Ljava/util/stream/LongStream;
+6 -1: IBM862
+8 -1: Map.java
+35 -1: java/lang/Class$EnclosingMethodInfo
+25 -1: (J)Ljava/math/BigInteger;
+31 -1: (Ljava/net/URL;Ljava/io/File;)V
+6 -1: IBM866
+6 -1: unload
+28 -1: sun/invoke/util/VerifyAccess
+105 -1: ()Ljava/util/Map<Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;Ljava/lang/annotation/Annotation;>;
+25 -1: Resetting to invalid mark
+20 -1: java/util/Vector$Itr
+5 -1: SHIFT
+11 -1: NonfairSync
+18 -1: getSecurityManager
+34 -1: ()[Ljava/lang/ClassValue$Entry<*>;
+28 -1: (J)Ljava/lang/StringBuilder;
+28 -1: (Ljava/security/PublicKey;)V
+12 -1: getResources
+6 -1: IBM874
+27 -1: which Java does not define
+36 -1: (Ljava/lang/invoke/MethodTypeForm;)V
+48 -1: array length is not legal for long[] or double[]
+18 -1: IS_FIELD_OR_METHOD
+7 -1: Aliases
+17 -1: checkedExceptions
+13 -1: getDayOfMonth
+51 -1: (Ljava/util/Spliterator;Z)Ljava/util/stream/Stream;
+20 -1: java/io/EOFException
+26 -1: Enclosing method not found
+17 -1: flushLeftoverChar
+122 -1: (Ljava/lang/Class<*>;[Ljava/lang/Class<*>;[Ljava/lang/Class<*>;IILjava/lang/String;[B[B)Ljava/lang/reflect/Constructor<*>;
+18 -1: buildAnnotatedType
+21 -1: setContextClassLoader
+22 -1: java/io/UnixFileSystem
+20 -1: nonSyncContentEquals
+43 -1: java/util/Collections$SynchronizedSortedMap
+15 -1: Properties.java
+35 -1: com.oracle.usagetracker.config.file
+13 -1: java/util/Map
+18 -1: setEagerValidation
+13 -1: getSetMessage
+6 -1: unlock
+14 -1: refKindIsField
+22 -1: bad field type alias:
+17 -1: casAnnotationData
+6 -1: AUGUST
+106 -1: (Ljava/util/concurrent/CountedCompleter;[Ljava/lang/Object;[Ljava/lang/Object;IIIILjava/util/Comparator;)V
+11 -1: monitorExit
+17 -1: linkMethodTracing
+69 -1: (Ljava/lang/String;Ljava/lang/String;Lsun/util/locale/BaseLocale$1;)V
+21 -1: java/lang/ClassLoader
+39 -1: PKCS11 KeyStore debugging
+10 -1: checkRtype
+25 -1: getLocalGregorianCalendar
+23 -1: GenericDeclaration.java
+12 -1: isViewableAs
+22 -1: static_oop_field_count
+72 -1: (Ljava/util/function/ToDoubleFunction<-TT;>;)Ljava/util/Comparator<TT;>;
+11 -1: languageKey
+6 -1: Class
+34 -1: java/util/HashMap$ValueSpliterator
+37 -1: (IJ)Ljava/lang/AbstractStringBuilder;
+17 -1: privilegedContext
+36 -1: java/util/LinkedHashMap$LinkedValues
+11 -1: getHostName
+10 -1: beginEntry
+7 -1: isAlpha
+61 -1: (Ljava/lang/invoke/MethodType;I)Ljava/lang/invoke/LambdaForm;
+10 -1: expandArgs
+14 -1: Finalizer.java
+14 -1: timeDefinition
+28 -1: ()Ljava/util/jar/Attributes;
+14 -1: ansi_x3.4-1968
+11 -1: setPriority
+23 -1: (C)Ljava/lang/Class<*>;
+26 -1: (Ljava/lang/Object;TV;)TV;
+70 -1: (Ljava/util/function/BiFunction;Ljava/lang/Object;Ljava/lang/Object;)V
+48 -1: ()Lsun/reflect/generics/factory/GenericsFactory;
+25 -1: java/lang/invoke/CallSite
+8 -1: tzdb.dat
+17 -1: containsAllLimits
+17 -1: fileNameMapLoaded
+6 -1: values
+17 -1: setLastAccessTime
+12 -1: expandFromVM
+50 -1: java/lang/invoke/MethodHandle$PolymorphicSignature
+3 -1: .EC
+14 -1: access denied
+22 -1: java/util/AbstractList
+47 -1: (IILjava/lang/String;)Ljava/lang/StringBuilder;
+52 -1: ()Lsun/reflect/generics/repository/MethodRepository;
+22 -1: (Ljava/lang/String;)[B
+57 -1: (Ljava/lang/Object;)Ljava/lang/invoke/DirectMethodHandle;
+18 -1: compareAndSwapLong
+4 -1: !=
+6 -1: StdArg
+29 -1: (Ljava/security/Permission;)V
+22 -1: ([D)Ljava/lang/String;
+28 -1: Lsun/reflect/MethodAccessor;
+14 -1: ansi_x3.4-1986
+20 -1: getPeakFinalRefCount
+29 -1: (Ljava/security/Permission;)Z
+5 -1: debug
+38 -1: (Ljava/lang/reflect/Constructor<*>;)[B
+27 -1: java/util/GregorianCalendar
+16 -1: Null replacement
+26 -1: ()Ljava/lang/reflect/Type;
+28 -1: DIRECTIONALITY_LEFT_TO_RIGHT
+102 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)Lsun/util/locale/BaseLocale;
+15 -1: isConvertibleTo
+24 -1: ARRAY_DOUBLE_INDEX_SCALE
+16 -1: getComponentType
+29 -1: sun/util/locale/LocaleMatcher
+11 -1: LOCALECACHE
+6 -1: UNWRAP
+16 -1: AbstractSet.java
+3 -1: CAT
+36 -1: java/lang/annotation/RetentionPolicy
+14 -1: getParameters0
+8 -1: .Handler
+33 -1: Ljava/lang/IllegalStateException;
+10 -1: RAW_RETURN
+20 -1: java/lang/ClassValue
+16 -1: getDisplayString
+152 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>([Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;I)Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
+67 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>()Ljava/util/Map<TK;TV;>;
+214 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
+33 -1: java/lang/invoke/SerializedLambda
+42 -1: ([Ljava/lang/Object;II)[Ljava/lang/Object;
+22 -1: java/util/zip/ZipUtils
+9 -1: setDaemon
+26 -1: java/net/HttpURLConnection
+6 -1: mkdirs
+20 -1: (Ljava/io/Reader;I)V
+28 -1: (IC)Ljava/lang/StringBuffer;
+45 -1: ([Ljava/lang/Class<*>;I)[Ljava/lang/Class<*>;
+29 -1: java/lang/invoke/MethodHandle
+28 -1: sun/misc/CompoundEnumeration
+6 -1: setVal
+23 -1: INTERNED_ARGUMENT_LIMIT
+4 -1: NULL
+49 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Class;)Z
+43 -1: java/util/Collections$UnmodifiableSortedMap
+39 -1: (Ljava/lang/Object;Ljava/lang/Object;)I
+6 -1: ([JJ)I
+19 -1: java/io/PrintWriter
+25 -1: ()Ljava/lang/ThreadGroup;
+5 -1: (IJ)J
+16 -1: onMalformedInput
+15 -1: decrementAndGet
+11 -1: -2147483648
+6 -1: reduce
+12 -1: asCharBuffer
+39 -1: (Ljava/lang/Object;Ljava/lang/Object;)V
+44 -1: (Ljava/util/SortedSet;)Ljava/util/SortedSet;
+9 -1: backtrace
+3 3: Bar
+47 -1: ()Lsun/misc/JavaSecurityProtectionDomainAccess;
+39 -1: (Ljava/lang/Object;Ljava/lang/Object;)Z
+5 -1: (IJ)V
+6 -1: ([JJ)V
+22 -1: ([Ljava/lang/Thread;)I
+5 -1: (IJ)Z
+7 -1: ([BII)I
+79 -1: <T:Ljava/lang/Object;>(Ljava/util/Comparator<-TT;>;)Ljava/util/Comparator<TT;>;
+12 -1: getUnchecked
+10 -1: getBaseURL
+36 -1: (Ljava/lang/Object;)Ljava/util/List;
+53 -1: (Ljava/util/function/Function;)Ljava/util/Comparator;
+10 -1: getComment
+7 -1: ([BII)V
+30 -1: privateGetDeclaredConstructors
+58 -1: (Ljava/lang/String;ZILjava/util/Locale;)Ljava/lang/String;
+18 -1: unknown era name:
+13 -1: invokeSpecial
+9 -1: checkLink
+16 -1: cspc8codepage437
+6 -1: stream
+18 -1: sun/nio/cs/UTF_8$1
+18 -1: contextClassLoader
+50 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;I)V
+30 -1: sun/util/calendar/BaseCalendar
+11 -1: enumeration
+18 -1: key can't be empty
+137 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<Ljava/util/Map$Entry<TK;TV;>;+TU;>;Ljava/util/function/BiFunction<-TU;-TU;+TU;>;)TU;
+10 -1: getBoolean
+5 -1: eetop
+49 -1: (Ljava/lang/invoke/MethodType;)Ljava/lang/String;
+43 -1: sun/reflect/generics/scope/ConstructorScope
+13 -1: CANADA_FRENCH
+39 -1: Ljava/nio/channels/ReadableByteChannel;
+15 -1: java/lang/Float
+29 -1: DIRECTIONALITY_OTHER_NEUTRALS
+52 -1: (ZLjava/nio/charset/Charset;Ljava/io/OutputStream;)V
+8 -1: appendTo
+19 -1: PARAGRAPH_SEPARATOR
+16 -1: (Unknown Source)
+4 -1: tree
+38 -1: (I[C)Ljava/lang/AbstractStringBuilder;
+14 -1: VerifierStream
+48 -1: (Ljava/util/Collection<TE;>;Ljava/lang/Object;)V
+15 -1: releaseInflater
+20 -1: getHeaderNamesInList
+17 -1: getSystemPackages
+8 -1: teardown
+6 -1: (BZI)I
+10 -1: checkWrite
+19 -1: JavaLangAccess.java
+31 -1: Ljava/lang/ClassValue$Identity;
+50 -1: (Ljava/util/concurrent/CountedCompleter;[S[SIIII)V
+24 -1: getDeclaredConstructors0
+3 -1: /..
+3 -1: /./
+16 -1: hashCodeForCache
+18 -1: Property settings:
+26 -1: Illegal initial capacity:
+10 -1: text/plain
+61 -1: (Ljava/util/function/ToDoubleFunction;)Ljava/util/Comparator;
+24 -1: createMemoryManagerMBean
+10 -1: ,lastRule=
+9 -1: GMT-00:00
+5 -1: mtime
+40 -1: (Ljava/lang/String;I)[Ljava/lang/String;
+11 -1: (TT;TV;)TV;
+154 -1: (Ljava/lang/Class<*>;Ljava/lang/String;[Ljava/lang/Class<*>;Ljava/lang/Class<*>;[Ljava/lang/Class<*>;IILjava/lang/String;[B[B[B)Ljava/lang/reflect/Method;
+41 -1: (Ljava/util/jar/JarFile;)Ljava/util/List;
+43 -1: (JILjava/lang/Object;)Ljava/nio/ByteBuffer;
+19 -1: MethodTypeForm.java
+21 -1: java/util/jar/JarFile
+30 -1: java/lang/Integer$IntegerCache
+22 -1: getDisplayVariantArray
+6 -1: setAll
+13 -1: ClassValueMap
+52 -1: (Ljava/security/PublicKey;Ljava/security/Provider;)V
+51 -1: java/util/concurrent/ConcurrentHashMap$BaseIterator
+59 -1: (Ljava/lang/Runnable;Ljava/security/AccessControlContext;)V
+100 -1: (Ljava/util/concurrent/ConcurrentMap;Ljava/util/function/BiFunction;)Ljava/util/function/BiConsumer;
+8 -1: default
+13 -1: compareAndSet
+10 -1: iso8859-13
+9 -1: putShortB
+14 -1: skipDelimiters
+28 -1: URI has a fragment component
+10 -1: iso8859-15
+42 -1: (Ljava/net/Proxy;)Ljava/net/URLConnection;
+23 -1: needsPackageAccessCheck
+9 -1: putShortL
+3 -1: //[
+69 -1: (Ljava/security/AccessControlContext;Ljava/security/DomainCombiner;)V
+18 -1: too many arguments
+35 -1: ([III)Ljava/util/Spliterator$OfInt;
+10 -1: CopiesList
+10 -1: iso-8859-1
+9 -1: ([BII[C)I
+10 -1: iso-8859-2
+11 -1: returnCount
+10 -1: iso-8859-4
+10 -1: iso-8859-5
+8 -1: utf_16be
+10 -1: iso-8859-7
+9 -1: isLimited
+9 -1: parseByte
+10 -1: iso-8859-9
+13 -1: , s.length()
+10 -1: matchCerts
+14 -1: RECURSIVE_CHAR
+11 -1: reduceToInt
+11 -1: displayName
+9 -1: calendars
+64 -1: (Ljava/lang/String;ZLjava/util/jar/JarEntry;)Lsun/misc/Resource;
+11 -1: isProtected
+78 -1: (Ljava/util/SortedMap;Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/SortedMap;
+4 -1: trim
+20 -1: java/nio/FloatBuffer
+17 -1: PreHashedMap.java
+74 -1: Ljava/util/concurrent/ConcurrentMap<Ljava/lang/String;Ljava/lang/String;>;
+22 -1: ([S)Ljava/lang/String;
+19 -1: PrintStreamOrWriter
+38 -1: java/util/Collections$EmptyEnumeration
+22 -1: java/util/LinkedList$1
+13 -1: sunpkcs11.jar
+25 -1: java/nio/DirectByteBuffer
+96 -1: (ZLjava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle;
+7 -1: isArray
+43 -1: (Ljava/lang/String;)Ljava/util/Enumeration;
+52 -1: java/lang/invoke/MethodHandleImpl$AsVarargsCollector
+59 -1: (Ljava/lang/String;Lsun/misc/Resource;)Ljava/lang/Class<*>;
+26 -1: setJavaNetHttpCookieAccess
+15 -1: wrongTargetType
+57 -1: java/util/concurrent/ConcurrentHashMap$ForEachMappingTask
+33 -1: [Ljava/lang/reflect/TypeVariable;
+5 -1: load0
+39 -1: (Ljava/lang/String;)Ljava/lang/Boolean;
+21 -1: isHeldByCurrentThread
+14 -1: outOfBoundsMsg
+30 -1: Ljava/lang/ref/Reference$Lock;
+11 -1: ISO-8859-13
+84 -1: <T:Ljava/lang/Object;>(Ljava/lang/ClassValue<TT;>;)Ljava/lang/ClassValue$Entry<TT;>;
+11 -1: ISO-8859-15
+40 -1: (Ljava/net/URL;)Ljava/net/URLConnection;
+84 -1: <T:Ljava/lang/Object;:Ljava/lang/Comparable<-TT;>;>(Ljava/util/Collection<+TT;>;)TT;
+38 -1: sun/reflect/generics/scope/MethodScope
+5 -1: mutex
+11 -1: loaderTypes
+8 -1: defaults
+22 -1: getActualTypeArguments
+41 -1: DIRECTIONALITY_EUROPEAN_NUMBER_TERMINATOR
+4 -1: keys
+71 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
+94 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;I)Ljava/lang/invoke/MethodHandle;
+113 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractSet<TE;>;Ljava/util/Set<TE;>;Ljava/lang/Cloneable;Ljava/io/Serializable;
+12 -1: checkConnect
+39 -1: (Ljava/lang/String;Ljava/util/Locale;)V
+26 -1: ([CII[C)Ljava/lang/String;
+12 -1: isDoubleWord
+37 -1: configparser JAAS ConfigFile parsing
+27 -1: sun/misc/Perf$GetPerfAction
+44 -1: (Ljava/util/Collections$UnmodifiableList;I)V
+4 -1: acos
+26 -1: java/nio/DirectLongBufferS
+7 -1: (ITE;)V
+14 -1: putIntVolatile
+24 -1: setContentHandlerFactory
+26 -1: java/nio/DirectLongBufferU
+10 -1: fieldCount
+11 -1: invokeBasic
+50 -1: (Ljava/util/zip/ZipEntry;)Ljava/util/jar/JarEntry;
+24 -1: java/util/Locale$Builder
+9 -1: setParent
+11 -1: asLifoQueue
+33 -1: lambda$comparingDouble$8dcf42ea$1
+24 -1: (Ljava/lang/Throwable;)I
+35 -1: (Lsun/misc/JavaUtilZipFileAccess;)V
+49 -1: (ILjava/lang/Object;)Ljava/util/HashMap$TreeNode;
+10 -1: CLASS_PATH
+6 -1: tclass
+11 -1: getExponent
+23 -1: getAnnotatedReturnType0
+18 -1: checkPackageAccess
+35 -1: Can not instantiate java.lang.Class
+24 -1: (Ljava/lang/Throwable;)V
+195 -1: (Ljava/lang/invoke/LambdaForm$Name;Ljava/lang/invoke/LambdaForm$Name;Ljava/lang/invoke/BoundMethodHandle$SpeciesData;Ljava/lang/invoke/BoundMethodHandle$SpeciesData;)Ljava/lang/invoke/LambdaForm;
+17 -1: Empty replacement
+3 -1: .SF
+14 -1: ByteOrder.java
+39 -1: ()Lsun/util/calendar/BaseCalendar$Date;
+35 -1: ()[Ljava/security/ProtectionDomain;
+12 -1: setElementAt
+30 -1: (Ljava/security/CodeSource;Z)Z
+45 -1: (Ljava/lang/Class<*>;)Ljava/lang/ClassLoader;
+52 -1: (Ljava/nio/charset/Charset;)Ljava/util/zip/ZipCoder;
+13 -1: foldArguments
+23 -1: java/time/LocalDateTime
+30 -1: [Lsun/launcher/LauncherHelper;
+16 -1: 0123456789abcdef
+60 -1: (Ljava/util/Spliterator$OfInt;Z)Ljava/util/stream/IntStream;
+33 -1: (ILjava/lang/String;IIIIIIIIIII)V
+20 -1: DMH.newInvokeSpecial
+28 -1: java/nio/charset/CoderResult
+33 -1: sun/nio/cs/StandardCharsets$Cache
+11 -1: saveConvert
+14 -1: ExtClassLoader
+12 -1: parentOrNull
+20 -1: insertParameterTypes
+32 -1: (II)Ljava/util/stream/IntStream;
+13 -1: setStackTrace
+20 -1: is not an enum type
+3 -1: CNT
+4 -1: host
+85 -1: ([Ljava/lang/Object;Ljava/util/function/IntFunction;)Ljava/util/function/IntConsumer;
+11 -1: batchRemove
+8 -1: newField
+16 5: sun/nio/cs/UTF_8
+104 -1: (Ljava/lang/invoke/LambdaForm$Name;Ljava/lang/invoke/LambdaForm$Name;)Ljava/lang/invoke/LambdaForm$Name;
+8 -1: saturday
+35 -1: java/util/ArraysParallelSortHelpers
+15 -1: java/util/Queue
+40 -1: (Ljava/lang/Class<*>;)Ljava/lang/String;
+7 -1: toChars
+5 -1: first
+17 -1: ArrayDecoder.java
+30 -1: ()Lsun/reflect/MethodAccessor;
+26 -1: thread group can't be null
+13 -1: IllegalName:
+32 -1: java/util/Collections$SetFromMap
+14 -1: line.separator
+17 -1: getDeclaredMethod
+10 -1: getMinutes
+35 -1: (Lsun/util/locale/BaseLocale$Key;)I
+40 -1: ([Ljava/lang/String;)Ljava/lang/Process;
+31 -1: Ljava/util/LinkedHashMap$Entry;
+13 -1: , str.length
+8 -1: getProbe
+6 -1: ([DI)I
+5 -1: (CI)I
+23 -1: saveAndRemoveProperties
+6 -1: rehash
+3 -1: lcb
+31 -1: Ljava/util/Arrays$NaturalOrder;
+55 -1: (IILjava/lang/String;)Ljava/lang/AbstractStringBuilder;
+10 -1: loadFactor
+15 -1: putLongVolatile
+34 -1: sun/misc/URLClassPath$FileLoader$1
+12 -1: Europe/Paris
+8 -1: DECEMBER
+86 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction<Lsun/misc/Launcher$AppClassLoader;>;
+22 -1: getImplMethodSignature
+38 -1: Malformed enclosing method information
+8 -1: maskNull
+3 -1: lct
+21 -1: CONSTRUCTOR_MODIFIERS
+36 -1: ()Lsun/misc/JavaNetHttpCookieAccess;
+12 -1: HashIterator
+84 -1: (Ljava/lang/Class;Ljava/lang/Class$AnnotationData;Ljava/lang/Class$AnnotationData;)Z
+33 -1: java/lang/Character$UnicodeScript
+5 -1: toHex
+27 -1: java/security/AllPermission
+17 -1: appendReplacement
+20 -1: SimpleImmutableEntry
+18 -1: getRequestProperty
+12 -1: compareCerts
+44 -1: java/util/ArrayPrefixHelpers$IntCumulateTask
+19 -1: makeSpreadArguments
+222 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceEntriesTask;Ljava/util/function/Function;Ljava/util/function/BiFunction;)V
+8 -1: addFirst
+6 -1: nextUp
+35 -1: (Ljava/net/ContentHandlerFactory;)V
+40 -1: (Ljava/lang/String;)Ljava/lang/Class<*>;
+23 -1: java/util/LocaleISOData
+14 -1: PREPARED_FORMS
+6 -1: FJByte
+20 -1: getGenericSuperclass
+6 -1: offset
+16 -1: LocaleUtils.java
+12 -1: isUnresolved
+18 -1: aliases_ISO_8859_1
+18 -1: aliases_ISO_8859_2
+15 -1: isSurrogatePair
+18 -1: aliases_ISO_8859_4
+18 -1: aliases_ISO_8859_5
+6 -1: EXTLEN
+18 -1: aliases_ISO_8859_7
+15 -1: Comparator.java
+18 -1: aliases_ISO_8859_9
+15 -1: ISO_8859-2:1987
+22 -1: Ljava/util/List<+TE;>;
+16 -1: Unknown Category
+3 -1: CST
+51 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractList<TE;>;
+6 -1: FRIDAY
+40 -1: (Ljava/lang/String;ZZ)Ljava/lang/String;
+13 -1: isInterrupted
+8 -1: utf_16le
+89 -1: (BLjava/lang/Class<*>;Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/DirectMethodHandle;
+22 -1: checkInvocationCounter
+12 -1: EPOCH_OFFSET
+35 -1: (JJILjava/nio/DirectByteBuffer$1;)V
+7 -1: canRead
+9 -1: getLoader
+18 -1: publicConstructors
+23 -1: factory already defined
+33 -1: java/lang/ref/ReferenceQueue$Null
+37 -1: (Ljava/util/List;Ljava/util/Random;)V
+25 -1: setPackageAssertionStatus
+20 -1: MapReduceEntriesTask
+11 -1: OPEN_DELETE
+35 -1: (Ljava/util/Set;Ljava/lang/Class;)V
+9 -1: rootGroup
+10 -1: updateForm
+22 -1: JavaUtilJarAccess.java
+3 -1: CTT
+57 -1: (Lsun/reflect/MethodInfo;)Ljava/lang/reflect/Constructor;
+82 -1: <T:Ljava/lang/Object;>(Ljava/util/NavigableSet<TT;>;)Ljava/util/NavigableSet<TT;>;
+13 -1: getReturnType
+34 -1: java/util/HashMap$EntrySpliterator
+14 -1: TIME_UNDEFINED
+32 -1: com/sun/crypto/provider/AESCrypt
+7 -1: H_DIGIT
+20 -1: clearAssertionStatus
+44 -1: java/lang/invoke/MethodHandleImpl$BindCaller
+8 -1: scloader
+6 -1: IBM923
+5 -1: read0
+5 -1: read1
+4 -1: true
+9 -1: BA_HIDDEN
+16 -1: jvmUpdateVersion
+36 -1: java/lang/StringCoding$StringDecoder
+37 -1: (J)Ljava/nio/file/attribute/FileTime;
+3 -1: lib
+17 -1: getParameterTypes
+15 -1: FinalizerThread
+31 -1: ()Lsun/util/calendar/Gregorian;
+50 -1: (Ljava/lang/CharSequence;)Ljava/lang/StringBuffer;
+13 -1: PROP_SETTINGS
+33 -1: java/util/function/BinaryOperator
+70 -1: (ILjava/util/List<Ljava/lang/Class<*>;>;)Ljava/lang/invoke/MethodType;
+25 -1: getDefaultRequestProperty
+27 -1: (Ljava/util/jar/JarEntry;)V
+27 -1: SPLITERATOR_CHARACTERISTICS
+18 -1: FieldAccessor.java
+10 -1: setComment
+62 -1: (Ljava/lang/String;)Ljava/lang/management/MemoryManagerMXBean;
+11 -1: array_klass
+39 -1: ()Ljava/lang/Class$EnclosingMethodInfo;
+67 -1: ([Ljava/lang/ClassValue$Entry<*>;ILjava/lang/ClassValue$Entry<*>;)I
+9 -1: (II[CII)I
+50 -1: (Ljava/util/jar/JarFile;Ljava/util/zip/ZipEntry;)V
+20 -1: SPECIFICATION_VENDOR
+72 -1: (Lsun/misc/URLClassPath$JarLoader;Ljava/net/URL;)Ljava/util/jar/JarFile;
+87 -1: <T:Ljava/lang/Object;>(Ljava/lang/ThreadLocal<Ljava/lang/ref/SoftReference<TT;>;>;TT;)V
+9 -1: isVarArgs
+10 -1: setBoolean
+12 -1: (TK;TV;TV;)Z
+16 -1: findSharedClass0
+5 -1: csize
+49 -1: Ljava/security/cert/CertificateEncodingException;
+40 -1: java/util/concurrent/locks/ReentrantLock
+86 -1: (Ljava/io/OutputStream;Ljava/lang/Object;Ljava/lang/String;)Lsun/nio/cs/StreamEncoder;
+5 -1: ready
+38 -1: Ljava/security/AccessControlException;
+28 -1: UnmodifiableRandomAccessList
+69 -1: <T:Ljava/lang/Object;>([TT;Ljava/util/function/BinaryOperator<TT;>;)V
+27 -1: Ljava/lang/invoke/Invokers;
+39 -1: java/util/LinkedList$DescendingIterator
+11 -1: writeFields
+17 -1: classLoaderDepth0
+18 -1: permutedTypesMatch
+52 -1: (Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/List;
+12 -1: linkToStatic
+10 -1: CheckedMap
+6 -1: CENOFF
+8 -1: lastRule
+15 -1: java/lang/Short
+39 -1: ()Ljava/lang/Class$ReflectionData<TT;>;
+8 -1: nextDown
+14 -1: image/x-pixmap
+39 -1: (Ljava/lang/Class;[Ljava/lang/Object;)V
+25 -1: defineClassSourceLocation
+23 -1: sun/misc/PostVMInitHook
+15 -1: could not load
+16 -1: allowArraySyntax
+90 -1: Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater<Ljava/io/BufferedInputStream;[B>;
+10 -1: putBoolean
+11 -1: has params
+14 -1: setMaxPriority
+10 -1: mayContain
+46 -1: java/lang/reflect/MalformedParametersException
+10 -1: baseLocale
+14 -1: isSubwordOrInt
+10 -1: nextDouble
+32 -1: java/lang/Character$UnicodeBlock
+85 -1: (JLjava/util/function/ToDoubleBiFunction;DLjava/util/function/DoubleBinaryOperator;)D
+20 -1: numberOfLeadingZeros
+59 -1: (I[Ljava/lang/Class<*>;)[Ljava/lang/invoke/LambdaForm$Name;
+7 -1: setSize
+29 -1: java/io/FileNotFoundException
+9 -1: getString
+24 -1: ([CII)Ljava/lang/String;
+38 -1: (Ljava/lang/String;Ljava/lang/Class;)V
+5 -1: shift
+18 -1: getConstructorSlot
+41 -1: java/lang/ThreadLocal$SuppliedThreadLocal
+16 -1: UNASSIGNED_STACK
+20 -1: Malformed class name
+12 -1: ofEpochMilli
+34 -1: sun/launcher/LauncherHelper$StdArg
+33 -1: java/nio/ByteBufferAsShortBufferB
+7 -1: convert
+21 -1: ()[Ljava/util/Locale;
+15 -1: ISO_8859-5:1988
+35 -1: av[0] not instace of MethodHandle:
+33 -1: java/nio/ByteBufferAsShortBufferL
+5 -1: hypot
+16 -1: InputStream.java
+13 -1: reinvokerForm
+39 -1: JVMTI_THREAD_STATE_WAITING_INDEFINITELY
+16 -1: sun/misc/Version
+66 -1: <T::Ljava/lang/annotation/Annotation;>(Ljava/lang/Class<TT;>;)[TT;
+11 -1: codePointAt
+30 -1: ([Ljava/lang/reflect/Method;)V
+9 -1: duplicate
+9 -1: interface
+5 -1: X.509
+24 -1: SynchronizedNavigableSet
+8 -1: us-ascii
+17 -1: getUnresolvedType
+21 -1: PRIVATE_USE_EXTENSION
+4 -1: form
+93 -1: (Ljava/util/ArrayPrefixHelpers$LongCumulateTask;Ljava/util/function/LongBinaryOperator;[JII)V
+27 -1: sealing violation: package
+34 -1: RuntimeVisibleParameterAnnotations
+17 -1: LF_INVSTATIC_INIT
+14 -1: Gregorian.java
+32 -1: java/util/function/UnaryOperator
+3 -1: log
+3 -1: low
+22 -1: sun/misc/JavaNetAccess
+9 -1: getLength
+21 -1: getRawTypeAnnotations
+36 -1: (Ljava/lang/String;)Ljava/lang/Long;
+9 -1: getNumber
+66 -1: (ILjava/lang/Object;)Ljava/util/concurrent/ConcurrentHashMap$Node;
+20 -1: (Ljava/lang/Class;)C
+89 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Map$Entry<TK;TV;>;
+6 -1: ENDSIG
+20 -1: (Ljava/lang/Class;)I
+20 -1: (Ljava/lang/Class;)J
+24 -1: [[Ljava/io/Serializable;
+22 -1: serialPersistentFields
+7 -1: console
+142 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
+27 -1: (Ljava/nio/ByteBuffer;ICZ)V
+20 -1: (Ljava/lang/Class;)V
+40 -1: java/lang/ArrayIndexOutOfBoundsException
+6 -1: this$0
+51 -1: (Ljava/lang/invoke/MemberName;[Ljava/lang/Object;)V
+18 -1: packageAccessValid
+33 -1: ([Ljava/lang/StackTraceElement;)V
+8 -1: constant
+113 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;IILjava/security/ProtectionDomain;Ljava/lang/String;)Ljava/lang/Class<*>;
+8 -1: isMethod
+20 -1: (Ljava/lang/Class;)Z
+6 -1: ENDSIZ
+8 -1: newEntry
+57 -1: (Ljava/lang/Object;)Ljava/lang/IndexOutOfBoundsException;
+25 -1: (Ljava/util/Comparator;)V
+8 -1: isBridge
+6 -1: ([BI)I
+6 -1: ([BI)J
+16 -1: getReferenceKind
+26 -1: [Ljava/security/Principal;
+71 -1: (Ljava/lang/Class;[Ljava/lang/reflect/Field;)[Ljava/lang/reflect/Field;
+32 -1: ()Ljava/lang/ClassValue$Version;
+16 -1: SearchValuesTask
+17 -1: setCompressedSize
+16 -1: DEFAULT_CAPACITY
+108 -1: <K:Ljava/lang/Object;V::Ljava/lang/Comparable<-TV;>;>()Ljava/util/Comparator<Ljava/util/Map$Entry<TK;TV;>;>;
+27 -1: java/util/ComparableTimSort
+41 -1: null StackTraceElement in serial stream.
+6 -1: ([BI)V
+44 -1: (Ljava/util/jar/JarFile;)Lsun/misc/JarIndex;
+71 -1: (Ljava/util/jar/JarFile;Ljava/util/Enumeration;)Ljava/util/Enumeration;
+52 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Class<*>;)Z
+36 -1: [Ljava/lang/reflect/TypeVariable<*>;
+17 -1: OutputStream.java
+8 -1: combiner
+15 -1: decodeArrayLoop
+19 -1: (Ljava/io/Writer;)V
+41 -1: (Ljava/util/List<*>;Ljava/util/List<*>;)I
+35 -1: ()[Ljava/security/cert/Certificate;
+33 -1: ([I)Ljava/util/Spliterator$OfInt;
+9 -1: NF_asType
+17 -1: java/io/Closeable
+11 -1: updateBytes
+12 -1: charsets.jar
+18 -1: getDeclaredFields0
+47 -1: (Ljava/lang/Object;I)Ljava/lang/reflect/Member;
+60 -1: (Ljava/lang/String;ILjava/lang/String;)Ljava/nio/ByteBuffer;
+15 -1: getTotalSeconds
+57 -1: (Ljava/util/Collection<+Ljava/util/Map$Entry<TK;TV;>;>;)Z
+4 -1: JULY
+10 -1: Exceptions
+41 -1: ()Ljava/util/List<Ljava/io/IOException;>;
+14 -1: ParseUtil.java
+13 -1: getJarFileURL
+29 -1: setJavaIOFileDescriptorAccess
+24 -1: ARRAY_OBJECT_BASE_OFFSET
+21 -1: onUnmappableCharacter
+53 -1: (Ljava/lang/Object;Ljava/lang/Object;)Ljava/util/Map;
+24 -1: MethodHandleNatives.java
+40 -1: java/nio/charset/MalformedInputException
+37 -1: [Ljava/lang/reflect/AnnotatedElement;
+15 -1: CLASSPATH_CHARS
+18 -1: [Ljava/lang/Class;
+7 -1: FJFloat
+47 -1: <T:Ljava/lang/Object;>(Ljava/util/List<TT;>;I)V
+19 -1: Ljava/lang/Runtime;
+23 -1: java/lang/CharacterData
+42 -1: (Ljava/lang/Void;Ljava/lang/ClassLoader;)V
+76 -1: (Ljava/nio/channels/ReadableByteChannel;Ljava/nio/charset/CharsetDecoder;I)V
+56 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class;B)V
+19 -1: java/util/zip/CRC32
+33 -1: <T:Ljava/lang/Object;>([TT;I)[TT;
+22 -1: ([F)Ljava/lang/String;
+5 -1: UTF_8
+20 -1: aliases_UTF_32BE_BOM
+11 -1: Buffer.java
+78 -1: <T:Ljava/lang/Object;>(Ljava/util/Comparator<TT;>;)Ljava/util/Comparator<TT;>;
+44 -1: (Ljava/lang/String;)Ljava/util/zip/ZipEntry;
+9 -1: malformed
+4 -1: JUNE
+51 -1: (Ljava/util/jar/JarFile;Ljava/util/jar/JarFile$1;)V
+6 -1: locale
+34 -1: (Ljava/util/function/BiFunction;)V
+10 -1: setMinutes
+40 -1: (Ljava/lang/reflect/AccessibleObject;Z)V
+12 -1: maybeCompile
+46 -1: (Ljava/lang/Class;Ljava/lang/reflect/Method;)V
+7 -1: getEras
+55 -1: <T:Ljava/lang/Object;>([TT;Ljava/util/Iterator<*>;)[TT;
+17 -1: toUnsignedString0
+32 -1: (Ljava/lang/invoke/MethodType;)V
+32 -1: (Ljava/lang/invoke/MethodType;)Z
+10 -1: Class.java
+27 -1: ()Ljava/util/Iterator<TK;>;
+29 -1: WINDOWS_EPOCH_IN_MICROSECONDS
+41 -1: (Ljava/io/InputStream;)Ljava/lang/String;
+4 -1: prev
+24 -1: ()Ljava/util/Properties;
+11 -1: awaitBooted
+19 -1: generateConstructor
+22 -1: sun/misc/SharedSecrets
+19 -1: getDateTimeInstance
+43 -1: (IIILsun/util/calendar/BaseCalendar$Date;)J
+5 -1: setID
+11 -1: Locale.java
+12 -1: getRootGroup
+15 -1: setLastModified
+7 -1: trouble
+28 -1: (Z)Ljava/lang/StringBuilder;
+5 -1: setIO
+17 -1: loadClassInternal
+23 -1: java/lang/ref/Finalizer
+8 -1: EmptySet
+16 -1: aliases_UTF_16BE
+50 -1: (Ljava/util/NavigableMap;)Ljava/util/NavigableMap;
+15 -1: unmodifiableMap
+48 -1: (Ljava/lang/Class<*>;)Lsun/reflect/ConstantPool;
+15 -1: arrayContentsEq
+7 -1: EXT_TAG
+31 -1: (Ljava/util/HashMap$TreeNode;)Z
+5 -1: cp737
+22 -1: java/util/zip/Checksum
+5 -1: names
+22 -1: ConcurrentHashMap.java
+7 -1: ([J[J)Z
+7 -1: WAITING
+31 -1: sun.launcher.resources.launcher
+14 -1: getThreadGroup
+8 -1: PutField
+12 -1: hugeCapacity
+9 -1: isPackage
+72 -1: (Ljava/lang/ThreadLocal<*>;)Ljava/lang/ThreadLocal$ThreadLocalMap$Entry;
+23 7: sun/nio/ch/DirectBuffer
+13 -1: Checksum.java
+25 -1: (Ljava/nio/ByteBuffer;I)C
+51 -1: (Ljava/lang/invoke/MethodHandle;)Ljava/lang/Object;
+25 -1: (Ljava/nio/ByteBuffer;I)D
+7 -1: treeify
+25 -1: (Ljava/nio/ByteBuffer;I)F
+5 -1: setIn
+25 -1: (Ljava/nio/ByteBuffer;I)I
+20 -1: TRACE_METHOD_LINKAGE
+25 -1: (Ljava/nio/ByteBuffer;I)J
+7 -1: putIntB
+22 -1: createGarbageCollector
+50 -1: <T:Ljava/lang/Object;>(Ljava/lang/Class<TT;>;)[TT;
+25 -1: (Ljava/nio/ByteBuffer;I)S
+7 -1: putIntL
+19 -1: (B)Ljava/lang/Byte;
+14 -1: Hashtable.java
+29 -1: java/lang/ArrayStoreException
+11 -1: all_allowed
+16 -1: getLastRawOffset
+7 -1: inReady
+36 -1: java/lang/ThreadLocal$ThreadLocalMap
+40 -1: (ILjava/lang/String;Ljava/lang/String;)V
+23 -1: Ljava/lang/ThreadLocal;
+16 -1: classValueOrNull
+62 -1: (Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/MethodHandle;
+23 -1: preparedFieldLambdaForm
+22 -1: (Z)Ljava/lang/Boolean;
+14 -1: ThreadLocalMap
+27 -1: java/lang/StackTraceElement
+13 -1: getEntryCSize
+19 -1: java.security.debug
+53 -1: (Ljava/util/Collection<*>;Ljava/util/Collection<*>;)Z
+6 -1: LOCLEN
+40 -1: Ljava/lang/Class<Ljava/lang/Character;>;
+6 -1: (JJB)V
+66 -1: Ljava/util/Hashtable<Ljava/lang/String;Ljava/net/ContentHandler;>;
+31 -1: [[Ljava/lang/StackTraceElement;
+9 -1: putStatic
+16 -1: Asia/Ho_Chi_Minh
+15 -1: getDisplayNames
+13 -1: convertToAbbr
+23 -1: Method not implemented.
+15 -1: isCCLOverridden
+14 -1: doubleCapacity
+137 -1: (Ljava/lang/Class<*>;ZLjava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Class<*>;)Ljava/util/List<Ljava/lang/invoke/MemberName;>;
+219 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceKeysTask;Ljava/util/function/Function;Ljava/util/function/BiFunction;)V
+7 -1: native
+29 -1: (Ljava/lang/reflect/Field;Z)V
+18 -1: Ljava/util/Locale;
+31 -1: Ljava/util/concurrent/TimeUnit;
+16 -1: threadsSuspended
+7 -1: ([III)V
+20 -1: setMaxDelimCodePoint
+18 -1: contentClassPrefix
+13 -1: mappingOffset
+10 -1: toIndex =
+47 -1: (Ljava/lang/CharSequence;)Ljava/io/PrintStream;
+12 -1: booleanValue
+13 -1: putMapEntries
+17 -1: defaultBundleName
+50 -1: (Ljava/util/concurrent/CountedCompleter;[B[BIIII)V
+10 -1: executable
+20 -1: java/time/ZoneOffset
+28 -1: java/lang/ref/FinalReference
+11 -1: newTreeNode
+7 -1: lookup2
+10 -1: TableStack
+59 -1: Ljava/util/concurrent/ConcurrentHashMap$ValuesView<TK;TV;>;
+11 -1: getAccessor
+9 -1: available
+18 -1: java/io/FileReader
+34 -1: java/security/ProtectionDomain$3$1
+16 -1: integer overflow
+11 -1: internTable
+28 -1: Ljava/util/HashMap$TreeNode;
+19 -1: | invocationCounter
+12 -1: findResource
+9 -1: isLoaded0
+5 -1: cp775
+24 -1: DIRECTIONALITY_UNDEFINED
+9 -1: isInvalid
+7 -1: lookupN
+35 -1: (Lsun/reflect/MethodAccessorImpl;)V
+6 -1: ENDSUB
+4 -1: to
+59 -1: ([Ljava/lang/Object;IILjava/lang/Class;)[Ljava/lang/Object;
+10 -1: meta-index
+6 -1: INDENT
+9 -1: WEDNESDAY
+40 -1: ()Ljava/lang/annotation/RetentionPolicy;
+14 -1: getUsableSpace
+7 -1: TUESDAY
+51 -1: (Ljava/lang/Class;I)Ljava/lang/invoke/MethodHandle;
+12 -1: getSubjectDN
+21 -1: Ljava/io/InputStream;
+25 -1: (IC)Ljava/nio/CharBuffer;
+52 -1: (Ljava/nio/CharBuffer;)Ljava/util/function/Supplier;
+17 -1: ()[Ljava/net/URL;
+6 -1: search
+10 -1: Main-Class
+8 -1: ([CIIC)I
+16 -1: Certificate.java
+14 -1: spreadInvokers
+22 -1: sun/nio/cs/ISO_8859_15
+6 -1: accept
+18 -1: ReflectAccess.java
+13 -1: java/nio/Bits
+14 -1: linkToCallSite
+46 -1: Ljava/nio/charset/UnsupportedCharsetException;
+8 -1: ([CIIC)V
+9 -1: (TT;TV;)V
+26 -1: java/lang/OutOfMemoryError
+34 -1: policy loading and granting
+76 -1: (Ljava/nio/CharBuffer;ILjava/nio/ByteBuffer;I)Ljava/nio/charset/CoderResult;
+13 -1: x-windows-949
+21 -1: Ljava/io/PrintStream;
+9 -1: initNames
+12 -1: testAnyFlags
+65 -1: (Ljava/lang/reflect/Method;)Ljava/lang/invoke/DirectMethodHandle;
+34 -1: (Ljava/util/List;)Ljava/util/List;
+10 -1: CacheEntry
+10 -1: hasAllPerm
+26 -1: java/nio/charset/Charset$1
+26 -1: java/nio/charset/Charset$2
+19 -1: ()Ljava/util/Stack;
+26 -1: java/nio/charset/Charset$3
+62 -1: (Ljava/lang/String;)Lsun/util/calendar/LocalGregorianCalendar;
+23 -1: ARRAY_FLOAT_INDEX_SCALE
+23 -1: (Ljava/lang/Object;IS)V
+13 -1: x-windows-950
+31 -1: Ljava/util/Hashtable$Entry<**>;
+87 -1: Ljava/util/WeakHashMap<Ljava/lang/ClassValue$Identity;Ljava/lang/ClassValue$Entry<*>;>;
+9 -1: permClass
+37 -1: (Ljava/security/ProtectionDomain$3;)V
+99 -1: <S::Lsun/reflect/generics/tree/Signature;>Lsun/reflect/generics/repository/AbstractRepository<TS;>;
+37 -1: ()Ljava/util/function/BinaryOperator;
+64 -1: java/util/Collections$UnmodifiableNavigableMap$EmptyNavigableMap
+91 -1: (Ljava/util/ArrayPrefixHelpers$IntCumulateTask;Ljava/util/function/IntBinaryOperator;[III)V
+6 -1: getCrc
+25 -1: ByteArrayInputStream.java
+9 -1: SYNTHETIC
+52 -1: Ljava/lang/ref/PhantomReference<Ljava/lang/Object;>;
+246 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceKeysToDoubleTask;Ljava/util/function/ToDoubleFunction;DLjava/util/function/DoubleBinaryOperator;)V
+38 -1: java/lang/Throwable$WrappedPrintStream
+21 -1: Illegal load factor:
+43 -1: Ljava/util/Deque<Ljava/util/zip/Inflater;>;
+3 -1: map
+6 -1: expand
+6 -1: access
+3 -1: max
+33 -1: impliesCreateAccessControlContext
+3 -1: may
+53 -1: java/util/concurrent/ConcurrentHashMap$ReduceKeysTask
+91 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction<Lsun/misc/URLClassPath$Loader;>;
+60 -1: attempt to add a Permission to a readonly Permissions object
+21 -1: canonicalizeExtension
+11 -1: copyValueOf
+25 -1: (IJ)Ljava/nio/LongBuffer;
+112 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<-TV;+TU;>;Ljava/util/function/BiFunction<-TU;-TU;+TU;>;)TU;
+11 -1: DeqIterator
+11 -1: SpeciesData
+8 -1: getCause
+16 -1: aliases_UTF_16LE
+51 -1: (TT;TV;Ljava/util/function/BinaryOperator<TV;>;)TV;
+25 -1: (JF)Ljava/nio/ByteBuffer;
+16 -1: sun/misc/IOUtils
+32 -1: Ljava/util/Locale$FilteringMode;
+6 -1: .class
+13 -1: getPermission
+13 -1: startsWithLOC
+8 -1: Identity
+23 -1: ([BII)Ljava/lang/Class;
+15 -1: putByteVolatile
+36 -1: (Ljava/util/Deque;)Ljava/util/Queue;
+22 -1: (Ljava/lang/Object;S)V
+47 -1: java/util/concurrent/ConcurrentHashMap$BulkTask
+4 -1: n =
+9 -1: (ITE;)TE;
+5 -1: zeroD
+18 -1: formatUnsignedLong
+29 -1: default display locale =
+23 -1: java/io/File$PathStatus
+5 -1: zeroF
+20 -1: Ljava/util/Set<TK;>;
+20 -1: (Ljava/util/List;I)V
+5 -1: zeroI
+5 -1: zeroJ
+7 -1: context
+39 -1: Ljava/nio/channels/WritableByteChannel;
+5 -1: zeroL
+34 -1: Lsun/util/calendar/CalendarSystem;
+24 -1: JVMTI_THREAD_STATE_ALIVE
+18 -1: (Ljava/util/Set;)V
+18 -1: (Ljava/util/Set;)Z
+42 -1: (TT;Ljava/lang/ref/ReferenceQueue<-TT;>;)V
+7 -1: entries
+30 -1: (Ljava/util/WeakHashMap;IIII)V
+15 -1: csisolatingreek
+38 -1: ([Ljava/lang/Class;)Ljava/lang/Object;
+12 -1: isMalformed3
+12 -1: isMalformed4
+5 -1: FJInt
+23 -1: java/util/LinkedHashMap
+20 -1: malformedInputAction
+12 -1: Charset.java
+5 -1: LLL_L
+42 -1: (Ljava/util/Collection;)Ljava/lang/Object;
+22 -1: makeMethodHandleInvoke
+3 -1: mdt
+7 -1: unicode
+12 -1: newInstance0
+10 -1: checkCerts
+34 -1: java/util/WeakHashMap$HashIterator
+23 -1: (Ljava/lang/Object;JI)I
+9 -1: hexDigits
+13 -1: javaToDosTime
+24 -1: (I)Ljava/nio/LongBuffer;
+6 -1: A_DATA
+12 -1: deepToString
+23 -1: (Ljava/lang/Object;JI)V
+91 -1: (JLjava/util/function/ToLongBiFunction<-TK;-TV;>;JLjava/util/function/LongBinaryOperator;)J
+23 -1: bad spread array length
+11 -1: readTimeout
+14 -1: toAbsolutePath
+8 -1: isFinite
+19 -1: currentLoadedClass0
+3 -1: \xef\xbf\xbd
+23 -1: (Ljava/nio/file/Path;)I
+8 -1: handlers
+21 -1: (Ljava/util/List;II)V
+89 -1: (Lsun/misc/URLClassPath$Loader;Ljava/lang/String;Ljava/net/URL;Ljava/net/URLConnection;)V
+8 -1: OVERFLOW
+8 -1: newTable
+8 -1: THURSDAY
+6 -1: notify
+12 -1: initialValue
+35 -1: (I)Ljava/util/LinkedList$Node<TE;>;
+18 -1: AsVarargsCollector
+26 -1: (Lsun/misc/JavaIOAccess;)V
+18 -1: ()Ljava/lang/Void;
+23 -1: (Ljava/nio/file/Path;)Z
+16 -1: MINUTE_IN_MILLIS
+67 -1: (Ljava/lang/Class;[Ljava/lang/Class;Z)Ljava/lang/invoke/MethodType;
+18 -1: Ljava/util/Vector;
+70 -1: (Ljava/lang/reflect/Constructor;[Ljava/lang/Object;)Ljava/lang/Object;
+40 -1: (Ljava/lang/Object;ILjava/lang/Object;)V
+25 -1: UnresolvedPermission.java
+14 -1: ReduceKeysTask
+21 -1: ()[Ljava/lang/Object;
+129 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;E:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Collection<TE;>;Ljava/io/Serializable;
+16 -1: ClassLoader.java
+46 -1: Ljava/util/Comparators$NaturalOrderComparator;
+17 -1: compareAndSwapInt
+22 -1: packageDefinitionValid
+41 -1: ([Ljava/lang/Object;[Ljava/lang/Object;)Z
+162 -1: (Ljava/util/List<Ljava/util/Locale$LanguageRange;>;Ljava/util/Collection<Ljava/lang/String;>;Ljava/util/Locale$FilteringMode;)Ljava/util/List<Ljava/lang/String;>;
+16 -1: sun.zip.zipFiles
+17 -1: java_runtime_name
+31 -1: (Ljava/lang/ClassValue$Entry;)V
+31 -1: (Ljava/lang/ClassValue$Entry;)Z
+30 -1: <T:Ljava/lang/Object;>(TT;)TT;
+39 -1: JavaSecurityProtectionDomainAccess.java
+24 -1: (I)Ljava/lang/Throwable;
+7 -1: FJShort
+9 -1: putFloatB
+19 -1: checkedNavigableSet
+25 -1: java/lang/invoke/Invokers
+18 -1: setIfModifiedSince
+14 -1: parameterTypes
+41 -1: (Ljava/lang/Object;Ljava/lang/Runnable;)V
+9 -1: putFloatL
+11 -1: getTypeCode
+5 -1: (ZZ)I
+24 -1: java/lang/ProcessBuilder
+9 -1: UNDERFLOW
+21 -1: VolatileCallSite.java
+24 -1: (C)Ljava/nio/CharBuffer;
+55 -1: java/util/concurrent/ConcurrentHashMap$ForEachValueTask
+26 -1: (Ljava/lang/String;[CII)[B
+18 -1: reduceKeysToDouble
+5 -1: (ZZ)Z
+23 -1: setCallSiteTargetNormal
+3 -1: min
+4 -1: ceil
+62 -1: (Ljava/lang/String;)Ljava/util/LinkedList<Ljava/lang/String;>;
+29 -1: (Ljava/util/AbstractList;II)V
+32 -1: Ljava/lang/Class$AnnotationData;
+21 -1: createFileExclusively
+64 -1: (Ljava/lang/ref/SoftReference;I)Ljava/lang/Class$ReflectionData;
+26 -1: java/lang/Short$ShortCache
+54 -1: (Ljava/net/URL;Ljava/io/File;)Ljava/net/URLConnection;
+29 -1: Lsun/nio/cs/Surrogate$Parser;
+58 -1: (Ljava/lang/Class;)Lsun/reflect/annotation/AnnotationType;
+8 -1: findForm
+53 -1: Ljava/lang/invoke/MethodType$ConcurrentWeakInternSet;
+39 -1: (Lsun/misc/Perf;Ljava/nio/ByteBuffer;)V
+16 -1: mergePermissions
+11 -1: totalMemory
+53 -1: java/lang/invoke/DirectMethodHandle$EnsureInitialized
+139 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/AbstractMap<TK;TV;>;Ljava/util/concurrent/ConcurrentMap<TK;TV;>;Ljava/io/Serializable;
+29 -1: java/util/HashMap$KeyIterator
+20 -1: STACK_TRACE_SENTINEL
+5 -1: order
+18 -1: java/lang/Runnable
+8 -1: GetField
+13 -1: Empty command
+7 -1: CONTROL
+9 -1: blockedOn
+12 -1: testAllFlags
+11 -1: getInflater
+16 -1: threadTerminated
+44 -1: (Ljava/lang/ThreadGroup;Ljava/lang/String;)V
+20 -1: java.runtime.version
+8 -1: peekLast
+23 -1: java/util/ArrayList$Itr
+21 -1: (Ljava/util/Locale;)V
+13 -1: isOptimizable
+8 -1: FairSync
+7 -1: CHINESE
+15 -1: initHelpMessage
+30 -1: ()Ljava/util/HashMap$TreeNode;
+29 -1: Ljava/lang/SecurityException;
+7 -1: charset
+35 -1: sun/security/util/SecurityConstants
+19 -1: sun.nio.cs.bugLevel
+8 2: Foo.java
+49 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;)V
+12 -1: EntrySetView
+37 -1: (Lsun/misc/JavaNetHttpCookieAccess;)V
+35 -1: Ljava/util/Hashtable$Entry<TK;TV;>;
+20 -1: NF_constructorMethod
+8 -1: getMonth
+38 -1: (Ljava/util/Iterator;Ljava/util/Map;)V
+14 -1: getIntVolatile
+6 -1: [name=
+8 -1: oop_size
+20 -1: Can't load library:
+30 -1: ()Ljava/util/Spliterator<TV;>;
+33 -1: Lsun/reflect/ConstructorAccessor;
+61 -1: Ljava/lang/Number;Ljava/lang/Comparable<Ljava/lang/Integer;>;
+15 -1: printVmSettings
+33 -1: stack include stack trace
+45 -1: ([Ljava/lang/Object;I)Ljava/util/Spliterator;
+37 -1: sun/reflect/generics/scope/ClassScope
+36 -1: java/io/UnsupportedEncodingException
+24 -1: (J)Ljava/nio/LongBuffer;
+11 -1: addressSize
+15 -1: ByteBuffer.java
+62 -1: (Ljava/lang/String;)Lsun/reflect/generics/tree/ClassSignature;
+9 -1: (TT;TT;)I
+25 -1: java/io/DefaultFileSystem
+15 -1: BaseLocale.java
+14 -1: BitSetIterator
+17 -1: AbstractList.java
+57 -1: Ljava/lang/ref/WeakReference<Ljava/lang/ThreadLocal<*>;>;
+178 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
+9 -1: arguments
+26 -1: java/util/Locale$LocaleKey
+9 -1: setLength
+29 -1: sun/nio/cs/ISO_8859_1$Decoder
+9 -1: zipfs.jar
+24 -1: Ljava/util/zip/ZipCoder;
+14 -1: , new state =
+93 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;IIIJLjava/util/concurrent/ConcurrentHashMap;)V
+39 -1: java/security/PrivilegedExceptionAction
+9 -1: dnsns.jar
+20 -1: iteratorBinarySearch
+14 -1: initializePath
+22 -1: DefaultFileSystem.java
+17 -1: Ljava/util/Deque;
+8 -1: DEFLATED
+11 -1: Can't load
+9 -1: ArrayList
+21 -1: negativeZeroFloatBits
+41 -1: (Ljava/lang/String;ILjava/util/Locale;)[C
+14 -1: ANSI_X3.4-1968
+39 -1: sun/reflect/annotation/AnnotationType$1
+3 -1: mod
+62 -1: Ljava/nio/Buffer;Ljava/lang/Comparable<Ljava/nio/ByteBuffer;>;
+29 -1: interpretWithArgumentsTracing
+6 -1: getDay
+47 -1: sun/reflect/generics/repository/ClassRepository
+19 -1: refKindDoesDispatch
+20 -1: getAnnotationsByType
+14 -1: needsExpansion
+18 -1: lastIndexOfSubList
+26 -1: JavaUtilZipFileAccess.java
+59 -1: (Ljava/lang/CharSequence;)Ljava/lang/AbstractStringBuilder;
+12 -1: ptypesOffset
+8 -1: hashcode
+18 -1: ([Ljava/net/URL;)V
+8 -1: iso-ir-6
+7 -1: jzentry
+52 -1: only dump output if specified codebase
+31 -1: lambda$comparingLong$6043328a$1
+5 -1: MARCH
+14 -1: ANSI_X3.4-1986
+14 -1: isMalformed3_2
+7 -1: IS_TYPE
+68 -1: Ljava/lang/Object;Ljava/lang/Comparable<Ljava/nio/charset/Charset;>;
+30 -1: protocol doesn't support input
+17 -1: getExtClassLoader
+14 -1: setProxiedHost
+73 -1: ()Ljava/util/Map<Ljava/lang/String;Ljava/util/List<Ljava/lang/String;>;>;
+16 -1: traceInterpreter
+17 -1: (Ljava/net/URL;)I
+5 -1: expm1
+18 -1: createInheritedMap
+66 -1: java/util/concurrent/ConcurrentHashMap$ForEachTransformedEntryTask
+17 -1: getTimeOfDayValue
+15 -1: zeroLengthArray
+20 -1: invalid permission:
+6 -1: REPORT
+15 -1: isNumericString
+78 -1: (Ljava/util/Locale;Ljava/lang/String;[Ljava/lang/Object;)Ljava/util/Formatter;
+6 -1: (TV;)Z
+25 -1: Lsun/misc/JavaLangAccess;
+29 -1: (I)Ljava/lang/reflect/Method;
+17 -1: (Ljava/net/URL;)V
+34 -1: ()Ljava/lang/Class$ReflectionData;
+50 -1: java.lang.invoke.MethodHandle.TRACE_METHOD_LINKAGE
+10 -1: copyWith:
+17 -1: (Ljava/net/URL;)Z
+32 -1: ()Ljava/util/stream/Stream<TE;>;
+22 -1: quickCheckMemberAccess
+29 -1: ()Lsun/net/www/MessageHeader;
+19 -1: getAssignedCombiner
+8 -1: ([JIIJ)I
+17 -1: formatUnsignedInt
+68 -1: <V:Ljava/lang/Object;>Ljava/util/AbstractMap<Ljava/lang/String;TV;>;
+34 -1: java/nio/ByteBufferAsDoubleBufferB
+32 -1: ([I)Ljava/util/stream/IntStream;
+9 -1: init_lock
+18 -1: must be resolved:
+42 -1: ()Ljava/nio/channels/spi/SelectorProvider;
+8 -1: ([JIIJ)V
+33 -1: IncompatibleClassChangeError.java
+34 -1: java/nio/ByteBufferAsDoubleBufferL
+31 -1: ()Ljava/util/function/Function;
+43 -1: Ljava/lang/Enum<Ljava/io/File$PathStatus;>;
+17 -1: availableCharsets
+49 -1: java/util/ArraysParallelSortHelpers$FJChar$Sorter
+22 -1: permission=<classname>
+22 -1: getAnnotatedSuperclass
+20 -1: isObjectPublicMethod
+15 -1: Attempt to get
+10 -1: createLong
+14 -1: HASH_INCREMENT
+32 -1: sun/management/ManagementFactory
+13 -1: separatorChar
+15 -1: bad field type
+8 -1: november
+27 -1: (F)Ljava/lang/StringBuffer;
+3 -1: EAT
+3 -1: mst
+54 -1: (Ljava/lang/reflect/Method;)Ljava/lang/reflect/Method;
+18 -1: Ljava/lang/Object;
+7 -1: ;:&=+$,
+12 -1: Handler.java
+7 -1: isDirty
+127 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedAction<TT;>;Ljava/security/AccessControlContext;[Ljava/security/Permission;)TT;
+14 -1: asTypeUncached
+5 -1: split
+200 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/reflect/AnnotatedElement;Ljava/lang/Class;Ljava/lang/reflect/Type;Lsun/reflect/annotation/TypeAnnotation$TypeAnnotationTarget;)Ljava/lang/reflect/AnnotatedType;
+47 -1: java.lang.invoke.MethodHandle.TRACE_INTERPRETER
+22 -1: sun/invoke/empty/Empty
+66 -1: (Ljava/util/Map;Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/Map;
+18 -1: jvm_update_version
+32 -1: (Ljava/util/Map;)Ljava/util/Map;
+14 -1: cacheLoadLimit
+8 -1: javaHome
+52 -1: (Ljava/lang/reflect/Field;)Ljava/lang/reflect/Field;
+20 -1: [[Ljava/lang/Object;
+19 -1: isJavaLetterOrDigit
+11 -1: loadLibrary
+32 -1: java/io/StreamCorruptedException
+14 -1: setAccessible0
+27 -1: sun/nio/cs/UTF_16LE$Encoder
+60 -1: (Ljava/lang/String;[Ljava/lang/Object;)Ljava/io/PrintStream;
+8 -1: segments
+10 -1: UTF_8.java
+3 -1: ECT
+5 -1: cp813
+5 -1: cp819
+61 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/util/Comparator;)I
+5 -1: Cache
+4 -1: sinh
+32 -1: java/util/function/ToIntFunction
+10 -1: setFactory
+24 -1: Illegal mappings count:
+16 -1: fileToEncodedURL
+38 -1: Ljava/lang/annotation/RetentionPolicy;
+27 -1: Ljava/net/SocketPermission;
+46 -1: (Ljava/lang/CharSequence;I)[Ljava/lang/String;
+11 -1: cardinality
+13 -1: getMonthValue
+64 -1: (Ljava/lang/invoke/MethodType;II)Ljava/lang/invoke/MethodHandle;
+6 -1: ENDTOT
+12 -1: getBytesUTF8
+9 -1: cacheLoad
+13 -1: packageAccess
+14 -1: sharedToString
+5 -1: merge
+29 -1: parameter type cannot be void
+27 -1: makePreparedFieldLambdaForm
+40 -1: Couldn't find 3-letter country code for
+166 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/net/URL;Ljava/lang/ClassLoader;)V
+19 -1: (Ljava/util/Map;Z)V
+13 -1: setExecutable
+17 -1: objectFieldOffset
+57 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)V
+128 -1: (Ljava/lang/Class<*>;ZLjava/lang/String;Ljava/lang/Class<*>;Ljava/lang/Class<*>;)Ljava/util/List<Ljava/lang/invoke/MemberName;>;
+61 -1: java/util/concurrent/ConcurrentHashMap$MapReduceKeysToIntTask
+6 -1: asType
+25 -1: java/io/ObjectStreamField
+15 -1: jvmMajorVersion
+124 -1: (Ljava/security/PrivilegedExceptionAction;Ljava/security/AccessControlContext;[Ljava/security/Permission;)Ljava/lang/Object;
+23 -1: (Ljava/lang/Class<*>;)C
+6 -1: andNot
+15 -1: getResponseCode
+59 -1: (Ljava/lang/StringBuffer;)Ljava/lang/AbstractStringBuilder;
+23 -1: (Ljava/lang/Class<*>;)I
+7 -1: seeAllp
+44 -1: (Ljava/lang/ClassLoader;[Ljava/lang/Class;)V
+13 -1: loadFromCache
+35 -1: sun/nio/cs/HistoricallyNamedCharset
+38 -1: (Ljava/lang/Class;[Ljava/lang/Class;)V
+19 -1: INVOKER_METHOD_TYPE
+16 -1: putShortVolatile
+12 -1: Asia/Karachi
+8 -1: cyrillic
+12 -1: getISO2Table
+23 -1: (Ljava/lang/Class<*>;)V
+3 -1: 1.4
+15 -1: LongBuffer.java
+6 -1: (IFZ)V
+23 -1: (Ljava/lang/Class<*>;)Z
+10 -1: initOutput
+9 -1: CELLSBUSY
+39 -1: java/security/PrivilegedActionException
+31 -1: sun/util/calendar/CalendarUtils
+202 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/reflect/AnnotatedElement;Ljava/lang/Class;[Ljava/lang/reflect/Type;Lsun/reflect/annotation/TypeAnnotation$TypeAnnotationTarget;)[Ljava/lang/reflect/AnnotatedType;
+20 -1: Ljava/lang/Class<*>;
+5 -1: cp850
+25 -1: (JI)Ljava/nio/ByteBuffer;
+5 -1: cp852
+24 -1: Invalid parameter name "
+39 -1: ([CII)Ljava/lang/AbstractStringBuilder;
+5 -1: cp855
+11 -1: Deallocator
+5 -1: cp857
+5 -1: cp858
+7 -1: ([SI)[S
+37 -1: ([C)Ljava/lang/AbstractStringBuilder;
+27 -1: java/lang/SecurityException
+82 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class;Ljava/lang/invoke/MethodHandle;)V
+38 -1: (Ljava/lang/String;)Ljava/lang/String;
+7 -1: connect
+7 -1: isEmpty
+11 -1: replaceNode
+19 -1: SuppliedThreadLocal
+12 -1: asFixedArity
+12 -1: fromIndex =
+19 -1: createMemoryManager
+9 -1: List.java
+8 -1: FEBRUARY
+21 -1: UnicodeLittleUnmarked
+6 -1: a null
+30 -1: ()Ljava/util/Spliterator<TT;>;
+5 -1: cp862
+17 -1: ZoneInfoFile.java
+5 -1: cp866
+8 -1: BulkTask
+53 -1: java/util/concurrent/locks/AbstractQueuedSynchronizer
+20 -1: FileInputStream.java
+12 -1: java.vm.info
+10 -1: newDecoder
+5 -1: (JB)V
+8 -1: filePath
+17 -1: spreadArrayChecks
+44 -1: ([Ljava/lang/Object;Ljava/util/Comparator;)V
+33 -1: java/util/Collections$AsLIFOQueue
+32 -1: Ljava/util/LinkedList$Node<TE;>;
+5 -1: cp874
+78 -1: (Ljava/util/Locale;Ljava/lang/String;[Ljava/lang/Object;)Ljava/io/PrintStream;
+39 -1: (JLjava/util/function/Consumer<-TK;>;)V
+15 -1: appendCodePoint
+20 -1: primitiveReturnCount
+54 -1: only dump output if specified permission
+20 -1: getGenericInterfaces
+41 -1: ([Ljava/lang/reflect/AccessibleObject;Z)V
+17 -1: nUnstartedThreads
+33 -1: (Ljava/lang/invoke/MemberName;Z)V
+24 -1: ARRAY_OBJECT_INDEX_SCALE
+40 -1: (Ljava/lang/String;ILjava/util/Locale;)I
+17 -1: java/io/Flushable
+22 -1: newConstructorAccessor
+26 -1: sun/misc/JavaUtilJarAccess
+6 -1: booted
+10 -1: setDoInput
+36 -1: (Ljava/lang/Class;)[Ljava/lang/Enum;
+19 -1: java/lang/Character
+52 -1: ([Ljava/net/URL;Ljava/net/URLStreamHandlerFactory;)V
+24 -1: (Ljava/nio/LongBuffer;)I
+16 -1: start > length()
+28 -1: (I)Ljava/lang/CharacterData;
+5 -1: val$c
+61 -1: (Ljava/lang/Throwable;Ljava/lang/String;[Ljava/lang/Object;)V
+13 -1: resolveOrNull
+9 -1: L_ESCAPED
+27 -1: MapReduceValuesToDoubleTask
+15 -1: getPreparedForm
+33 -1: (I)[Ljava/util/WeakHashMap$Entry;
+54 -1: ()Ljava/util/stream/Stream<+Ljava/util/zip/ZipEntry;>;
+16 -1: bad method type
+5 -1: val$s
+17 -1: Null charset name
+36 -1: java/lang/invoke/LambdaForm$Compiled
+24 -1: (Ljava/util/SortedMap;)V
+19 -1: java/time/LocalTime
+29 -1: not invocable, no method type
+21 -1: recalculateWordsInUse
+6 -1: val$id
+39 -1: sun/security/util/ManifestEntryVerifier
+60 -1: ([Ljava/lang/Class<*>;I)Ljava/lang/reflect/Constructor<TT;>;
+45 -1: java/util/ArrayPrefixHelpers$LongCumulateTask
+5 -1: OfInt
+11 -1: environment
+60 -1: ([Ljava/lang/Class<*>;[B)[[Ljava/lang/annotation/Annotation;
+7 -1: (JJJZ)V
+10 -1: BufferPool
+6 -1: isUTF8
+12 -1: threadLocals
+35 -1: (Ljava/lang/String;)[Ljava/net/URL;
+21 -1: Ljava/nio/LongBuffer;
+15 -1: copyConstructor
+25 -1: setCallSiteTargetVolatile
+15 -1: getNumericValue
+26 -1: Ljava/security/CodeSource;
+18 -1: Null output stream
+14 -1: cloneWithIndex
+23 -1: LOCAL_LISTEN_PERMISSION
+6 -1: (TT;)I
+46 -1: (Ljava/security/PublicKey;Ljava/lang/String;)V
+6 -1: setCrc
+26 -1: java/io/FilterOutputStream
+10 -1: access$000
+10 -1: access$001
+10 -1: access$002
+6 -1: (TT;)V
+78 -1: <T:Ljava/lang/Object;U:Ljava/lang/Object;>([TU;IILjava/lang/Class<+[TT;>;)[TT;
+41 -1: java/util/concurrent/atomic/AtomicInteger
+8 -1: renameTo
+40 -1: (Ljava/lang/Class<*>;)Ljava/lang/Object;
+17 -1: getRawAnnotations
+29 -1: java/lang/VirtualMachineError
+37 -1: java/lang/management/MemoryPoolMXBean
+25 -1: (II)Ljava/util/List<TE;>;
+6 -1: utf_16
+23 -1: (Ljava/lang/String;[B)V
+19 -1: MIN_ARRAY_SORT_GRAN
+25 -1: array length is not legal
+45 -1: java/util/concurrent/locks/ReentrantLock$Sync
+36 -1: Ljava/security/AccessControlContext;
+48 -1: sun/reflect/generics/repository/MethodRepository
+24 -1: MethodHandleStatics.java
+24 -1: addThreadDumpForMonitors
+64 -1: <T:Ljava/lang/Object;>(Ljava/util/Set<TT;>;)Ljava/util/Set<TT;>;
+58 -1: (Ljava/lang/String;[Ljava/lang/Object;Ljava/lang/Object;)Z
+37 -1: (III)Lsun/util/calendar/CalendarDate;
+9 -1: createURI
+15 -1: unreserveMemory
+52 -1: (Lsun/reflect/MethodInfo;)Ljava/lang/reflect/Method;
+66 -1: (Ljava/lang/Class;[Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
+51 -1: (Ljava/lang/reflect/Constructor;)Ljava/lang/String;
+23 -1: inheritableThreadLocals
+63 -1: ()Ljava/util/Map<Ljava/lang/String;Ljava/lang/reflect/Method;>;
+16 -1: setContentLength
+16 -1: LOWERCASE_LETTER
+4 -1: size
+25 -1: java.launcher.opt.hotspot
+19 -1: buildAnnotatedTypes
+26 -1: JAVAFX_LAUNCHER_CLASS_NAME
+11 -1: getAliasMap
+19 -1: CheckedNavigableSet
+15 -1: getAbsolutePath
+11 -1: doubleValue
+6 -1: utf_32
+22 -1: IMPLEMENTATION_VERSION
+3 -1: ne1
+11 -1: contentType
+8 -1: canWrite
+11 -1: Object.java
+14 -1: America/Denver
+8 -1: fileName
+13 -1: allPermDomain
+27 -1: ()Ljava/util/Iterator<TE;>;
+31 -1: (Lsun/reflect/MethodAccessor;)V
+11 -1: asTypeCache
+13 -1: lineSeparator
+9 -1: JarLoader
+15 -1: replacementNode
+18 -1: getContentEncoding
+12 -1: invoke_LLL_L
+22 -1: ()Ljava/util/TimeZone;
+17 -1: Reference Handler
+33 -1: java/lang/invoke/MethodHandleImpl
+47 -1: ()Ljava/util/concurrent/ConcurrentHashMap$Node;
+12 -1: invoke_LLL_V
+8 -1: form <<
+23 -1: (Ljava/lang/Object;JJ)J
+15 -1: isHighSurrogate
+31 -1: (Ljava/util/Collection<+TV;>;)Z
+36 -1: ([Ljava/util/HashMap$Node<TK;TV;>;)V
+23 -1: (Ljava/lang/Object;JJ)V
+12 -1: utf_32be_bom
+40 -1: sun/util/calendar/LocalGregorianCalendar
+27 -1: [Ljava/security/CodeSigner;
+15 -1: afterNodeAccess
+13 -1: nextThreadNum
+18 -1: INTERNED_ARGUMENTS
+11 -1: getMillisOf
+18 -1: offsetByCodePoints
+11 -1: writeObject
+48 -1: (Ljava/util/Locale$Category;Ljava/util/Locale;)V
+3 -1: nfe
+41 -1: (Ljava/util/Properties;Ljava/io/Reader;)V
+50 -1: (Ljava/util/concurrent/CountedCompleter;[C[CIIII)V
+15 -1: implFlushBuffer
+33 -1: (I)[Ljava/lang/invoke/MemberName;
+12 -1: Unicode.java
+17 -1: DMH.invokeVirtual
+5 -1: setup
+51 -1: (Ljava/util/Collection;[Ljava/lang/reflect/Field;)V
+3 -1: EST
+7 -1: TREEBIN
+7 -1: getFile
+10 -1: isLeapYear
+18 -1: LinkedHashIterator
+14 -1: DISPLAY_SCRIPT
+25 -1: privateGetDeclaredMethods
+68 -1: (Ljava/util/function/Function;Ljava/lang/Object;Ljava/lang/Object;)I
+22 -1: ()Ljava/util/Iterator;
+21 -1: sun/management/Sensor
+15 -1: getAvailableIDs
+51 -1: Lsun/util/PreHashedMap<Ljava/nio/charset/Charset;>;
+8 -1: elot_928
+6 -1: LATIN0
+45 -1: ([Ljava/lang/Object;II[Ljava/lang/Object;II)V
+10 -1: [Unlocked]
+15 -1: internArguments
+6 -1: LATIN9
+33 -1: (II)Ljava/lang/invoke/MethodType;
+12 -1: Version.java
+17 -1: setConnectTimeout
+75 -1: (Ljava/util/Locale;Ljava/lang/String;[Ljava/lang/Object;)Ljava/lang/String;
+13 -1: highSurrogate
+12 -1: Africa/Cairo
+21 -1: synchronizedSortedMap
+21 -1: in java.library.path
+45 -1: sun/reflect/generics/tree/FormalTypeParameter
+24 -1: UncaughtExceptionHandler
+14 -1: previousOrSame
+24 -1: java/security/Permission
+9 -1: x-ISCII91
+5 -1: L_HEX
+35 -1: java/lang/invoke/DirectMethodHandle
+35 -1: java/util/ArrayDeque$DeqSpliterator
+14 -1: java/util/List
+11 -1: toLowerCase
+24 -1: java/nio/charset/Charset
+10 -1: MIN_NORMAL
+110 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
+13 -1: regionMatches
+17 -1: newMethodAccessor
+26 -1: (Ljava/net/InetAddress;B)V
+68 -1: (Ljava/util/zip/ZipFile;Ljava/lang/String;J)Ljava/util/zip/ZipEntry;
+22 -1: ()Ljava/io/FileSystem;
+19 -1: primitiveSimpleName
+5 -1: MOVED
+9 -1: STATE_RED
+13 -1: linkToSpecial
+19 -1: AnnotationType.java
+20 -1: (II)Ljava/util/List;
+252 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceMappingsToDoubleTask;Ljava/util/function/ToDoubleBiFunction;DLjava/util/function/DoubleBinaryOperator;)V
+12 -1: callSiteForm
+22 -1: isSiblingBindingBefore
+62 -1: <T:Ljava/lang/Object;>([TT;IITT;Ljava/util/Comparator<-TT;>;)I
+15 -1: buildEmptyNames
+11 -1: Thread.java
+30 -1: Ljava/lang/ref/Reference<TT;>;
+35 -1: sun/reflect/MethodAccessorGenerator
+152 -1: (Ljava/util/function/Function;Ljava/util/function/Function;Ljava/util/function/BinaryOperator;Ljava/util/function/Supplier;)Ljava/util/stream/Collector;
+5 -1: total
+242 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceValuesToLongTask;Ljava/util/function/ToLongFunction;JLjava/util/function/LongBinaryOperator;)V
+27 -1: javax/security/auth/Subject
+43 -1: JVMTI_THREAD_STATE_BLOCKED_ON_MONITOR_ENTER
+17 -1: getSignerCertPath
+15 -1: registerNatives
+21 -1: sun/reflect/FieldInfo
+54 -1: (Ljava/nio/charset/Charset;Lsun/nio/cs/ISO_8859_1$1;)V
+17 -1: unwrapWithNoPrims
+17 -1: instanceof Long:
+20 -1: hasRealParameterData
+23 -1: ()Ljava/time/LocalTime;
+14 -1: getAnnotations
+8 -1: optimize
+7 -1: setChar
+11 -1: OFFSET_MASK
+4 -1: TYPE
+177 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/BiFunction;Ljava/util/concurrent/atomic/AtomicReference;)V
+18 -1: removeShutdownHook
+27 -1: ()Ljava/security/Principal;
+29 -1: JAVAFX_APPLICATION_CLASS_NAME
+6 -1: digits
+37 -1: [Ljava/lang/reflect/Constructor<TT;>;
+45 -1: ()Ljava/lang/Thread$UncaughtExceptionHandler;
+7 -1: tryLock
+19 -1: java/net/Proxy$Type
+21 -1: setJavaSecurityAccess
+13 -1: tieBreakOrder
+3 -1: no
+16 -1: Australia/Sydney
+13 -1: DAY_IN_MILLIS
+19 -1: ()Ljava/nio/Buffer;
+12 -1: Integer.java
+14 -1: isBmpCodePoint
+6 -1: daemon
+23 -1: Lsun/misc/JavaIOAccess;
+106 -1: <U:Ljava/lang/Object;>(JLjava/util/function/BiFunction<-TK;-TV;+TU;>;Ljava/util/function/Consumer<-TU;>;)V
+10 -1: getFloatAt
+15 -1: content/unknown
+52 -1: ()Ljava/util/Enumeration<+Ljava/util/zip/ZipEntry;>;
+123 -1: <T:Ljava/lang/Object;>(Ljava/lang/Class<*>;Lsun/reflect/annotation/AnnotationType;Lsun/reflect/annotation/AnnotationType;)Z
+4 -1: nsme
+12 -1: prefixLength
+9 -1: flagsMods
+95 -1: (BLjava/lang/invoke/MemberName;Ljava/lang/Class;Ljava/lang/Class;)Ljava/lang/invoke/MemberName;
+62 -1: (Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/LambdaForm;
+16 -1: Illegal mode: 0x
+24 -1: java/io/FileOutputStream
+41 -1: [Pp][Ee][Rr][Mm][Ii][Ss][Ss][Ii][Oo][Nn]=
+24 -1: java/security/CodeSource
+16 -1: DUMP_CLASS_FILES
+25 -1: ([C)Ljava/nio/CharBuffer;
+12 -1: bindArgument
+50 -1: Ljava/lang/ref/FinalReference<Ljava/lang/Object;>;
+21 -1: unmodifiableSortedMap
+10 -1: jarHandler
+73 -1: (Ljava/lang/Class;[Ljava/lang/reflect/Method;)[Ljava/lang/reflect/Method;
+67 -1: ()Ljava/util/Map<Ljava/lang/Thread;[Ljava/lang/StackTraceElement;>;
+15 -1: threadSeqNumber
+18 -1: AutoCloseable.java
+9 -1: holdsLock
+25 -1: (Ljava/lang/Object;JJJJ)V
+7 -1: (IJII)I
+15 -1: copyToLongArray
+58 -1: Ljava/util/HashMap<Ljava/lang/String;Ljava/lang/Package;>;
+84 -1: (Ljava/lang/invoke/MethodHandle;I[Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle;
+32 -1: getExecutableTypeAnnotationBytes
+17 -1: streamHandlerLock
+35 -1: java/lang/IndexOutOfBoundsException
+15 -1: moveRootToFront
+28 -1: ()Ljava/nio/file/FileSystem;
+14 -1: content-length
+61 -1: (Ljava/lang/invoke/CallSite;Ljava/lang/invoke/MethodHandle;)V
+7 -1: csASCII
+18 -1: staticIsConsistent
+21 -1: sharedToGenericString
+8 -1: linkLast
+21 -1: isUnicodeExtensionKey
+7 -1: readInt
+7 -1: compile
+32 -1: ()Ljava/lang/reflect/Executable;
+4 -1: Big5
+20 -1: Ljava/util/Set<TE;>;
+18 -1: ExpiringCache.java
+44 -1: (Ljava/lang/String;[BII)Ljava/lang/Class<*>;
+18 -1: LinkedHashMap.java
+32 -1: Ljava/lang/UnsatisfiedLinkError;
+13 -1: parameterType
+28 -1: (ID)Ljava/lang/StringBuffer;
+15 -1: synchronizedSet
+9 -1: implClose
+6 -1: member
+14 -1: MH_INVOKE_MODS
+21 -1: forOutputStreamWriter
+37 -1: Lsun/misc/JavaIOFileDescriptorAccess;
+28 -1: java/lang/ProcessEnvironment
+17 -1: setNormalizedYear
+14 -1: isMalformed4_2
+14 -1: isMalformed4_3
+38 -1: (Ljava/lang/Object;)Ljava/lang/String;
+16 -1: getJavaAWTAccess
+12 -1: isPrivileged
+30 -1: java/util/Collections$EmptyMap
+17 -1: LinkedKeyIterator
+7 -1: vmcount
+27 -1: java/lang/ref/WeakReference
+5 -1: march
+13 -1: addOldMapping
+58 -1: (Ljava/lang/Object;Ljava/lang/Runnable;)Lsun/misc/Cleaner;
+56 -1: (ILjava/lang/String;)[Ljava/lang/invoke/LambdaForm$Name;
+65 -1: java/util/concurrent/ConcurrentHashMap$MapReduceEntriesToLongTask
+55 -1: (Ljava/lang/invoke/SerializedLambda;)Ljava/lang/Object;
+17 -1: getEnclosingClass
+35 -1: (I)Lsun/util/calendar/BaseCalendar;
+13 -1: binarySearch0
+25 -1: ([J)Ljava/nio/LongBuffer;
+19 -1: java/util/Map$Entry
+22 -1: java/util/HashMap$Node
+26 -1: sun/reflect/MethodAccessor
+8 -1: LASTYEAR
+7 -1: disable
+36 -1: sun/launcher/LauncherHelper$FXHelper
+6 -1: toPath
+10 -1: shortValue
+6 -1: remove
+59 -1: ([Ljava/lang/String;[Ljava/lang/String;)Ljava/lang/Process;
+55 -1: java/util/concurrent/ConcurrentHashMap$ValueSpliterator
+64 -1: (Ljava/util/Collection;Ljava/lang/Object;)Ljava/util/Collection;
+15 -1: asPrimitiveType
+16 -1: PrintStream.java
+10 -1: image/jpeg
+22 -1: specificToStringHeader
+7 -1: class "
+38 -1: java/util/Collections$CheckedSortedMap
+19 -1: SUPPRESSED_SENTINEL
+16 -1: getEnumConstants
+54 -1: (ILjava/lang/CharSequence;II)Ljava/lang/StringBuilder;
+36 -1: Ljava/lang/Class<Ljava/lang/Short;>;
+13 -1: toThreadState
+38 -1: (Ljava/lang/Class;)Ljava/lang/Package;
+24 -1: (C)Ljava/lang/Character;
+19 -1: UNTREEIFY_THRESHOLD
+4 -1: NCPU
+23 -1: ()Ljava/lang/Exception;
+42 -1: (ITK;TV;Ljava/util/HashMap$Node<TK;TV;>;)V
+15 -1: nothingToVerify
+15 -1: setInitialValue
+15 -1: getTimeInMillis
+12 -1: getDoubleAt0
+18 -1: parameterTypeCache
+86 -1: (Ljava/nio/file/WatchService;[Ljava/nio/file/WatchEvent$Kind;)Ljava/nio/file/WatchKey;
+49 -1: java/util/concurrent/ConcurrentHashMap$ValuesView
+13 -1: <all actions>
+7 -1: exitVM.
+34 -1: Ljava/lang/ClassNotFoundException;
+68 -1: (Ljava/util/Map;Ljava/lang/Class;)[Ljava/lang/annotation/Annotation;
+28 -1: getCalendarDateFromFixedDate
+28 -1: UnsafeFieldAccessorImpl.java
+27 -1: java/lang/RuntimePermission
+74 -1: Ljava/lang/Object;Ljava/lang/Comparable<Lsun/util/locale/BaseLocale$Key;>;
+62 -1: ()Ljava/util/Iterator<Ljava/nio/charset/spi/CharsetProvider;>;
+13 -1: LanguageRange
+239 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceValuesToIntTask;Ljava/util/function/ToIntFunction;ILjava/util/function/IntBinaryOperator;)V
+37 -1: DIRECTIONALITY_LEFT_TO_RIGHT_OVERRIDE
+62 -1: (Ljava/lang/invoke/MethodType;II)Ljava/lang/invoke/MethodType;
+16 -1: DMH.invokeStatic
+11 -1: (TK;TV;)TV;
+7 -1: ([FI)[F
+14 -1: newPerfCounter
+35 -1: ([JI)Ljava/util/Spliterator$OfLong;
+30 -1: java/util/AbstractList$ListItr
+5 -1: cp912
+5 -1: cp914
+45 -1: (Ljava/io/BufferedWriter;Ljava/lang/String;)V
+6 -1: LOCNAM
+8 -1: launcher
+5 -1: cp915
+14 -1: standardString
+26 -1: ()Ljava/lang/Thread$State;
+10 -1: L_ALPHANUM
+8 -1: (C[CII)I
+9 -1: SEPTEMBER
+20 -1: java/text/DateFormat
+38 -1: Ljava/lang/CloneNotSupportedException;
+5 -1: cp920
+23 -1: getConstructorSignature
+16 -1: ReferenceHandler
+19 -1: America/Puerto_Rico
+5 -1: cp923
+10 -1: typeString
+30 -1: Self-suppression not permitted
+25 -1: (Ljava/io/OutputStream;)V
+9 -1: implReset
+12 -1: fullAddCount
+34 -1: java/lang/invoke/LambdaForm$Hidden
+25 -1: ()Lsun/misc/JavaIOAccess;
+9 -1: Math.java
+9 -1: getAndSet
+7 -1: failure
+14 -1: LINE_SEPARATOR
+6 -1: parent
+30 -1: java/lang/BootstrapMethodError
+8 -1: indexMap
+9 -1: ALL_KINDS
+23 -1: desiredAssertionStatus0
+39 -1: (ILjava/lang/Object;)Ljava/lang/Object;
+22 -1: RuntimePermission.java
+21 -1: getContextClassLoader
+14 -1: VARARGS_INVOKE
+8 -1: zoneinfo
+130 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;ILjava/lang/invoke/DirectMethodHandle$1;)V
+18 -1: java/lang/Readable
+11 -1: containsAll
+11 -1: newPosition
+57 -1: sun/reflect/InstantiationExceptionConstructorAccessorImpl
+13 -1: REVERSE_ORDER
+29 -1: Required array size too large
+6 -1: sunday
+44 -1: <T:Ljava/lang/Object;>()Ljava/util/Set<TT;>;
+10 -1: toIntExact
+33 -1: ([BIILjava/nio/charset/Charset;)V
+14 -1: indexOfSubList
+15 -1: tryAcquireNanos
+31 -1: java/lang/InvalidClassException
+22 -1: SecureClassLoader.java
+12 -1: proxiedHosts
+7 -1: ([CII)I
+11 -1: toHexString
+30 -1: sun/util/calendar/ZoneInfoFile
+31 -1: Ljava/util/jar/Attributes$Name;
+10 -1: L_USERINFO
+25 -1: (IB)Ljava/nio/ByteBuffer;
+11 -1: parseDouble
+7 -1: ([CII)V
+13 -1: Asia/Shanghai
+5 -1: [...]
+57 -1: ([Ljava/lang/Class;[B)[[Ljava/lang/annotation/Annotation;
+19 -1: java/nio/LongBuffer
+15 -1: getCertificates
+9 -1: comparing
+83 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Class<*>;IILjava/lang/String;[B)V
+43 -1: Ljava/util/concurrent/atomic/AtomicInteger;
+23 -1: toFieldDescriptorString
+20 -1: Lsun/misc/MetaIndex;
+37 -1: java/util/Collections$UnmodifiableSet
+5 -1: (JC)V
+37 -1: nanosecond timeout value out of range
+26 -1: AbstractStringBuilder.java
+43 -1: java/lang/invoke/DirectMethodHandle$Special
+49 -1: ([Ljava/nio/file/LinkOption;)Ljava/nio/file/Path;
+15 -1: currentPosition
+14 -1: java/net/Proxy
+13 -1: asConstructor
+8 -1: userInfo
+14 -1: parseClassPath
+15 -1: legacyMergeSort
+34 -1: java/security/UnresolvedPermission
+97 -1: Lsun/util/locale/LocaleObjectCache<Lsun/util/locale/BaseLocale$Key;Lsun/util/locale/BaseLocale;>;
+9 -1: freeEntry
+19 -1: delimiterCodePoints
+34 -1: Should be non-empty if initialized
+23 -1: (I)Ljava/lang/Class<*>;
+11 -1: Reader.java
+26 -1: checkClassLoaderPermission
+27 -1: java/nio/DirectShortBufferS
+95 -1: Ljava/lang/Object;Ljava/security/PrivilegedExceptionAction<Lsun/misc/Launcher$ExtClassLoader;>;
+27 -1: java/nio/DirectShortBufferU
+20 -1: ()[Ljava/lang/Class;
+56 -1: ()[Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
+19 -1: sun/nio/cs/UTF_16BE
+24 -1: java/util/AbstractList$1
+10 -1: ([CIIIII)V
+60 -1: Ljava/lang/Object;Ljava/lang/Comparable<Ljava/lang/Object;>;
+37 -1: (Ljava/lang/invoke/LambdaForm$Name;)S
+9 -1: putDouble
+52 -1: ([Ljava/security/CodeSource;)Ljava/util/Enumeration;
+37 -1: (Ljava/lang/invoke/LambdaForm$Name;)Z
+22 -1: ()[Ljava/lang/Package;
+41 -1: java/lang/CharSequence$1CodePointIterator
+13 -1: auditSubclass
+24 -1: Ljava/util/jar/JarEntry;
+20 -1: findMethodHandleType
+15 -1: MAX_BUFFER_SIZE
+19 -1: FilePermission.java
+18 -1: WrappedPrintStream
+36 -1: (D)Ljava/lang/AbstractStringBuilder;
+11 -1: unfinalized
+10 -1: getFileURL
+37 -1: (Ljava/io/FileFilter;)[Ljava/io/File;
+54 -1: (Ljava/nio/ByteBuffer;I)Ljava/nio/charset/CoderResult;
+7 -1: ([ZI)[Z
+64 -1: (Ljava/security/CodeSource;)Ljava/security/PermissionCollection;
+6 -1: PUBLIC
+83 -1: (Ljava/util/jar/JarFile;Ljava/net/URL;Ljava/lang/String;)Ljava/security/CodeSource;
+17 -1: lockInterruptibly
+67 -1: ([Ljava/util/Hashtable$Entry;Ljava/lang/Object;Ljava/lang/Object;)V
+42 -1: java/util/ArraysParallelSortHelpers$FJChar
+21 -1: defaultCharBufferSize
+14 -1: unalignedKnown
+23 -1: ()Ljava/net/Proxy$Type;
+4 -1: TZDB
+14 -1: CharacterCache
+13 -1: lengthOfMonth
+13 -1: hasExtensions
+23 -1: Prefix string too short
+15 -1: Executable.java
+10 -1: forEachKey
+6 -1: getEra
+13 -1: appendEncoded
+21 -1: java/util/AbstractMap
+10 -1: access$100
+10 -1: access$102
+30 -1: javafx.application.Application
+46 -1: (Ljava/lang/Thread$UncaughtExceptionHandler;)V
+43 -1: Ljava/lang/invoke/LambdaForm$NamedFunction;
+101 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class;IILjava/lang/String;[B)Ljava/lang/reflect/Field;
+9 -1: WILD_CHAR
+21 -1: SynchronizedSortedSet
+28 -1: (Ljava/util/Collection<*>;)Z
+29 -1: (I[C)Ljava/lang/StringBuffer;
+65 -1: (Ljava/lang/String;[Ljava/lang/Class;Z)Ljava/lang/reflect/Method;
+7 -1: putByte
+6 -1: H_MARK
+49 -1: (Ljava/lang/invoke/MemberName;)Ljava/lang/Object;
+98 -1: ([Ljava/lang/ClassValue$Entry<*>;ILjava/lang/ClassValue$Entry<*>;Z)Ljava/lang/ClassValue$Entry<*>;
+23 -1: array is not of length
+52 -1: <T:Ljava/lang/Object;>(Ljava/util/List<TT;>;TT;TT;)Z
+41 -1: Ljava/util/Collections$EmptyListIterator;
+8 -1:
+11 -1: updateCheck
+29 -1: getBootClassPathEntryForClass
+27 -1: sun/nio/cs/US_ASCII$Encoder
+10 -1: bindCaller
+18 -1: Ljava/util/BitSet;
+10 -1: checkRange
+77 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Class<*>;Ljava/lang/Void;)V
+7 -1: Classes
+6 -1: store0
+23 -1: java/lang/Thread$Caches
+25 -1: Ljava/lang/CharacterData;
+7 -1: (JI[C)V
+49 -1: (Ljava/util/LinkedList;Ljava/util/LinkedList$1;)V
+16 -1: getGcInfoBuilder
+12 -1: counterCells
+14 -1: memoryLimitSet
+7 -1: , nojit
+9 -1: sharpsMap
+7 -1: october
+13 -1: isProxiedHost
+9 -1: rawOffset
+18 -1: toJavaFormatString
+19 -1: sun.boot.class.path
+60 -1: (ILjava/lang/CharSequence;)Ljava/lang/AbstractStringBuilder;
+11 -1: spliterator
+13 -1: contentLength
+18 -1: unixTimeToFileTime
+31 -1: Lsun/reflect/LangReflectAccess;
+16 -1: while Java has
+79 -1: (JLjava/util/function/ToIntBiFunction;ILjava/util/function/IntBinaryOperator;)I
+12 -1: timeEndOfDay
+17 -1: getCustomTimeZone
+25 -1: Ljava/lang/ref/Reference;
+20 -1: ()Ljava/util/Locale;
+64 -1: (Ljava/util/HashMap<TK;TV;>;[Ljava/util/HashMap$Node<TK;TV;>;Z)V
+13 -1: MAX_JVM_ARITY
+72 -1: (Ljava/lang/String;Ljava/lang/ClassLoader;)Ljava/lang/invoke/MethodType;
+11 -1: AsLIFOQueue
+84 -1: <T:Ljava/lang/Object;>(Ljava/util/List<TT;>;Ljava/lang/Object;)Ljava/util/List<TT;>;
+12 -1: mappingCount
+29 -1: (Ljava/io/FileOutputStream;)V
+50 -1: <T:Ljava/lang/Object;>(Ljava/util/List<-TT;>;TT;)V
+23 -1: Category cannot be NULL
+10 -1: normalized
+5 -1: CLASS
+28 -1: (IZ)Ljava/lang/StringBuffer;
+18 -1: java/lang/System$1
+18 -1: java/lang/System$2
+9 -1: getResult
+44 -1: ()Ljava/util/Collection<Ljava/lang/Thread;>;
+8 -1: isNative
+59 -1: Ljava/lang/Number;Ljava/lang/Comparable<Ljava/lang/Short;>;
+24 -1: [Ljava/lang/ThreadGroup;
+24 -1: (B)Ljava/nio/ByteBuffer;
+4 -1: READ
+44 -1: (Ljava/io/FilePermission;)Ljava/lang/String;
+93 -1: <E:Ljava/lang/Object;>Ljava/util/Collections$SynchronizedCollection<TE;>;Ljava/util/Set<TE;>;
+12 -1: compileClass
+12 -1: isProxyClass
+20 -1: isSystemDomainLoader
+74 -1: <T:Ljava/lang/Object;>(Ljava/util/List<TT;>;Ljava/util/Comparator<-TT;>;)V
+7 -1: getMask
+72 -1: (Ljava/lang/ClassLoader;Ljava/lang/SecurityManager;Ljava/lang/String;I)V
+20 -1: removeLastOccurrence
+64 -1: (Ljava/lang/reflect/Field;)Ljava/lang/invoke/DirectMethodHandle;
+57 -1: ()Ljava/util/Map<Ljava/lang/String;Ljava/lang/Class<*>;>;
+11 -1: parkBlocker
+40 -1: (Lsun/misc/JarIndex;Ljava/lang/String;)V
+33 -1: [Ljava/security/ProtectionDomain;
+14 -1: setContentType
+14 -1: getEnumeration
+18 -1: ProtectionDomain
+76 -1: (Lsun/util/calendar/BaseCalendar$Date;)Lsun/util/calendar/BaseCalendar$Date;
+16 -1: setRequestMethod
+52 -1: (Ljava/util/List;Ljava/lang/Object;)Ljava/util/List;
+32 -1: Lsun/util/calendar/BaseCalendar;
+52 -1: (Ljava/net/URL;Ljava/lang/String;)Ljava/lang/String;
+5 -1: .:@[]
+7 -1: addLast
+21 -1: AnnotatedElement.java
+10 -1: defaultVal
+16 -1: getCanonicalPath
+17 -1: protection_domain
+9 -1: strictfp
+19 -1: sun/nio/cs/UTF_16LE
+9 -1: readBytes
+18 -1: removeStaleEntries
+46 -1: java/util/Collections$UnmodifiableNavigableSet
+5 -1: cpath
+14 -1: COPY_THRESHOLD
+8 -1: permsMap
+8 -1: japanese
+33 -1: java/nio/charset/StandardCharsets
+47 -1: Lsun/reflect/DelegatingConstructorAccessorImpl;
+19 -1: NF_checkGenericType
+40 -1: java/util/Collections$UnmodifiableList$1
+4 -1: TERM
+48 -1: The following can be used with stack and domain:
+27 -1: ([BII)Ljava/nio/ByteBuffer;
+40 -1: Ljava/util/Vector<Ljava/lang/Class<*>;>;
+5 -1: digit
+7 -1: isFinal
+39 -1: (Ljava/lang/String;Ljava/lang/String;)I
+26 -1: memberDeclaringClassOrNull
+10 -1: ([CI[BII)I
+38 -1: (Ljava/lang/Class;I)Ljava/lang/Object;
+15 -1: isValidProtocol
+17 -1: (this Collection)
+11 -1: getTreeNode
+16 -1: ThreadLocal.java
+23 -1: java/nio/HeapLongBuffer
+39 -1: (Ljava/lang/String;Ljava/lang/String;)V
+12 -1: getNextEntry
+39 -1: (Ljava/lang/String;Ljava/lang/String;)Z
+28 -1: (C)Lsun/invoke/util/Wrapper;
+9 -1: readFloat
+21 -1: overrideFieldAccessor
+16 -1: fillInStackTrace
+16 -1: getDeclaredField
+5 -1: deflt
+8 -1: nextChar
+10 -1: primCounts
+22 -1: getAnnotatedInterfaces
+26 -1: ()Ljava/util/zip/Inflater;
+73 -1: <U:Ljava/lang/Object;>(JLjava/util/function/BiFunction<-TK;-TV;+TU;>;)TU;
+16 -1: traceMethodCalls
+10 -1: sun.nio.cs
+7 -1: marshal
+9 -1: ftypeKind
+77 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Class;)Ljava/lang/invoke/MemberName;
+11 -1: sun/misc/VM
+14 -1: GuardWithCatch
+40 -1: (Ljava/lang/Object;)Ljava/util/Iterator;
+13 -1: subtractExact
+42 -1: (Ljava/lang/Object;ILjava/lang/Object;II)V
+10 -1: isInfinite
+18 -1: sun.util.calendar.
+14 -1: java/lang/Math
+16 -1: java/lang/String
+10 -1: encodePath
+14 -1: compactAndTrim
+11 -1: getVariants
+4 -1: from
+47 -1: (Ljava/lang/ThreadLocal<*>;Ljava/lang/Object;)V
+35 -1: serializeAgentPropertiesToByteArray
+16 -1: computeIfPresent
+9 -1: EMPTY_MAP
+28 -1: java/lang/InstantiationError
+68 -1: (Ljava/util/Comparator;Ljava/util/Comparator;)Ljava/util/Comparator;
+14 -1: getDisplayName
+14 -1: limitedContext
+23 -1: usagetracker.properties
+52 -1: java/util/concurrent/locks/ReentrantLock$NonfairSync
+7 -1: public
+17 -1: srcBegin > srcEnd
+48 -1: (ILjava/util/List;)Ljava/lang/invoke/MethodType;
+21 -1: java/lang/ThreadDeath
+9 -1: gregorian
+111 -1: (Ljava/util/HashMap;[Ljava/util/HashMap$Node;ILjava/lang/Object;Ljava/lang/Object;)Ljava/util/HashMap$TreeNode;
+52 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;III)V
+12 -1: generateFile
+20 -1: appendParameterTypes
+22 -1: sun/misc/FileURLMapper
+13 -1: defaultDomain
+25 -1: (I)Ljava/time/ZoneOffset;
+21 -1: getBooleanAttributes0
+39 -1: (Ljava/lang/String;)Lsun/misc/Resource;
+43 -1: Ljava/lang/Thread$UncaughtExceptionHandler;
+23 -1: getTypeAnnotationBytes0
+8 -1: ELOT_928
+32 -1: sun/nio/cs/FastCharsetProvider$1
+34 -1: Ljava/nio/BufferOverflowException;
+14 -1: AppClassLoader
+10 -1: protected
+12 -1: isAnnotation
+16 -1: PerfCounter.java
+51 -1: Ljava/util/Map<Ljava/io/File;Lsun/misc/MetaIndex;>;
+160 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
+11 -1: setLeapYear
+16 -1: parseContextSpec
+16 -1: setFieldAccessor
+8 -1: writeInt
+16 -1: java/lang/Number
+33 -1: java/util/AbstractMap$SimpleEntry
+9 -1: nextTable
+8 -1: getQuery
+14 -1: putOrderedLong
+93 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)V
+52 -1: (Ljava/lang/String;)Lsun/reflect/generics/tree/Tree;
+85 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/concurrent/ConcurrentHashMap$Node;)V
+9 -1: singleton
+9 -1: destroyed
+15 -1: iso_8859-2:1987
+12 -1: comparingInt
+29 -1: [Ljava/lang/OutOfMemoryError;
+39 -1: (Ljava/lang/String;Ljava/lang/Object;)V
+27 -1: ([Ljava/util/Enumeration;)V
+36 -1: Ljava/nio/charset/CodingErrorAction;
+16 -1: getCanonicalName
+41 -1: (Ljava/nio/LongBuffer;)Ljava/util/BitSet;
+15 -1: DISPLAY_COUNTRY
+32 -1: getFunctionalInterfaceMethodName
+66 -1: (Ljava/lang/String;Ljava/util/Map;Ljava/util/Map;Ljava/util/Map;)V
+24 -1: getUnresolvedPermissions
+66 -1: ([Ljava/lang/ClassValue$Entry<*>;I)Ljava/lang/ClassValue$Entry<*>;
+41 -1: ()Lsun/reflect/annotation/AnnotationType;
+7 -1: afIndex
+7 -1: csascii
+20 -1: ()Ljava/util/Vector;
+16 -1: EntrySpliterator
+53 -1: (Ljava/lang/Throwable;I)Ljava/lang/StackTraceElement;
+81 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class;)Ljava/lang/invoke/MethodHandle;
+20 -1: classAssertionStatus
+7 -1: EXECUTE
+21 -1: ()Ljava/lang/Runtime;
+6 -1: cesu-8
+7 -1: offset
+23 -1: Ljava/lang/SafeVarargs;
+34 -1: (Ljava/util/LinkedHashMap$Entry;)V
+8 -1: entryFor
+8 -1: getCache
+46 -1: (Ljava/lang/Object;I)Ljava/lang/reflect/Field;
+4 -1: skip
+8 -1: (II[CI)V
+4 -1: vart
+12 -1: InnerClasses
+68 -1: (Ljava/util/Map;Ljava/lang/Class;[Ljava/lang/String;)Ljava/util/Map;
+19 -1: currentClassLoader0
+34 -1: getDefaultUncaughtExceptionHandler
+11 -1: String.java
+117 -1: (Ljava/lang/ThreadLocal<*>;ILjava/lang/ThreadLocal$ThreadLocalMap$Entry;)Ljava/lang/ThreadLocal$ThreadLocalMap$Entry;
+7 -1: january
+31 -1: (ILjava/lang/String;IIIIIIIII)V
+24 -1: Lsun/misc/JavaAWTAccess;
+5 -1: .path
+15 -1: [Ljava/io/File;
+11 -1: Writer.java
+8 -1: , Size:
+159 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/Function;Ljava/util/function/Consumer;)V
+32 -1: java/lang/invoke/LambdaForm$Name
+51 -1: (Ljava/util/ArrayList;Ljava/util/AbstractList;III)V
+7 -1: getZone
+14 -1: JIS_X0212-1990
+21 -1: (Ljava/util/Set<*>;)Z
+149 -1: (Lsun/util/locale/provider/LocaleServiceProviderPool$LocalizedObjectGetter;Ljava/util/Locale;Ljava/lang/String;[Ljava/lang/Object;)Ljava/lang/Object;
+21 -1: Illegal Load factor:
+35 -1: ()Ljava/lang/invoke/MethodTypeForm;
+22 -1: ([Z)Ljava/lang/String;
+7 -1: setName
+48 -1: <T:Ljava/lang/Object;>(TT;Ljava/lang/String;)TT;
+9 -1: INTERFACE
+22 -1: ARRAY_CHAR_INDEX_SCALE
+19 -1: java/nio/ByteBuffer
+23 -1: Ljava/io/ExpiringCache;
+7 -1: streams
+44 -1: java/lang/invoke/DirectMethodHandle$Accessor
+36 -1: ([Ljava/security/ProtectionDomain;)V
+16 -1: afterNodeRemoval
+9 -1: prevIndex
+49 -1: java/util/concurrent/ConcurrentHashMap$KeySetView
+22 -1: getEnumConstantsShared
+17 -1: java/lang/Integer
+12 -1: getRawOffset
+36 -1: ()Ljava/nio/file/attribute/FileTime;
+7 -1: offsets
+10 -1: ] throw =>
+3 -1: [[B
+10 -1: hostsEqual
+18 -1: compareComparables
+35 -1: sun/reflect/ConstructorAccessorImpl
+8 -1: december
+36 -1: Invalid binary time-zone data: TZDB:
+24 -1: synchronizedNavigableMap
+72 -1: sun/util/locale/provider/LocaleServiceProviderPool$LocalizedObjectGetter
+19 -1: parseCustomTimeZone
+88 -1: (Ljava/lang/Class<*>;Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/DirectMethodHandle;
+9 -1: findClass
+6 -1: OBJECT
+3 -1: GBK
+110 -1: (JLjava/util/function/ToLongFunction<Ljava/util/Map$Entry<TK;TV;>;>;JLjava/util/function/LongBinaryOperator;)J
+6 -1: UTF_16
+17 -1: <all permissions>
+13 -1: lookupCharset
+28 -1: ConstructorAccessorImpl.java
+62 -1: java/util/concurrent/ConcurrentHashMap$MapReduceKeysToLongTask
+30 -1: Ljava/lang/ClassCastException;
+56 -1: ()Ljava/util/Spliterator<Ljava/util/Map$Entry<TK;TV;>;>;
+11 -1: invokerType
+23 -1: java/lang/StringBuilder
+12 -1: deleteCharAt
+11 -1: CR_OVERFLOW
+14 -1: toExternalForm
+3 -1: out
+34 -1: Ljava/net/URLStreamHandlerFactory;
+15 -1: encodeArrayLoop
+30 -1: ()Ljava/util/Enumeration<TK;>;
+27 -1: java/io/SyncFailedException
+10 -1: checkedSet
+16 -1: checkedSortedSet
+22 -1: java/util/zip/ZipEntry
+43 -1: java/util/LinkedHashMap$LinkedValueIterator
+22 -1: UnmodifiableCollection
+32 -1: java/nio/ByteBufferAsCharBufferB
+11 -1: blockerLock
+27 -1: checkExtensionsDependencies
+11 -1: fromIndex:
+32 -1: java/nio/ByteBufferAsCharBufferL
+6 -1: UTF_32
+30 -1: java/util/Hashtable$Enumerator
+92 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/Map<+TK;+TV;>;)Ljava/util/Map<TK;TV;>;
+4 -1: tail
+5 -1: (BB)C
+16 -1: isValidSignature
+9 -1: addMillis
+9 -1: peekFirst
+86 -1: <E:Ljava/lang/Object;>(Ljava/util/Set<TE;>;Ljava/lang/Class<TE;>;)Ljava/util/Set<TE;>;
+5 -1: (BB)I
+15 -1: jvmMicroVersion
+28 -1: [Ljava/util/Hashtable$Entry;
+15 -1: iso_8859-5:1988
+14 -1: HOUR_IN_MILLIS
+67 -1: (Ljava/util/PrimitiveIterator$OfInt;I)Ljava/util/Spliterator$OfInt;
+5 -1: (BB)S
+21 -1: UnmodifiableSortedMap
+79 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/util/concurrent/ConcurrentHashMap;)V
+56 -1: Ljava/util/Stack<Ljava/lang/ClassLoader$NativeLibrary;>;
+5 -1: (BB)Z
+10 -1: treeifyBin
+8 -1: isOpaque
+27 -1: java.launcher.ergo.message1
+27 -1: java.launcher.ergo.message2
+101 -1: Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/Cloneable;Ljava/lang/Comparable<Ljava/util/Date;>;
+31 -1: (Ljava/io/ObjectOutputStream;)V
+3 -1: GET
+13 -1: matchLocation
+13 -1: WrappedMember
+63 -1: NoSuchMethodException:\n could not find proper constructor for
+14 -1: gssloginconfig
+70 -1: (Ljava/util/LinkedList$Node<TE;>;TE;Ljava/util/LinkedList$Node<TE;>;)V
+57 -1: (Ljava/lang/Object;Ljava/lang/Object;Z)Ljava/lang/Object;
+11 -1: toByteArray
+49 -1: java/util/ArraysParallelSortHelpers$FJByte$Sorter
+13 -1: no protocol:
+940 -1: aaaarababkaeaveafafrakakaamamhanargararaasasmavavaayaymazazebabakbebelbgbulbhbihbibisbmbambnbenbobodbrbrebsboscacatcechechchacocoscrcrecscescuchucvchvcycymdadandedeudvdivdzdzoeeeweelellenengeoepoesspaetesteueusfafasfffulfifinfjfijfofaofrfrafyfrygaglegdglaglglggngrngugujgvglvhahauhehebhihinhohmohrhrvhthathuhunhyhyehzheriainaidindieileigiboiiiiiikipkinindioidoisislititaiuikuiwhebjajpnjiyidjvjavkakatkgkonkikikkjkuakkkazklkalkmkhmknkankokorkrkaukskaskukurkvkomkwcorkykirlalatlbltzlgluglilimlnlinlolaoltlitlulublvlavmgmlgmhmahmimrimkmkdmlmalmnmonmomolmrmarmsmsamtmltmymyananaunbnobndndenenepngndonlnldnnnnononornrnblnvnavnynyaocociojojiomormororiososspapanpipliplpolpspusptporququermrohrnrunroronrurusrwkinsasanscsrdsdsndsesmesgsagsisinskslkslslvsmsmosnsnasosomsqsqisrsrpsssswstsotsusunsvsweswswatatamteteltgtgkththatitirtktuktltgltntsntotontrturtstsotttattwtwitytahuguigukukrururduzuzbvevenvivievovolwawlnwowolxhxhoyiyidyoyorzazhazhzhozuzul
+42 -1: java/util/LinkedHashMap$LinkedHashIterator
+39 -1: java/util/ArrayDeque$DescendingIterator
+15 -1: MODIFIER_LETTER
+21 -1: (Lsun/misc/Cleaner;)Z
+12 -1: PACKAGE_NAME
+14 -1: getMappedValue
+10 -1: interrupt0
+8 -1: LF_LIMIT
+17 -1: getDeclaringClass
+42 -1: (ZILjava/lang/String;)Ljava/lang/Class<*>;
+57 -1: (Ljava/lang/management/ThreadInfo;[Ljava/lang/Object;[I)V
+15 -1: java/nio/Bits$1
+61 -1: (Ljava/lang/String;ZLjava/lang/ClassLoader;)Ljava/lang/Class;
+28 -1: java/lang/ref/ReferenceQueue
+33 -1: [Ljava/security/cert/Certificate;
+44 -1: (Ljava/util/Hashtable;I)Ljava/util/Iterator;
+24 -1: java/security/CodeSigner
+19 -1: Non-positive length
+24 -1: [Ljava/util/Enumeration;
+38 -1: ()Ljava/security/PermissionCollection;
+16 -1: checkGenericType
+56 -1: java/util/concurrent/ConcurrentHashMap$ReduceEntriesTask
+7 -1: getYear
+5 -1: atime
+19 -1: Ljava/util/HashMap;
+125 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<Ljava/util/Map$Entry<TK;TV;>;+TU;>;Ljava/util/function/Consumer<-TU;>;)V
+22 -1: STOP_THREAD_PERMISSION
+46 -1: (Ljava/util/Enumeration;)Ljava/util/ArrayList;
+16 -1: getPathSeparator
+10 -1: getMembers
+8 -1: getIntAt
+26 -1: java/io/File$TempDirectory
+48 -1: java/lang/invoke/MethodHandleImpl$GuardWithCatch
+25 -1: CaseInsensitiveComparator
+8 -1: pollLast
+21 -1: GET_POLICY_PERMISSION
+23 -1: uninitialized call site
+75 -1: (Ljava/util/function/Function;Ljava/util/Comparator;)Ljava/util/Comparator;
+9 -1: directory
+51 -1: (JLjava/util/function/BiFunction<-TV;-TV;+TV;>;)TV;
+41 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;)V
+42 -1: (Ljava/lang/Throwable;Ljava/lang/String;)V
+26 -1: (FLjava/lang/Appendable;)V
+5 -1: stop0
+9 -1: substring
+64 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/HashMap$Node;)V
+5 -1: (JD)V
+9 -1: getShortB
+10 -1: nextOrSame
+24 -1: [ interpretWithArguments
+6 -1: GB2312
+32 -1: java/nio/BufferOverflowException
+23 -1: sun/nio/cs/ArrayEncoder
+4 -1: tanh
+9 -1: getShortL
+55 -1: (JLjava/util/function/BiFunction;)Ljava/util/Map$Entry;
+10 -1: getMessage
+12 -1: findTreeNode
+38 -1: DIRECTIONALITY_COMMON_NUMBER_SEPARATOR
+23 -1: [Ljava/lang/Comparable;
+17 -1: getCallSiteTarget
+55 -1: (Ljava/nio/ByteBuffer;II)Ljava/nio/charset/CoderResult;
+19 -1: java/util/ArrayList
+17 -1: java/io/DataInput
+13 -1: getPrincipals
+52 -1: <E:Ljava/lang/Object;>(TE;)Ljava/util/Iterator<TE;>;
+44 -1: sun/reflect/generics/tree/ClassTypeSignature
+6 -1: loaded
+20 -1: ()Ljava/lang/Object;
+36 -1: Ljava/util/concurrent/ConcurrentMap;
+13 -1: classValueMap
+33 -1: java/lang/SystemClassLoaderAction
+6 -1: loader
+31 -1: java/lang/annotation/Annotation
+5 -1: colon
+11 -1: Vector.java
+24 -1: CharacterDataLatin1.java
+12 -1: setUseCaches
+22 -1: getTypeAnnotationBytes
+9 -1: readShort
+24 -1: longPrimitiveReturnCount
+5 -1: get16
+34 -1: setDefaultUncaughtExceptionHandler
+17 -1: cachedInputStream
+29 -1: java/util/LinkedHashMap$Entry
+17 -1: java/lang/Boolean
+50 -1: ()[Lsun/reflect/generics/tree/FormalTypeParameter;
+14 -1: AnnotationData
+21 -1: Ljava/net/Proxy$Type;
+13 -1: invokeVirtual
+14 -1: Parameter.java
+21 -1: getDayOfWeekDateAfter
+92 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
+56 -1: (Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
+46 -1: sun/util/locale/provider/LocaleProviderAdapter
+29 -1: Ljava/lang/StackTraceElement;
+47 -1: (TK;Ljava/util/function/Function<-TK;+TV;>;)TV;
+32 -1: enableContextClassLoaderOverride
+68 -1: (Ljava/lang/AbstractStringBuilder;)Ljava/lang/AbstractStringBuilder;
+51 -1: Ljava/util/concurrent/ConcurrentHashMap$KeySetView;
+9 -1: addAndGet
+5 -1: store
+7 -1: ([JII)V
+15 -1: signatureReturn
+18 -1: NF_reinvokerTarget
+22 -1: ()Ljava/nio/file/Path;
+25 -1: (C)Ljava/lang/Appendable;
+7 -1: expires
+18 -1: initializeInvokers
+19 -1: application/java-vm
+13 -1: stopOrSuspend
+13 -1: rawOffsetDiff
+6 -1: (JJZ)V
+9 -1: findValue
+5 -1: get32
+10 -1: asSubclass
+6 -1: forJRE
+3 -1: GMT
+7 -1: delete0
+69 -1: ([Ljava/security/cert/Certificate;[Ljava/security/cert/Certificate;)Z
+75 -1: (Ljava/util/LinkedList$Node;Ljava/lang/Object;Ljava/util/LinkedList$Node;)V
+6 -1: setEra
+24 -1: ()Ljava/util/Comparator;
+10 -1: access$200
+10 -1: access$202
+20 -1: retrieveDisplayNames
+3 -1: pae
+24 -1: java/lang/Byte$ByteCache
+7 -1: VM.java
+9 -1: TRANSIENT
+6 -1: setErr
+16 -1: jdkUpdateVersion
+10 -1: isResolved
+35 -1: sun/misc/JavaIOFileDescriptorAccess
+4 -1: char
+13 -1: Readable.java
+19 -1: UnixFileSystem.java
+43 -1: (Ljava/lang/ThreadLocal;)Ljava/lang/Object;
+40 -1: (Ljava/lang/String;[Ljava/lang/String;)V
+7 -1: profile
+11 -1: , version:
+25 -1: PermissionCollection.java
+13 -1: setNormalized
+10 -1: access$210
+24 -1: (Ljava/lang/String;IJZ)J
+19 -1: isAnnotationPresent
+85 -1: (Ljava/util/Map;Ljava/lang/Class;Ljava/lang/Class;)[Ljava/lang/annotation/Annotation;
+19 -1: DMH.invokeInterface
+157 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/concurrent/ConcurrentHashMap$CollectionView<TK;TV;TV;>;Ljava/util/Collection<TV;>;Ljava/io/Serializable;
+94 -1: <E:Ljava/lang/Object;>Ljava/util/Collections$UnmodifiableCollection<TE;>;Ljava/util/List<TE;>;
+41 -1: java/lang/StringIndexOutOfBoundsException
+29 -1: java/net/UnknownHostException
+11 -1: (BBBBBBBB)J
+4 -1: iioe
+12 -1: (TK;TV;Z)TV;
+5 -1: ERROR
+31 -1: (Ljava/io/File;Ljava/io/File;)I
+32 -1: [Ljava/lang/invoke/MethodHandle;
+27 -1: lambda$comparing$77a9974f$1
+13 -1: toLowerCaseEx
+61 -1: (Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MemberName;)V
+66 -1: (ILjava/lang/Object;Ljava/lang/Class;)Ljava/util/HashMap$TreeNode;
+43 -1: java/util/concurrent/ConcurrentHashMap$Node
+23 -1: latestUserDefinedLoader
+24 -1: buildAnnotatedSuperclass
+19 -1: compareToIgnoreCase
+31 -1: (Ljava/io/File;Ljava/io/File;)Z
+40 -1: (I[C)[Ljava/lang/invoke/LambdaForm$Name;
+16 -1: ROTATE_THRESHOLD
+18 -1: getClassAtIfLoaded
+37 -1: java/lang/IllegalThreadStateException
+5 -1: get64
+12 -1: writeReplace
+14 -1: DAYS_PER_CYCLE
+4 -1: _get
+6 -1: nChars
+26 -1: ()Ljava/net/SocketAddress;
+27 -1: setUncaughtExceptionHandler
+6 -1: jzfile
+42 -1: All subclasses should override this method
+3 2: Foo
+56 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/lang/String;
+136 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedExceptionAction<TT;>;Ljava/security/AccessControlContext;[Ljava/security/Permission;)TT;
+3 -1: pdt
+44 -1: sun/util/locale/LocaleObjectCache$CacheEntry
+20 -1: java/util/Comparator
+9 -1: suspended
+11 -1: removeEntry
+10 -1: SPACE_FREE
+12 -1: processQueue
+9 -1: java.home
+5 -1: valid
+23 -1: printEnclosedStackTrace
+4 -1: push
+5 -1: guard
+23 -1: javaNetHttpCookieAccess
+36 -1: (Ljava/security/cert/Certificate;)[B
+9 -1: isWrapped
+12 -1: CharIterator
+26 -1: sun.io.useCanonPrefixCache
+42 -1: (Lsun/misc/Cleaner;Ljava/lang/Throwable;)V
+7 -1: prepare
+8 -1: parseInt
+13 -1: Invokers.java
+63 -1: (Ljava/net/URLClassLoader;)Ljava/security/AccessControlContext;
+18 -1: defaultWriteObject
+5 -1: class
+15 -1: EnclosingMethod
+23 -1: ([BI)Ljava/lang/String;
+16 -1: rangeCheckForAdd
+11 -1: getTimeImpl
+15 -1: arrayIndexScale
+5 -1: scalb
+5 -1: scale
+45 -1: (Ljava/lang/String;J)Ljava/util/zip/ZipEntry;
+8 -1: ([FIIF)I
+16 -1: runAllFinalizers
+27 -1: ()Lsun/net/ProgressMonitor;
+15 -1: MemberName.java
+27 -1: [Ljava/lang/reflect/Member;
+6 -1: length
+14 -1: genericInvoker
+8 -1: ([FIIF)V
+34 -1: Ljava/nio/file/attribute/FileTime;
+6 -1: number
+70 -1: (Ljava/lang/StringBuilder;Ljava/lang/String;)Ljava/lang/StringBuilder;
+12 -1: printLocales
+38 -1: java/lang/invoke/MethodHandleStatics$1
+8 -1: private
+20 -1: invalid actions mask
+10 -1: not found
+13 -1: parseClassSig
+22 -1: getAllAvailableLocales
+175 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/Function;Ljava/util/concurrent/atomic/AtomicReference;)V
+8 -1: ([BII)[B
+35 -1: (Ljava/util/HashMap$Node<TK;TV;>;)V
+132 -1: (Ljava/lang/Thread;ILjava/lang/Object;Ljava/lang/Thread;JJJJ[Ljava/lang/StackTraceElement;[Ljava/lang/Object;[I[Ljava/lang/Object;)V
+8 -1: ([BII)[C
+20 -1: DECIMAL_DIGIT_NUMBER
+40 -1: (Ljava/lang/String;[Ljava/lang/Object;)Z
+7 -1: ([CCI)I
+64 -1: (TV;)Ljava/util/concurrent/ConcurrentHashMap$KeySetView<TK;TV;>;
+8 -1: aliasMap
+8 -1: checkfpx
+44 -1: java/util/Comparators$NaturalOrderComparator
+48 -1: (Ljava/lang/ClassLoader;)Ljava/lang/ClassLoader;
+12 -1: Name is null
+10 -1: invoke_L_L
+8 -1: URL.java
+51 -1: (JILjava/time/ZoneOffset;)Ljava/time/LocalDateTime;
+25 -1: Lsun/invoke/util/Wrapper;
+19 -1: LauncherHelper.java
+10 -1: invoke_L_V
+5 -1: index
+30 -1: sun/security/x509/X509CertImpl
+8 -1: addClass
+46 -1: (I)Ljava/lang/invoke/LambdaForm$NamedFunction;
+20 -1: refKindIsConstructor
+10 -1: getFieldAt
+5 -1: log10
+13 -1: GetPerfAction
+15 -1: isLetterOrDigit
+27 -1: hasCheckedSpecialAttributes
+25 -1: MapReduceEntriesToIntTask
+17 -1: probeHomeLocation
+9 -1: image/png
+19 -1: checkSpreadArgument
+12 -1: LinkedKeySet
+13 -1: removeMapping
+39 -1: sun/security/util/SecurityConstants$AWT
+9 -1: MAX_RADIX
+28 -1: (F)Ljava/lang/StringBuilder;
+11 -1: ([C[B[I[I)Z
+36 -1: (Ljava/lang/Class;)Ljava/lang/Class;
+32 -1: java/lang/invoke/MagicLambdaImpl
+6 -1: monday
+16 -1: closeClassLoader
+41 -1: (Ljava/util/concurrent/locks/Condition;)I
+8 -1: reversed
+27 -1: sun/util/calendar/Gregorian
+49 -1: (Lsun/nio/cs/FastCharsetProvider;)Ljava/util/Map;
+42 -1: (Ljava/lang/String;Ljava/lang/Throwable;)V
+18 -1: java/util/Calendar
+8 -1: vmtarget
+17 -1: TREEIFY_THRESHOLD
+41 -1: (Ljava/util/concurrent/locks/Condition;)Z
+9 -1: deadChild
+8 -1: EntrySet
+5 -1: log1p
+58 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/util/HashMap;)V
+9 -1: pageCount
+14 -1: slotToArgTable
+24 -1: toMethodDescriptorString
+25 -1: ([B)Ljava/nio/ByteBuffer;
+21 -1: twoToTheDoubleScaleUp
+32 -1: sun/misc/URLClassPath$FileLoader
+40 -1: (Ljava/util/List<Ljava/lang/String;>;Z)V
+6 -1: cache1
+6 -1: cache2
+27 -1: Ljava/net/URLStreamHandler;
+20 -1: Detect premature EOF
+94 -1: (Ljava/io/OutputStream;Ljava/lang/Object;Ljava/nio/charset/Charset;)Lsun/nio/cs/StreamEncoder;
+12 -1: NF_checkBase
+20 -1: (Ljava/nio/Buffer;)V
+45 -1: <E:Ljava/lang/Object;>Ljava/util/Vector<TE;>;
+4 -1: Sync
+12 -1: H_UNRESERVED
+32 -1: (Ljava/util/Map;)Ljava/util/Set;
+32 -1: (Ljava/util/Map$Entry<TK;TV;>;)Z
+25 -1: java/util/Locale$Category
+8 -1: receiver
+9 -1: MAX_VALUE
+4 -1: .RSA
+25 -1: Ljava/net/URLClassLoader;
+15 -1: Terminator.java
+26 -1: (Ljava/lang/String;TV;)TV;
+4 -1: null
+76 -1: (Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;)V
+9 -1: checkCast
+39 -1: ()Ljava/lang/AssertionStatusDirectives;
+15 -1: declaredMethods
+5 -1: clazz
+21 -1: Retention policy:
+20 -1: spreadArgElementType
+9 -1: WORD_MASK
+27 -1: ([IILjava/io/InputStream;)I
+11 -1: getMethodAt
+31 -1: (Ljava/net/URL;Ljava/net/URL;)Z
+13 -1: getLocaleName
+14 -1: isEnumConstant
+41 -1: (Ljava/lang/String;)Ljava/nio/CharBuffer;
+16 -1: newInvokeSpecial
+26 -1: (Ljava/nio/ByteBuffer;IS)V
+22 -1: sun/misc/JavaNioAccess
+184 -1: (Ljava/security/DomainCombiner;Ljava/lang/Class;Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;[Ljava/security/Permission;)Ljava/security/AccessControlContext;
+96 -1: (Ljava/lang/invoke/MethodHandle;ILjava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle;
+5 -1: ([S)I
+30 -1: java/security/AccessController
+37 -1: sun/misc/Launcher$SharedArchiveLoader
+4 -1: pack
+5 -1: ([S)V
+51 -1: failure before throwing exception, dump stack
+10 -1: dayOfMonth
+6 -1: CENSIG
+28 -1: java/util/function/Predicate
+26 -1: Malformed \\uxxxx encoding.
+9 -1: initIndex
+11 -1: invoke_LL_L
+23 -1: ConcurrentWeakInternSet
+14 -1: java/lang/Void
+42 -1: java/lang/String$CaseInsensitiveComparator
+38 -1: Ljava/lang/invoke/LambdaForm$Compiled;
+34 -1: java/util/Collections$SingletonSet
+142 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Class;)Ljava/lang/invoke/CallSite;
+35 -1: too many bootstrap method arguments
+17 -1: maxDelimCodePoint
+13 -1: previousIndex
+3 -1: pop
+6 -1: CENSIZ
+7 -1: ([Z[Z)Z
+11 -1: invoke_LL_V
+3 -1: pos
+33 -1: java/nio/file/WatchEvent$Modifier
+3 -1: pow
+12 -1: nextClearBit
+15 -1: Dictionary.java
+27 -1: sun/reflect/CallerSensitive
+13 -1: signatureType
+10 -1: dstSavings
+13 -1: UnicodeLittle
+16 -1: America/New_York
+82 -1: (Lsun/util/locale/BaseLocale;Lsun/util/locale/LocaleExtensions;)Ljava/util/Locale;
+25 -1: referenceKindIsConsistent
+62 -1: Ljava/nio/Buffer;Ljava/lang/Comparable<Ljava/nio/LongBuffer;>;
+4 -1: INTS
+11 -1: LOAD_FACTOR
+40 -1: sun/reflect/DelegatingMethodAccessorImpl
+16 -1: accumulateAndGet
+21 -1: (B)Ljava/lang/String;
+6 -1: UNSAFE
+13 -1: resolveOrFail
+21 -1: MapReduceMappingsTask
+5 -1: arity
+77 -1: (Ljava/io/FileDescriptor;ZZLjava/lang/Object;)Ljava/nio/channels/FileChannel;
+5 -1: value
+61 -1: Ljava/util/concurrent/ConcurrentHashMap$EntrySetView<TK;TV;>;
+6 -1: forJar
+52 -1: <T:Ljava/lang/Object;>Ljava/lang/ref/Reference<TT;>;
+21 -1: CREATE_ACC_PERMISSION
+28 -1: sun/misc/NativeSignalHandler
+11 -1: defineClass
+5 -1: match
+93 -1: (Ljava/util/zip/ZipFile;Ljava/util/zip/ZipFile$ZipFileInputStream;Ljava/util/zip/Inflater;I)V
+11 -1: Double.java
+30 -1: America/Argentina/Buenos_Aires
+8 -1: previous
+37 -1: (Ljava/io/Writer;Ljava/lang/String;)V
+9 -1: Synthetic
+18 -1: isVMAnonymousClass
+62 -1: ([Ljava/lang/Object;Ljava/lang/Object;Ljava/util/Comparator;)I
+22 -1: (JI)Ljava/lang/String;
+49 -1: (Ljava/lang/CharSequence;II)Ljava/io/PrintStream;
+52 -1: ([Ljava/lang/Thread;)[[Ljava/lang/StackTraceElement;
+12 -1: setDayOfWeek
+11 -1: getManifest
+30 -1: java/util/Locale$FilteringMode
+54 -1: (Ljava/lang/String;)Lsun/util/calendar/CalendarSystem;
+12 -1: nextHashCode
+19 -1: ()Ljava/io/Console;
+42 -1: AccessControlContext invoking the Combiner
+19 -1: shouldBeInitialized
+17 -1: invocationCounter
+21 -1: IMPLEMENTATION_VENDOR
+7 -1: chararr
+60 -1: (Ljava/lang/String;)Ljava/util/Iterator<Ljava/lang/String;>;
+11 -1: asCollector
+52 -1: (ILjava/lang/CharSequence;)Ljava/lang/StringBuilder;
+9 -1: exception
+22 -1: newInstanceCallerCache
+20 -1: nativeLibraryContext
+24 -1: MODIFY_THREAD_PERMISSION
+4 -1: WRAP
+19 -1: Method name is null
+32 -1: sun/invoke/util/ValueConversions
+7 -1: APP_TAG
+24 -1: (Ljava/util/Hashtable;)I
+23 -1: METHOD_FORMAL_PARAMETER
+18 -1: inflationThreshold
+24 -1: java/io/DeleteOnExitHook
+3 -1: pst
+13 -1: BITS_PER_WORD
+25 -1: getConstructorAnnotations
+17 -1: CheckedCollection
+24 -1: (Ljava/util/Hashtable;)V
+7 -1: inClass
+5 -1: getFD
+8 -1: readLong
+19 -1: aliases_ISO_8859_13
+19 -1: invokeWithArguments
+19 -1: aliases_ISO_8859_15
+42 -1: ()Ljava/util/concurrent/ConcurrentHashMap;
+8 -1: expandTo
+23 -1: java/text/MessageFormat
+8 -1: classID0
+11 -1: replaceWith
+21 -1: Invalid port number :
+65 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;)V
+19 -1: isGregorianLeapYear
+16 -1: asSpreaderChecks
+11 -1: withInitial
+10 -1: X-UTF-32BE
+57 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)V
+12 -1: wrong type:
+57 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Z
+17 -1: sun/misc/Resource
+14 -1: getReadTimeout
+8 -1: safeTrim
+38 -1: DIRECTIONALITY_RIGHT_TO_LEFT_EMBEDDING
+14 -1: isElementIndex
+23 -1: FilterOutputStream.java
+6 -1: (IJI)V
+3 -1: put
+57 -1: (Ljava/lang/String;[Ljava/lang/Object;)Ljava/lang/String;
+43 -1: Expecting an absolute path of the library:
+8 -1: checkRef
+53 -1: (Ljava/lang/String;)Ljava/lang/AbstractStringBuilder;
+74 -1: (Ljava/lang/Class<*>;[Ljava/lang/reflect/Field;)[Ljava/lang/reflect/Field;
+11 -1: user.script
+10 -1: H_ALPHANUM
+17 -1: getCalendarSystem
+48 -1: Ljava/util/concurrent/ConcurrentHashMap<TK;TV;>;
+17 -1: EnsureInitialized
+82 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;Ljava/lang/ThreadLocal;Ljava/lang/Object;)V
+243 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceMappingsToIntTask;Ljava/util/function/ToIntBiFunction;ILjava/util/function/IntBinaryOperator;)V
+26 -1: getAnnotatedExceptionTypes
+10 -1: validIndex
+6 -1: ([CC)I
+8 -1: overflow
+5 -1: getID
+93 -1: (Ljava/io/InputStream;Ljava/lang/Object;Ljava/nio/charset/Charset;)Lsun/nio/cs/StreamDecoder;
+22 -1: java/util/StringJoiner
+9 -1: putFields
+18 -1: USE_SHARED_ARCHIVE
+8 -1: thursday
+8 -1: nanoTime
+59 -1: (Lsun/reflect/annotation/AnnotationType;Ljava/lang/Class;)V
+69 -1: (Ljava/nio/charset/CoderResult$Cache;I)Ljava/nio/charset/CoderResult;
+36 -1: (J)Ljava/lang/AbstractStringBuilder;
+16 -1: java/util/Arrays
+6 -1: ([CC)V
+25 -1: registerAsParallelCapable
+4 -1: slot
+24 -1: java/net/URLConnection$1
+6 -1: koi8-r
+19 -1: should be of type
+46 -1: java/util/concurrent/ConcurrentHashMap$TreeBin
+6 -1: koi8-u
+34 -1: data type scale not a power of two
+53 -1: Ljava/util/Map<Ljava/lang/String;Ljava/lang/Object;>;
+21 -1: AccessibleObject.java
+53 -1: <E:Ljava/lang/Object;>()Ljava/util/NavigableSet<TE;>;
+88 -1: (Ljava/util/List;Ljava/util/Collection;Ljava/util/Locale$FilteringMode;)Ljava/util/List;
+17 -1: getAnnotationType
+36 -1: Ljava/util/HashMap$TreeNode<TK;TV;>;
+14 -1: declaringClass
+10 -1: read,write
+5 -1: getId
+10 -1: BIG_ENDIAN
+20 -1: PolymorphicSignature
+16 -1: comparingByValue
+67 -1: (ILjava/lang/invoke/MethodType;)[Ljava/lang/invoke/LambdaForm$Name;
+19 -1: java/util/Hashtable
+20 -1: getUnicodeLocaleKeys
+27 -1: ()Ljava/util/LinkedHashMap;
+51 -1: (Ljava/lang/CharSequence;)Ljava/lang/StringBuilder;
+30 -1: java/util/HashMap$HashIterator
+22 -1: (IZ)Ljava/lang/String;
+5 -1: yield
+34 -1: java/lang/Throwable$SentinelHolder
+62 -1: (Ljava/lang/invoke/MethodType;ZI)Ljava/lang/invoke/LambdaForm;
+5 -1: (FD)F
+17 -1: java/util/SubList
+24 -1: (Ljava/io/PrintStream;)V
+7 -1: LF.zero
+25 -1: java/util/StringTokenizer
+15 -1: ISO8859_15_FDIS
+11 -1: powerOfTwoD
+11 -1: powerOfTwoF
+22 -1: WeakHashMapSpliterator
+15 -1: refKindIsGetter
+12 -1: setRawOffset
+11 -1: setProperty
+23 -1: (Ljava/lang/Object;IB)V
+45 -1: (ILjava/lang/Object;)Ljava/util/HashMap$Node;
+13 -1: applyAsDouble
+83 -1: (Lsun/misc/URLClassPath$FileLoader;Ljava/lang/String;Ljava/net/URL;Ljava/io/File;)V
+19 -1: MethodAccessor.java
+9 -1: WALL_TIME
+7 -1: INVOKES
+13 -1: java.ext.dirs
+9 -1: getStatic
+56 -1: (Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/String;
+42 -1: (Ljava/util/function/UnaryOperator<TE;>;)V
+27 -1: java/lang/Class$MethodArray
+10 -1: H_USERINFO
+19 -1: PostVMInitHook.java
+7 -1: running
+32 -1: Warning: passing argument as-is
+13 -1: EntryIterator
+22 -1: NF_checkSpreadArgument
+46 -1: ([DLjava/util/function/IntToDoubleFunction;I)V
+7 -1: .<init>
+13 -1: mappingLength
+20 -1: implOnMalformedInput
+53 -1: (Ljava/lang/String;ILjava/lang/reflect/Executable;I)V
+26 -1: cannot make variable arity
+18 -1: SharedSecrets.java
+27 -1: (Ljava/io/InputStream;IZ)[B
+9 -1: Asia/Gaza
+55 -1: Ljava/util/Map<Ljava/lang/String;Ljava/lang/Class<*>;>;
+5 -1: NTLM
+19 -1: defaultCenturyStart
+18 -1: addElapsedTimeFrom
+38 -1: (Lsun/misc/Cleaner;)Lsun/misc/Cleaner;
+44 -1: (Ljava/io/OutputStream;ZLjava/lang/String;)V
+22 -1: (Ljava/lang/Object;B)V
+6 1: [LBar;
+7 -1: classes
+23 -1: java/net/URLClassLoader
+17 -1: sun/misc/Launcher
+163 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;)[Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
+12 -1: updateAndGet
+90 -1: (Ljava/net/URL;Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;)V
+9 -1: increment
+27 -1: (Ljava/lang/CharSequence;)V
+16 -1: Ljava/io/Reader;
+27 -1: java/io/PushbackInputStream
+6 -1: (JFZ)V
+17 -1: getAppClassLoader
+35 -1: sun/reflect/generics/tree/Signature
+9 -1: elementAt
+27 -1: (Ljava/lang/CharSequence;)Z
+10 -1: readDouble
+37 -1: ([B)Ljava/nio/charset/CharsetEncoder;
+46 -1: (Ljava/lang/ThreadGroup;Ljava/lang/Runnable;)V
+4 -1: park
+36 -1: java/lang/NegativeArraySizeException
+49 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/Class;)Z
+121 -1: <T:Ljava/lang/Object;U::Ljava/lang/Comparable<-TU;>;>(Ljava/util/function/Function<-TT;+TU;>;)Ljava/util/Comparator<TT;>;
+101 -1: (Ljava/lang/annotation/Annotation;Ljava/lang/annotation/Annotation;)Ljava/lang/annotation/Annotation;
+12 -1: .$|()[{^?*+\\
+6 -1: manRef
+3 -1: 437
+15 -1: newStringUnsafe
+15 -1: constantPoolOop
+10 -1: getPackage
+24 -1: FastCharsetProvider.java
+18 -1: getAnnotationBytes
+187 -1: (Ljava/security/DomainCombiner;Ljava/lang/Class<*>;Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;[Ljava/security/Permission;)Ljava/security/AccessControlContext;
+33 -1: Cannot suppress a null exception.
+27 -1: sun/nio/cs/StandardCharsets
+33 -1: (BB)Ljava/lang/invoke/MemberName;
+61 -1: ([Ljava/lang/ClassValue$Entry;ILjava/lang/ClassValue$Entry;)I
+10 -1: X-UTF-32LE
+5 -1: toMap
+89 -1: (Ljava/lang/Class<*>;Ljava/util/List<Ljava/lang/Class<*>;>;)Ljava/lang/invoke/MethodType;
+46 -1: ([Ljava/lang/Object;IILjava/util/Comparator;)V
+66 -1: ([Ljava/lang/reflect/Constructor;)[Ljava/lang/reflect/Constructor;
+22 -1: ()Ljava/nio/ByteOrder;
+20 -1: isMethodHandleInvoke
+25 -1: sun/net/www/URLConnection
+89 -1: Ljava/util/concurrent/ConcurrentHashMap<Ljava/lang/String;Ljava/lang/invoke/LambdaForm;>;
+49 -1: (Ljava/nio/charset/Charset;FFLjava/lang/String;)V
+17 -1: MIN_LOW_SURROGATE
+23 -1: AbstractCollection.java
+19 -1: (Ljava/util/Date;)I
+19 -1: (Ljava/util/Date;)J
+12 -1: cldrdata.jar
+4 -1: path
+77 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Class;IILjava/lang/String;[B)V
+6 -1: MS1250
+37 -1: setJavaSecurityProtectionDomainAccess
+11 -1: isDelimiter
+5 -1: char0
+6 -1: MS1251
+5 -1: char1
+16 -1: getJavaNetAccess
+6 -1: MS1252
+6 -1: MS1253
+6 -1: MS1254
+51 -1: (Ljava/lang/Class;)Ljava/security/ProtectionDomain;
+6 -1: MS1257
+93 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;Ljava/security/ProtectionDomain;)Ljava/lang/Class<*>;
+10 -1: access$300
+5 -1: (JZ)C
+19 -1: (Ljava/util/Date;)Z
+5 -1: (JZ)D
+26 -1: java/lang/Character$Subset
+10 -1: access$302
+5 -1: (JZ)F
+9 -1: emptyList
+5 -1: (JZ)I
+5 -1: (JZ)J
+23 -1: (Ljava/lang/Runnable;)V
+27 -1: java/lang/invoke/MemberName
+29 -1: ()Ljava/util/Comparator<TT;>;
+18 -1: retrieveDirectives
+7 -1: ([F[F)Z
+40 -1: (Lsun/misc/URLClassPath;Ljava/net/URL;)V
+5 -1: (JZ)S
+40 -1: (Ljava/util/function/IntUnaryOperator;)I
+5 -1: (JZ)V
+16 -1: parseAnnotations
+21 -1: (C)Ljava/lang/String;
+73 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(TK;TV;)Ljava/util/Map<TK;TV;>;
+15 -1: charset encoder
+17 -1: getDomainCombiner
+9 -1: EmptyList
+15 -1: java.vm.version
+19 -1: getResourceAsStream
+94 -1: Ljava/lang/ThreadLocal<Ljava/lang/ref/SoftReference<Ljava/lang/StringCoding$StringEncoder;>;>;
+26 -1: java/util/HashMap$TreeNode
+22 -1: (Ljava/util/HashMap;)V
+23 -1: sun/misc/URLClassPath$1
+65 -1: ([Ljava/net/URL;Ljava/lang/ClassLoader;)Ljava/net/URLClassLoader;
+20 -1: Hashtable Enumerator
+23 -1: sun/misc/URLClassPath$2
+10 -1: Array.java
+8 -1: FT_LIMIT
+24 -1: ()[Ljava/lang/Throwable;
+23 -1: sun/misc/URLClassPath$3
+14 -1: java/io/Writer
+5 -1: chars
+76 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>()Ljava/util/NavigableMap<TK;TV;>;
+6 -1: final
+5 -1: error
+34 -1: java/lang/ApplicationShutdownHooks
+29 -1: Lsun/launcher/LauncherHelper;
+30 -1: ()Ljava/util/Enumeration<TE;>;
+47 -1: (Ljava/util/List;)Ljava/lang/invoke/MethodType;
+9 -1: scriptKey
+5 -1: BYTES
+12 -1: getException
+69 -1: (Ljava/lang/Class<*>;Ljava/lang/Object;)Ljava/lang/invoke/MethodType;
+14 -1: Illegal Load:
+189 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$ReduceValuesTask;Ljava/util/function/BiFunction;)V
+66 -1: java/util/concurrent/ConcurrentHashMap$MapReduceMappingsToLongTask
+29 -1: getJavaIOFileDescriptorAccess
+11 -1: toCodePoint
+15 -1: setCreationTime
+18 -1: NULL_CAUSE_MESSAGE
+8 -1: elements
+32 -1: ()Ljava/nio/charset/CoderResult;
+8 -1: utf-32be
+7 -1: addDate
+4 -1: Cast
+23 -1: sun/misc/JavaLangAccess
+8 -1: 0{1,12}$
+27 -1: (Ljava/util/ArrayList;III)V
+11 -1: lastIndexOf
+14 -1: getCodeSources
+53 -1: (Lsun/util/calendar/CalendarDate;Ljava/lang/String;)V
+17 -1: cachedConstructor
+7 -1: forName
+74 -1: (Ljava/util/function/ToLongFunction;Ljava/lang/Object;Ljava/lang/Object;)I
+47 -1: (Ljava/lang/Object;)Lsun/reflect/FieldAccessor;
+8 -1: getDebug
+18 -1: currentClassLoader
+49 -1: Illegal leading minus sign on unsigned string %s.
+20 -1: toLowerCaseCharArray
+38 -1: java/util/concurrent/ConcurrentHashMap
+8 -1: isHidden
+92 -1: (Ljava/lang/Thread;ILjava/lang/Object;Ljava/lang/Thread;JJJJ[Ljava/lang/StackTraceElement;)V
+29 -1: java/lang/ArithmeticException
+26 -1: (Ljava/io/OutputStream;Z)V
+66 -1: (Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/RuntimeException;
+38 -1: Ljava/util/Map<Ljava/lang/String;TT;>;
+16 -1: getFindClassTime
+34 -1: ([J)Ljava/util/Spliterator$OfLong;
+24 -1: UnmodifiableNavigableSet
+32 -1: java/lang/ClassNotFoundException
+3 -1: \\n
+6 -1: SEALED
+14 -1: Flushable.java
+3 -1: HST
+24 -1: (Ljava/lang/Object;JII)Z
+13 -1: toSecondOfDay
+16 -1: thenComparingInt
+26 -1: java/lang/NoSuchFieldError
+18 -1: java/util/Locale$1
+25 -1: [Ljava/util/HashMap$Node;
+75 -1: ([Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)Ljava/lang/String;
+11 -1: x-mswin-936
+32 -1: java/lang/management/MemoryUsage
+25 -1: (JS)Ljava/nio/ByteBuffer;
+25 -1: java/lang/ref/Finalizer$1
+25 -1: java/lang/ref/Finalizer$2
+21 -1: (Ljava/util/BitSet;)V
+25 -1: java/lang/ref/Finalizer$3
+83 -1: <T:Ljava/lang/Object;>(Ljava/util/Collection<+TT;>;Ljava/util/Comparator<-TT;>;)TT;
+24 -1: sun/nio/ch/Interruptible
+21 -1: (Ljava/util/BitSet;)Z
+72 -1: ([Ljava/security/ProtectionDomain;Ljava/security/AccessControlContext;)V
+54 -1: Ljava/util/AbstractSet<Ljava/util/Map$Entry<TK;TV;>;>;
+34 -1: getConstructorParameterAnnotations
+4 -1: name
+92 -1: <E:Ljava/lang/Enum<TE;>;>Ljava/lang/Object;Ljava/lang/Comparable<TE;>;Ljava/io/Serializable;
+11 -1: FORM_OFFSET
+13 -1: getAliasTable
+5 -1: (DD)D
+23 -1: reflectionFactoryAccess
+221 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceValuesTask;Ljava/util/function/Function;Ljava/util/function/BiFunction;)V
+59 -1: (Ljava/lang/String;[Ljava/lang/String;)Ljava/nio/file/Path;
+6 -1: DELETE
+10 -1: returnType
+5 -1: (DD)I
+51 -1: ()Lsun/reflect/generics/repository/FieldRepository;
+8 -1: delegate
+12 -1: OTHER_LETTER
+18 -1: getTransitionIndex
+3 -1: HUP
+10 -1: (IIII[CI)V
+10 -1: ISO_8859-1
+17 -1: ArrayEncoder.java
+10 -1: ISO_8859-2
+34 -1: java/lang/reflect/AnnotatedElement
+10 -1: ISO_8859-4
+27 -1: sun/nio/cs/UTF_16LE$Decoder
+10 -1: ISO_8859-5
+13 -1: prefetchWrite
+9 -1: getFloatB
+10 -1: ISO_8859-7
+37 -1: (I)Ljava/lang/invoke/LambdaForm$Name;
+10 -1: ISO_8859-9
+10 -1: getActions
+11 -1: negateExact
+10 -1: isAbstract
+9 -1: getFloatL
+29 -1: java/lang/ClassValue$Identity
+14 -1: java/io/Reader
+8 -1: getOwner
+24 -1: java/lang/AssertionError
+17 -1: MethodHandle.java
+19 -1: classRedefinedCount
+10 -1: cachedYear
+15 -1: getAndIncrement
+26 -1: java.protocol.handler.pkgs
+14 -1: cleanSomeSlots
+27 -1: java/util/Spliterator$OfInt
+31 -1: getRawExecutableTypeAnnotations
+20 -1: ensureInitialization
+7 -1: os.arch
+57 -1: (Ljava/security/cert/CertPath;Ljava/security/Timestamp;)V
+21 -1: UNSAFE_COPY_THRESHOLD
+20 -1: toUnsignedBigInteger
+82 -1: (Ljava/util/concurrent/locks/Condition;)Ljava/util/Collection<Ljava/lang/Thread;>;
+15 -1: Reflection.java
+12 -1: decryptBlock
+3 -1: \\r
+8 -1: newArray
+8 -1: Category
+36 -1: java/lang/reflect/GenericDeclaration
+22 -1: (Ljava/lang/String;Z)V
+8 -1: suspend0
+10 -1: getSigners
+22 -1: (Ljava/lang/String;Z)Z
+31 -1: Unable to create temporary file
+117 -1: <T:Ljava/lang/Object;>(Ljava/lang/ClassValue<TT;>;Ljava/lang/ClassValue$Entry<TT;>;)Ljava/lang/ClassValue$Entry<TT;>;
+17 -1: channelsAvailable
+9 -1: Date.java
+13 -1: toIndex < 0:
+18 -1: mark > position: (
+11 -1: loadConvert
+4 -1: july
+42 -1: (Ljava/math/BigInteger;)Ljava/lang/String;
+6 -1: enable
+47 -1: (Ljava/util/zip/ZipEntry;)Ljava/io/InputStream;
+6 -1: unpack
+13 -1: setDayOfMonth
+19 -1: name can't be empty
+16 -1: getExtensionKeys
+15 -1: getAndDecrement
+36 -1: Ljava/lang/ClassValue$ClassValueMap;
+38 -1: (Ljava/lang/Class;Ljava/lang/String;)V
+11 -1: csISOlatin0
+9 -1: retention
+23 -1: system protocol handler
+9 -1: nullsLast
+15 -1: refKindIsStatic
+3 -1: (\n
+48 -1: sun/launcher/LauncherHelper$ResourceBundleHolder
+29 -1: ()Ljava/util/LinkedList<TE;>;
+11 -1: csISOlatin9
+31 -1: ([CII)Ljava/lang/StringBuilder;
+29 -1: (II)Ljava/lang/StringBuilder;
+7 -1: pdcache
+4 -1: june
+12 -1: ;/?:@&=+$,[]
+141 -1: ([Ljava/lang/invoke/LambdaForm$Name;[Ljava/lang/invoke/LambdaForm$Name;Ljava/lang/invoke/LambdaForm$Name;)[Ljava/lang/invoke/LambdaForm$Name;
+32 -1: ()[Ljava/util/WeakHashMap$Entry;
+110 -1: (Ljava/lang/Class<*>;ILjava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle;
+81 -1: (Lsun/reflect/annotation/AnnotationType;Lsun/reflect/annotation/AnnotationType;)Z
+46 -1: String value %s exceeds range of unsigned int.
+6 -1: close0
+6 -1: (JDZ)V
+160 -1: <T:Ljava/lang/Object;>Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/reflect/GenericDeclaration;Ljava/lang/reflect/Type;Ljava/lang/reflect/AnnotatedElement;
+12 -1: LinkedValues
+24 -1: java/nio/HeapCharBufferR
+23 -1: jvmVersionInfoAvailable
+16 -1: classLoaderDepth
+33 -1: (Lsun/nio/ch/DirectBuffer;IIIII)V
+32 -1: java/nio/file/attribute/FileTime
+50 -1: java/util/concurrent/ConcurrentHashMap$CounterCell
+73 -1: (Lsun/misc/URLClassPath$JarLoader;Lsun/misc/JarIndex;)Lsun/misc/JarIndex;
+60 -1: (Ljava/net/URL;Ljava/lang/String;)Ljava/security/CodeSource;
+25 -1: Ljava/lang/ref/Finalizer;
+12 -1: utf-32be-bom
+40 -1: (Ljava/lang/String;ILjava/lang/Object;)V
+9 -1: THROW_UCS
+23 -1: java/util/AbstractMap$1
+23 -1: java/util/AbstractMap$2
+10 -1: x-utf-32be
+4 -1: (S)B
+60 -1: (Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/LambdaForm;
+20 -1: ResourceBundleHolder
+4 -1: (S)I
+13 -1: getSuppressed
+17 -1: jdk_micro_version
+4 -1: (S)J
+9 -1: isNumeric
+10 -1: variantKey
+8 -1: utf-32le
+47 -1: java/util/concurrent/ConcurrentHashMap$MapEntry
+25 -1: ()Ljava/lang/Class<-TT;>;
+6 -1: closed
+4 -1: (S)S
+15 -1: setStandardTime
+10 -1: ShortCache
+4 -1: (S)V
+40 -1: sun/net/www/MessageHeader$HeaderIterator
+17 -1: jdk_major_version
+8 -1: FXHelper
+6 -1: CENTIM
+19 -1: java/security/Guard
+46 -1: java.lang.invoke.MethodHandle.DUMP_CLASS_FILES
+4 -1: ENUM
+27 -1: Ljava/lang/SecurityManager;
+39 -1: ([Ljava/lang/Class;[Ljava/lang/Class;)Z
+11 -1: getFieldAt0
+12 -1: user.variant
+28 -1: (Ljava/io/DataInputStream;)V
+44 -1: ([JLjava/util/function/LongBinaryOperator;)V
+7 -1: getRoot
+3 -1: +
+16 -1: identityHashCode
+25 -1: java/security/Permissions
+16 -1: Ljava/net/Proxy;
+23 -1: java/io/ExpiringCache$1
+5 -1: more
+10 -1: formatList
+49 -1: (Ljava/lang/String;)Lsun/launcher/LauncherHelper;
+29 -1: Relative path in absolute URI
+11 -1: checkMapped
+8 -1: Checksum
+8 -1: " Radix:
+9 -1: getAndAdd
+9 -1: implReady
+16 -1: SynchronizedList
+30 -1: [Ljava/lang/StackTraceElement;
+5 -1: right
+13 -1: UTF_16BE.java
+4 -1: HEAD
+11 -1: isInvocable
+6 -1: ENDCOM
+15 -1: getPropertiesEx
+6 -1: Unsafe
+7 -1: IBM-819
+37 -1: : 0 <= i2 && i2 < names.length: 0 <=
+19 -1: filterAndAddHeaders
+22 -1: nativeParkEventPointer
+18 -1: checkPositionIndex
+13 -1: invalid url:
+25 -1: out of range from input
+9 -1: loadClass
+12 -1: encodingName
+9 -1: x-JIS0208
+38 -1: (Ljava/lang/Class;Ljava/lang/Object;)Z
+28 -1: (I)Ljava/lang/reflect/Field;
+17 -1: getJvmVersionInfo
+6 -1: LIJFDV
+21 -1: (D)Ljava/lang/String;
+7 -1: oomeMsg
+30 -1: java/io/InvalidObjectException
+25 -1: java/io/FilterInputStream
+32 -1: Ljava/net/ContentHandlerFactory;
+13 -1: toUnsignedInt
+17 -1: reconstitutionPut
+37 -1: (Ljava/lang/Object;)Ljava/lang/Class;
+14 -1: getContentType
+43 -1: java/util/Collections$SynchronizedSortedSet
+24 -1: (II)Ljava/nio/file/Path;
+25 -1: JAVAFX_APPLICATION_MARKER
+29 -1: (IC)Ljava/lang/StringBuilder;
+13 -1: java/util/Set
+10 -1: clearError
+64 -1: (Ljava/lang/invoke/MethodType;[I)Ljava/lang/invoke/MethodHandle;
+25 -1: java/io/FileInputStream$1
+8 -1: getFirst
+36 -1: (Lsun/reflect/ConstructorAccessor;)V
+84 -1: (Ljava/util/NavigableMap;Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/NavigableMap;
+42 -1: (Ljava/lang/CharSequence;)Ljava/io/Writer;
+52 -1: ([Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
+6 -1: (IFI)V
+62 -1: <E:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Queue<TE;>;
+17 -1: getHeaderFieldInt
+16 -1: CheckedSortedMap
+39 -1: (ZILjava/lang/String;)Ljava/lang/Class;
+10 -1: getterName
+10 -1: Asia/Tokyo
+4 -1: Node
+7 -1: rotate1
+13 -1: Stream closed
+7 -1: rotate2
+9 -1: checkExec
+17 -1: NF_checkExactType
+18 -1: ReverseComparator2
+18 -1: arrayElementGetter
+97 -1: (Ljava/util/ArrayPrefixHelpers$DoubleCumulateTask;Ljava/util/function/DoubleBinaryOperator;[DII)V
+9 -1: iso8859-1
+9 -1: iso8859-2
+9 -1: iso8859-4
+9 -1: iso8859-5
+9 -1: iso8859-7
+16 -1: getPermissions
+9 -1: iso8859-9
+9 -1: fromClass
+17 -1: with modifiers "
+8 -1: isBooted
+24 -1: getCommonPoolParallelism
+10 -1: initialize
+47 -1: <T:Ljava/lang/Object;>(TT;)Ljava/util/Set<TT;>;
+17 -1: checkElementIndex
+14 -1: openConnection
+47 -1: (Ljava/lang/Thread;Lsun/nio/ch/Interruptible;)V
+12 -1: isAuthorized
+17 -1: ReduceEntriesTask
+7 -1: command
+24 -1: ArithmeticException.java
+24 -1: ensureOpenOrZipException
+67 -1: (Lsun/util/calendar/CalendarDate;I)Lsun/util/calendar/CalendarDate;
+39 -1: Ljava/lang/invoke/MethodHandles$Lookup;
+31 -1: Enclosing constructor not found
+34 -1: ()Lsun/util/calendar/BaseCalendar;
+25 -1: (JLjava/lang/Object;JJJ)V
+12 -1: > toIndex:
+22 -1: LocaleObjectCache.java
+19 -1: sun/misc/Launcher$1
+31 -1: java/util/HashMap$EntryIterator
+8 -1: contains
+60 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/lang/Object;
+53 -1: (I[Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
+19 -1: java/io/PrintStream
+42 -1: java/lang/Math$RandomNumberGeneratorHolder
+100 -1: <K:Ljava/lang/Object;>(I)Ljava/util/concurrent/ConcurrentHashMap$KeySetView<TK;Ljava/lang/Boolean;>;
+14 -1: getCapturedArg
+14 -1: getCodeSigners
+20 -1: mark() not supported
+56 -1: (Lsun/misc/URLClassPath;I)Lsun/misc/URLClassPath$Loader;
+20 -1: java/lang/StrictMath
+14 -1: annotationType
+3 -1: IET
+4 -1: lang
+13 -1: JarEntry.java
+9 -1: ([CIIII)I
+9 -1: canEncode
+5 -1: extra
+30 -1: java/lang/ref/ReferenceQueue$1
+37 -1: java/nio/channels/ReadableByteChannel
+73 -1: (Ljava/util/Map$Entry<Ljava/lang/String;Ljava/io/ExpiringCache$Entry;>;)Z
+24 -1: java/io/BufferedReader$1
+10 -1: x-utf-32le
+16 -1: methodDescriptor
+25 -1: (IJ)Ljava/nio/ByteBuffer;
+18 -1: getSystemResources
+46 -1: (Ljava/lang/String;I)Ljava/util/regex/Pattern;
+46 -1: (Ljava/net/URL;)Lsun/misc/URLClassPath$Loader;
+20 -1: calendars.properties
+25 -1: implOnUnmappableCharacter
+12 -1: signers_name
+40 -1: (ZILjava/util/Locale;)Ljava/lang/String;
+8 -1: (TE;)TE;
+50 -1: ()Lsun/util/locale/provider/LocaleProviderAdapter;
+11 -1: key is null
+7 -1: encrypt
+21 -1: millisUntilExpiration
+55 -1: Unable to parse property sun.reflect.inflationThreshold
+9 -1: checkExit
+5 -1: SHORT
+43 -1: java/util/Collections$UnmodifiableSortedSet
+10 -1: ISO8859_15
+16 -1: verifyParameters
+24 -1: buildAnnotatedInterfaces
+15 -1: refKindIsSetter
+45 -1: (JLjava/util/function/BiConsumer<-TK;-TV;>;)V
+23 -1: (Ljava/lang/Object;IC)V
+90 -1: <T:Ljava/lang/Object;>(Ljava/lang/ClassValue$Entry<TT;>;)Ljava/lang/ClassValue$Entry<TT;>;
+30 -1: (Ljava/net/URL;)Ljava/net/URI;
+60 -1: (BLjava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Object;)V
+43 -1: (Ljava/util/Collection;Ljava/lang/Object;)I
+44 -1: (Ljava/net/URLConnection;)Ljava/lang/Object;
+17 -1: Stream not marked
+11 -1: targetCheck
+127 -1: (Ljava/lang/Class<*>;ILjava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Object;[Ljava/lang/Object;)Ljava/lang/invoke/MemberName;
+11 -1: debugString
+112 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle;
+43 -1: (Ljava/util/Collection;Ljava/lang/Object;)V
+15 -1: NF_staticOffset
+22 -1: CASE_INSENSITIVE_ORDER
+6 -1: unpark
+29 -1: (Ljava/lang/CharSequence;II)I
+59 -1: Ljava/util/concurrent/ConcurrentHashMap$KeySetView<TK;TV;>;
+19 -1: defaultFormatLocale
+7 -1: combine
+58 -1: (Ljava/util/Locale$LocaleKey;)Lsun/util/locale/BaseLocale;
+29 -1: (Ljava/lang/CharSequence;II)V
+35 -1: sun/util/calendar/BaseCalendar$Date
+57 -1: Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater;
+75 -1: ([Ljava/lang/reflect/Member;[Ljava/lang/String;)[Ljava/lang/reflect/Member;
+15 -1: MethodType_init
+5 -1: (JF)V
+20 -1: AUTOSELECT_FILTERING
+12 -1: invokeStatic
+18 -1: readFileDescriptor
+22 -1: java/lang/Terminator$1
+72 -1: (Ljava/lang/Object;Ljava/util/function/UnaryOperator;)Ljava/lang/Object;
+17 -1: EMPTY_STACK_TRACE
+13 -1: isSamePackage
+32 -1: ()Ljava/security/DomainCombiner;
+10 -1: decodeLoop
+30 -1: DIRECTIONALITY_EUROPEAN_NUMBER
+112 -1: (Ljava/util/List<Ljava/util/Locale$LanguageRange;>;Ljava/util/Collection<Ljava/lang/String;>;)Ljava/lang/String;
+33 -1: (Ljava/util/function/Predicate;)Z
+35 -1: logincontext login context results
+17 -1: sun/nio/cs/UTF_16
+13 -1: SingletonList
+5 -1: end=
+7 -1: getURLs
+17 -1: traceInstructions
+22 -1: generateCustomizedCode
+9 -1: NO_CHANGE
+11 -1: Number.java
+49 -1: <T:Ljava/lang/Object;>(ITT;)Ljava/util/List<TT;>;
+19 -1: checkSpecifyHandler
+8 -1: setValue
+30 -1: (Ljava/net/URL;)Ljava/net/URL;
+22 -1: (Ljava/lang/Object;C)V
+19 -1: Negative capacity:
+24 -1: ArrayStoreException.java
+52 -1: (Ljava/lang/StringBuffer;II)Ljava/lang/StringBuffer;
+14 -1: linkMethodImpl
+42 -1: java/util/InvalidPropertiesFormatException
+4 -1: last
+19 -1: getLocalizedMessage
+65 -1: (Ljava/text/MessageFormat;[Ljava/lang/String;)[Ljava/lang/String;
+61 -1: Ljava/lang/Object;Ljava/util/Enumeration<Ljava/lang/Object;>;
+40 -1: (I[CII)Ljava/lang/AbstractStringBuilder;
+27 -1: java.launcher.opt.datamodel
+29 -1: (Ljava/lang/reflect/Method;)V
+19 -1: SPECIFICATION_TITLE
+123 -1: (Ljava/lang/Class;[Ljava/lang/Class;[Ljava/lang/Class;ILjava/lang/Class;)Lsun/reflect/SerializationConstructorAccessorImpl;
+32 -1: (I[CII)Ljava/lang/StringBuilder;
+29 -1: (Ljava/lang/reflect/Method;)Z
+23 -1: (Z[B)Ljava/lang/String;
+27 -1: sun/nio/cs/Surrogate$Parser
+32 -1: (Ljavax/security/auth/Subject;)Z
+29 -1: ()Ljava/lang/invoke/Invokers;
+7 -1: getPool
+7 -1: textOut
+12 -1: getEntryTime
+14 -1: classModifiers
+47 -1: (Ljava/util/Locale$Category;)Ljava/util/Locale;
+32 -1: getInheritedAccessControlContext
+4 -1: rcbt
+37 -1: (Ljava/lang/Class<*>;Ljava/io/File;)Z
+25 -1: AccessControlContext.java
+22 -1: FileURLConnection.java
+12 -1: NaturalOrder
+34 -1: sun/util/calendar/CalendarSystem$1
+94 -1: ([Ljava/lang/reflect/Method;Ljava/lang/String;[Ljava/lang/Class<*>;)Ljava/lang/reflect/Method;
+17 -1: No enum constant
+7 -1: ([DII)V
+8 -1: register
+23 -1: FINAL_QUOTE_PUNCTUATION
+27 -1: ACCESS_CLIPBOARD_PERMISSION
+15 -1: verifyConstants
+20 -1: (Ljava/io/Writer;I)V
+45 -1: (Ljava/lang/String;)Ljava/lang/reflect/Field;
+24 -1: linkMethodHandleConstant
+43 -1: (Ljava/io/OutputStream;Ljava/lang/String;)V
+125 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/Comparator<-TV;>;)Ljava/util/Comparator<Ljava/util/Map$Entry<TK;TV;>;>;
+14 -1: ALL_PERMISSION
+12 -1: createObject
+10 -1: CRC32.java
+14 -1: reservedMemory
+22 -1: ensureCapacityInternal
+11 -1: FormatData_
+9 -1: maxMemory
+27 -1: (I)Ljava/util/ListIterator;
+8 -1: UTF-16BE
+27 -1: AbstractSequentialList.java
+10 -1: access$400
+16 -1: Locale settings:
+10 -1: access$402
+12 -1: HashSet.java
+24 -1: java/lang/Long$LongCache
+30 -1: [Ljava/lang/reflect/Parameter;
+11 -1: single_step
+45 -1: (Ljava/lang/String;)Lsun/security/util/Debug;
+97 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;)Ljava/lang/invoke/SimpleMethodHandle;
+16 -1: indexOfBangSlash
+7 -1: region=
+26 -1: ([BII)Ljava/lang/Class<*>;
+8 -1: bitCount
+3 -1: INT
+67 -1: <T:Ljava/lang/Object;>([TT;Ljava/util/function/IntFunction<+TT;>;)V
+35 -1: newGetFloatIllegalArgumentException
+11 -1: ([DII[DII)V
+22 -1: makePreparedLambdaForm
+3 -1: <
+35 -1: sun/management/GarbageCollectorImpl
+4 -1: (*)*
+7 -1: getPort
+18 -1: java/io/FileSystem
+7 -1: getNode
+38 -1: (Ljava/lang/Object;I)Ljava/lang/Class;
+36 -1: $SwitchMap$java$util$Locale$Category
+18 -1: securityCheckCache
+5 -1: cdate
+10 -1: childValue
+19 -1: getMainClassFromJar
+70 -1: <T:Ljava/lang/Enum<TT;>;>(Ljava/lang/Class<TT;>;Ljava/lang/String;)TT;
+20 -1: unsuspendSomeThreads
+29 -1: sun.classloader.findClassTime
+11 -1: plusSeconds
+3 -1: =
+4 -1: Lock
+7 -1: regions
+38 -1: ()Ljava/lang/reflect/Constructor<TT;>;
+25 -1: parseParameterAnnotations
+20 -1: getSystemGMTOffsetID
+33 -1: [Cc][Oo][Dd][Ee][Bb][Aa][Ss][Ee]=
+37 -1: (Ljava/lang/String;I)Ljava/lang/Byte;
+10 -1: permission
+78 -1: (Ljava/lang/reflect/Constructor;)Lsun/reflect/generics/scope/ConstructorScope;
+28 -1: (Lsun/misc/JavaLangAccess;)V
+26 -1: GET_CLASSLOADER_PERMISSION
+24 -1: (J)Ljava/nio/ByteBuffer;
+20 -1: getUnresolvedActions
+49 -1: (I[BIILsun/security/util/ManifestEntryVerifier;)V
+5 -1: (ZJ)V
+14 -1: isClassOnlyJar
+35 -1: ()[Ljava/util/HashMap$Node<TK;TV;>;
+23 -1: ()Ljava/util/SortedMap;
+29 -1: HistoricallyNamedCharset.java
+30 -1: no leading reference parameter
+8 -1: csCESU-8
+3 -1: >
+13 -1: invoke_LLLL_L
+109 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/NavigableMap<TK;+TV;>;)Ljava/util/NavigableMap<TK;TV;>;
+13 -1: invoke_LLLL_V
+46 -1: (Ljava/lang/Class;Z)[Ljava/lang/reflect/Field;
+5 -1: offer
+12 -1: isoLanguages
+61 -1: (Ljava/io/OutputStream;Ljava/lang/String;Ljava/lang/String;)V
+44 -1: sun/reflect/BootstrapConstructorAccessorImpl
+12 -1: BaseIterator
+58 -1: (IZ[Ljava/lang/Class;[Ljava/lang/Class;)Ljava/lang/String;
+23 -1: initializeOSEnvironment
+62 -1: ([Ljava/security/cert/Certificate;)[Ljava/security/CodeSigner;
+3 -1: >>
+13 -1: searchEntries
+7 -1: setDate
+3 -1: red
+3 -1: ref
+10 -1: EMPTY_LIST
+3 -1: rem
+78 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractCollection<TE;>;Ljava/util/List<TE;>;
+9 -1: scanToken
+6 -1: greek8
+9 -1: basicType
+12 -1: getFromClass
+43 -1: averageCharsPerByte exceeds maxCharsPerByte
+8 -1: isDaemon
+7 -1: nonNull
+17 -1: Invalid default:
+45 -1: (Lsun/misc/URLClassPath;Ljava/lang/String;Z)V
+18 -1: java/lang/String$1
+11 -1: copyMethods
+15 -1: sun/misc/Signal
+5 -1: float
+18 -1: StreamDecoder.java
+19 -1: no such constructor
+14 -1: bad arity for
+14 -1: divideUnsigned
+10 -1: CODING_END
+3 -1: IST
+14 -1: HeaderIterator
+9 -1: september
+20 -1: makeVarargsCollector
+6 -1: L_PATH
+45 -1: (Ljava/lang/String;)Ljava/io/File$PathStatus;
+24 -1: URI scheme is not "file"
+85 -1: (Ljava/lang/Class<TT;>;Ljava/lang/Class<TV;>;Ljava/lang/String;Ljava/lang/Class<*>;)V
+27 -1: java/util/function/Supplier
+17 -1: checkedCollection
+8 -1: MapEntry
+81 -1: (Ljava/lang/invoke/MethodHandle;ILjava/util/List;)Ljava/lang/invoke/MethodHandle;
+34 -1: java/security/ProtectionDomain$Key
+14 -1: List length =
+39 -1: ([Ljava/lang/Object;)Ljava/lang/String;
+87 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/util/function/BiFunction;)Ljava/lang/Object;
+7 -1: unparse
+28 -1: jarFileHasClassPathAttribute
+40 -1: (Lsun/misc/JavaIOFileDescriptorAccess;)V
+30 -1: (Ljava/lang/reflect/Field;ZZ)V
+22 -1: GetPropertyAction.java
+8 -1: RUNNABLE
+10 -1: exprString
+13 -1: getAnnotation
+19 -1: class can't be null
+22 -1: defaultAssertionStatus
+8 -1: getName0
+16 -1: quoteReplacement
+15 -1: getMemberVMInfo
+42 -1: (Ljava/lang/Class<*>;)Ljava/lang/Class<*>;
+16 -1: cachedLambdaForm
+16 -1: addFinalRefCount
+12 -1: getMethodAt0
+8 -1: ([ZII)[Z
+44 -1: (Ljava/lang/Object;TV;Ljava/lang/Object;)TV;
+4 -1: [TT;
+29 -1: Ljava/lang/invoke/LambdaForm;
+28 -1: java/util/DualPivotQuicksort
+61 -1: ()Ljava/util/concurrent/ConcurrentHashMap$KeySetView<TK;TV;>;
+17 -1: registerDirectory
+8 -1: jarFiles
+69 -1: (Ljava/lang/CharSequence;[Ljava/lang/CharSequence;)Ljava/lang/String;
+54 -1: [Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
+15 -1: getDefaultValue
+39 -1: sun/util/calendar/ZoneInfoFile$Checksum
+20 -1: DISABLE_JAR_CHECKING
+12 -1: CONTENT_TYPE
+46 -1: array type not assignable to trailing argument
+60 -1: <T:Ljava/lang/Object;>([TT;II)Ljava/util/stream/Stream<TT;>;
+47 -1: java.lang.invoke.MethodHandle.COMPILE_THRESHOLD
+9 -1: toInstant
+152 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/NavigableMap<TK;TV;>;Ljava/lang/Class<TK;>;Ljava/lang/Class<TV;>;)Ljava/util/NavigableMap<TK;TV;>;
+7 -1: L_ALPHA
+29 -1: java/lang/AbstractMethodError
+29 -1: java/util/jar/Attributes$Name
+15 -1: LOCALE_SETTINGS
+19 -1: (J)Ljava/lang/Long;
+4 -1: jar:
+17 -1: ensureInitialized
+13 -1: LAST_MODIFIED
+40 -1: ([Ljava/lang/String;)[Ljava/lang/String;
+7 -1: shuffle
+70 -1: (Lsun/util/locale/LanguageTag;)Lsun/util/locale/InternalLocaleBuilder;
+19 -1: isPackageAccessible
+17 -1: compileToBytecode
+11 -1: getPackages
+237 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceKeysToIntTask;Ljava/util/function/ToIntFunction;ILjava/util/function/IntBinaryOperator;)V
+53 -1: java/util/concurrent/ConcurrentHashMap$KeySpliterator
+26 -1: setURLStreamHandlerFactory
+47 -1: access print all checkPermission results
+22 -1: sun/reflect/MethodInfo
+75 -1: (Ljava/lang/String;ZLjava/util/Set<Ljava/lang/String;>;)Lsun/misc/Resource;
+6 -1: KOI8-R
+14 -1: Character.java
+5 -1: (SS)I
+8 -1: unshared
+73 -1: (Ljava/lang/String;[BIILjava/security/ProtectionDomain;)Ljava/lang/Class;
+19 -1: replacementTreeNode
+10 -1: BA_REGULAR
+8 -1: UTF-16LE
+44 -1: (Ljava/lang/Class<*>;[Ljava/lang/Class<*>;)V
+22 -1: InputStreamReader.java
+17 -1: getInvocationType
+23 -1: getDeclaredConstructors
+48 -1: [Lsun/reflect/generics/tree/FormalTypeParameter;
+67 -1: (Ljava/util/Comparator;Ljava/util/Map$Entry;Ljava/util/Map$Entry;)I
+6 -1: koi8_r
+14 -1: ofTotalSeconds
+16 -1: content-encoding
+6 -1: koi8_u
+10 -1: getEncoded
+6 -1: ()[TT;
+43 -1: ([ILjava/util/function/IntUnaryOperator;I)V
+18 -1: getSecurityContext
+13 -1: LF_GEN_LINKER
+78 -1: (BLjava/lang/invoke/MemberName;Ljava/lang/Class;)Ljava/lang/invoke/MemberName;
+49 -1: (Ljava/util/HashMap;[Ljava/util/HashMap$Node;II)V
+19 -1: LinkedEntryIterator
+23 -1: Warning: JIT compiler "
+7 -1: static
+100 -1: (Ljava/lang/Class;ZLjava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Class;)Ljava/util/List;
+79 -1: <T:Ljava/lang/Object;>(Ljava/util/Collection<+TT;>;)Ljava/util/Collection<TT;>;
+10 -1: iso-ir-100
+10 -1: iso-ir-101
+13 -1: toUpperString
+31 -1: ()Ljava/util/Spliterator$OfInt;
+43 -1: Ljava/lang/StringIndexOutOfBoundsException;
+19 -1: Lsun/misc/JarIndex;
+7 -1: Version
+90 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;Ljava/security/ProtectionDomain;)Ljava/lang/Class;
+10 -1: getHandler
+45 -1: (ILjava/lang/Object;)Ljava/lang/StringBuffer;
+28 -1: getDeclaredAnnotationsByType
+46 -1: ([Ljava/lang/Class;Ljava/lang/StringBuilder;)V
+53 -1: ()Ljava/util/Enumeration<Ljava/security/Permission;>;
+15 -1: addAllNonStatic
+10 -1: iso-ir-110
+14 -1: Using VM:
+17 -1: casReflectionData
+26 -1: (Lsun/util/PreHashedMap;)I
+24 -1: removeByNameAndSignature
+4 -1: OS X
+85 -1: (Ljava/lang/ClassLoader;Ljava/lang/String;Ljava/lang/ClassLoader;Ljava/lang/String;)Z
+16 -1: JarEntryIterator
+38 -1: Ljava/lang/Class<Ljava/lang/Integer;>;
+37 -1: Ljava/lang/Class<Ljava/lang/Double;>;
+28 -1: ([Ljava/util/HashMap$Node;)V
+34 -1: java/lang/reflect/GenericArrayType
+14 -1: annotationData
+26 -1: (Lsun/util/PreHashedMap;)V
+22 -1: checkPackageDefinition
+30 -1: ACCUMULATED_DAYS_IN_MONTH_LEAP
+12 -1: lowestOneBit
+64 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;Ljava/lang/ThreadLocal;)V
+16 -1: asReadOnlyBuffer
+11 -1: getRealName
+17 -1: StringCoding.java
+10 -1: iso-ir-126
+11 -1: isSurrogate
+8 -1: setError
+138 -1: <T:Ljava/lang/Object;U:Ljava/lang/Object;>(Ljava/util/function/Function<-TT;+TU;>;Ljava/util/Comparator<-TU;>;)Ljava/util/Comparator<TT;>;
+8 -1: (TK;)TK;
+4 -1: java
+136 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedAction<TT;>;Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;)TT;
+36 -1: ()Lsun/util/locale/LocaleExtensions;
+12 -1: doubleStream
+28 -1: ()Ljava/util/SimpleTimeZone;
+7 -1: :@&=+$,
+94 -1: Ljava/lang/ThreadLocal<Ljava/lang/ref/SoftReference<Ljava/lang/StringCoding$StringDecoder;>;>;
+64 -1: (Ljava/lang/String;[Ljava/lang/Class;)Ljava/lang/reflect/Method;
+19 -1: getSystemTimeZoneID
+18 -1: ReentrantLock.java
+8 -1: emptyMap
+16 -1: getSavedProperty
+249 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceEntriesToDoubleTask;Ljava/util/function/ToDoubleFunction;DLjava/util/function/DoubleBinaryOperator;)V
+14 -1: KeySpliterator
+13 -1: findResources
+14 -1: forWrapperType
+8 -1: floorMod
+12 -1: isoCountries
+10 -1: CheckedSet
+21 -1: AbstractCalendar.java
+12 -1: IS_INVOCABLE
+45 -1: (Ljava/lang/Class;)Lsun/reflect/ConstantPool;
+19 -1: checkSecurityAccess
+13 -1: Invalid index
+28 -1: STACK_TRACE_ELEMENT_SENTINEL
+88 -1: (ILjava/lang/Object;Ljava/lang/Object;)Ljava/util/concurrent/ConcurrentHashMap$TreeNode;
+130 -1: (Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)V
+14 -1: aliases_IBM437
+10 -1: iso-ir-144
+10 -1: iso-ir-148
+35 -1: ()Ljava/nio/charset/CharsetDecoder;
+95 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle;
+16 -1: UnmodifiableList
+40 -1: ()Ljava/util/concurrent/locks/Condition;
+9 -1: Path.java
+80 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/Class;[Ljava/lang/Class;)Ljava/util/Map;
+36 -1: Ljava/lang/Class<Ljava/lang/Float;>;
+124 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;)Ljava/lang/Object;
+20 -1: privateGetParameters
+24 -1: sun/nio/cs/StreamDecoder
+12 -1: getFreeSpace
+8 -1: US-ASCII
+22 -1: negativeZeroDoubleBits
+9 -1: putObject
+13 -1: linkToVirtual
+35 -1: Ljava/lang/Class<Ljava/lang/Long;>;
+15 -1: detectedCharset
+26 -1: java/lang/reflect/Modifier
+22 -1: JAVAFX_LAUNCH_MODE_JAR
+32 -1: java/net/URLStreamHandlerFactory
+7 -1: IBM-923
+80 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;)Ljava/lang/String;
+13 -1: TRANSFERINDEX
+34 -1: (Lsun/nio/cs/StandardCharsets$1;)V
+23 -1: ()Ljava/io/InputStream;
+16 -1: ()Ljava/io/File;
+41 -1: (Ljava/lang/String;)Ljava/nio/ByteBuffer;
+22 -1: sun/reflect/Reflection
+23 -1: java/lang/AutoCloseable
+25 -1: BootstrapMethodError.java
+19 -1: EnclosingMethodInfo
+13 -1: transferIndex
+18 -1: java/lang/Compiler
+4 -1: zero
+29 -1: java/util/Arrays$NaturalOrder
+9 -1: language=
+37 -1: Ljava/util/ArrayList<Ljava/net/URL;>;
+73 -1: ()Ljava/util/concurrent/locks/AbstractQueuedSynchronizer$ConditionObject;
+16 -1: balanceInsertion
+82 -1: (Ljava/lang/StringBuffer;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;I)V
+11 -1: asIntBuffer
+27 -1: (Ljava/util/LinkedList;II)V
+13 -1: ofEpochSecond
+19 -1: sunjce_provider.jar
+21 -1: (F)Ljava/lang/String;
+32 -1: >> does not contain binding <<
+21 -1: declaredPublicMethods
+5 -1: FIELD
+17 -1: getPrimitiveClass
+127 -1: (Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater$AtomicReferenceFieldUpdaterImpl;Ljava/lang/Class;Ljava/lang/String;)V
+21 -1: replaceParameterTypes
+73 -1: Ljava/util/Map<Ljava/lang/Class<*>;Ljava/security/PermissionCollection;>;
+21 -1: (Ljava/lang/Double;)I
+5 -1: floor
+4 -1: halt
+14 -1: newConstructor
+48 -1: (Ljava/util/function/BiFunction<-TK;-TV;+TV;>;)V
+17 -1: packageAccessLock
+15 -1: America/Phoenix
+19 -1: Incoming arguments:
+11 -1: V_Monotonic
+14 -1: decrementExact
+15 -1: updatePositions
+14 -1: toLocaleString
+12 -1: appendEscape
+7 -1: DISPLAY
+27 -1: sun/nio/cs/US_ASCII$Decoder
+13 -1: LITTLE_ENDIAN
+6 -1: isNull
+13 -1: TempDirectory
+6 -1: LM_JAR
+39 -1: JVMTI_THREAD_STATE_WAITING_WITH_TIMEOUT
+10 -1: isCompiled
+36 -1: (Ljava/lang/AbstractStringBuilder;)Z
+3 -1: run
+17 -1: START_PUNCTUATION
+33 -1: Ljava/util/Stack<Ljava/net/URL;>;
+49 -1: (Ljava/lang/String;)Ljava/lang/invoke/LambdaForm;
+28 -1: java/security/DomainCombiner
+53 -1: (Ljava/lang/String;Ljava/util/Map;)Ljava/time/ZoneId;
+81 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/Class;)[Ljava/lang/reflect/AnnotatedType;
+43 -1: java/lang/management/GarbageCollectorMXBean
+11 -1: toTitleCase
+12 -1: getHoldCount
+4 -1: ()[B
+4 -1: ()[C
+4 -1: ()[J
+20 -1: (Ljava/io/File;IZZ)Z
+18 -1: fileTimeToUnixTime
+23 -1: java/nio/HeapCharBuffer
+30 -1: Ljava/lang/ref/ReferenceQueue;
+6 -1: rt.jar
+69 -1: (Ljava/util/function/ToIntFunction<-TT;>;)Ljava/util/Comparator<TT;>;
+21 -1: java/lang/ThreadLocal
+25 -1: Ljava/lang/reflect/Field;
+44 -1: (Ljava/lang/String;Ljava/lang/Throwable;ZZ)V
+93 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/MethodHandle;
+22 -1: getDayOfWeekDateBefore
+37 -1: [Lsun/reflect/generics/tree/TypeTree;
+83 -1: <E:Ljava/lang/Object;>(Ljava/util/Map<TE;Ljava/lang/Boolean;>;)Ljava/util/Set<TE;>;
+10 -1: readFields
+42 -1: (Ljava/net/URL;)Ljava/security/CodeSource;
+44 -1: (Ljava/lang/String;IIJ)Ljava/nio/ByteBuffer;
+27 -1: Ljava/util/Collection<TE;>;
+13 -1: checkResource
+7 -1: rename0
+51 -1: (C)Ljava/lang/invoke/BoundMethodHandle$SpeciesData;
+47 -1: sun/reflect/generics/repository/FieldRepository
+11 -1: readBoolean
+134 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$TreeNode;)V
+13 -1: getZoneOffset
+17 -1: getJdkVersionInfo
+21 -1: sun/misc/MessageUtils
+23 -1: defaultAllowArraySyntax
+31 -1: java/util/concurrent/locks/Lock
+24 -1: java/lang/reflect/Method
+7 -1: toUpper
+17 -1: sun/misc/Signal$1
+51 -1: (JLjava/util/function/BiFunction<-TK;-TK;+TK;>;)TK;
+28 -1: (Ljava/lang/ref/Reference;)Z
+8 -1: nthreads
+26 -1: MapReduceEntriesToLongTask
+27 -1: (Ljava/util/NavigableSet;)V
+10 -1: savedProps
+25 -1: Lsun/security/util/Debug;
+12 -1: CR_MALFORMED
+13 -1: com.sun.proxy
+17 -1: CharSequence.java
+24 -1: (ILjava/lang/String;II)Z
+13 -1: findNextValue
+108 -1: <K::Ljava/lang/Comparable<-TK;>;V:Ljava/lang/Object;>()Ljava/util/Comparator<Ljava/util/Map$Entry<TK;TV;>;>;
+5 -1: (FF)F
+9 -1: typeClass
+5 -1: (FF)I
+11 -1: segmentMask
+7 -1: (JJJJ)V
+14 -1: aliases_CESU_8
+85 -1: (Ljava/lang/Class;Ljava/lang/invoke/MemberName;)Ljava/lang/invoke/DirectMethodHandle;
+15 -1: getCalendarDate
+21 -1: getDeclaredAnnotation
+8 -1: ([BIIB)I
+15 -1: stripExtensions
+14 -1: getISO3Country
+5 -1: short
+47 -1: String value %s exceeds range of unsigned long.
+34 -1: ()Ljava/security/ProtectionDomain;
+8 -1: ([BIIB)V
+23 -1: (Ljava/lang/Object;ID)V
+47 -1: (Ljava/lang/String;Ljava/nio/charset/Charset;)V
+29 -1: RuntimeVisibleTypeAnnotations
+24 -1: (Ljava/io/InputStream;)V
+39 -1: (Ljava/lang/Class;Ljava/lang/String;Z)V
+16 -1: convertPrimitive
+8 -1: (TK;)TV;
+24 -1: (Ljava/io/InputStream;)Z
+6 -1: start
+243 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceEntriesToLongTask;Ljava/util/function/ToLongFunction;JLjava/util/function/LongBinaryOperator;)V
+9 -1: asSpecial
+20 -1: java/text/Normalizer
+17 -1: DAYS_0000_TO_1970
+9 -1: toCharset
+20 -1: REPLACEALL_THRESHOLD
+20 -1: sun/net/util/URLUtil
+16 -1: findLoadedClass0
+14 -1: localedata.jar
+6 -1: Parser
+6 -1: start0
+4 -1: hash
+83 -1: (Ljava/lang/Class;Ljava/lang/Class;[Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
+29 -1: Ljava/lang/invoke/MemberName;
+8 -1: BOOT_TAG
+22 -1: MH_LINKER_ARG_APPENDED
+14 -1: comparingByKey
+47 -1: ([Ljava/lang/String;)Ljava/lang/ProcessBuilder;
+6 -1: start=
+18 -1: StringBuilder.java
+7 -1: getLong
+12 -1: copyElements
+16 -1: highResFrequency
+11 -1: toGMTString
+10 -1: ISO_8859_1
+10 -1: ISO_8859_2
+6 -1: result
+10 -1: ISO_8859_4
+10 -1: ISO_8859_5
+10 -1: ISO_8859_7
+15 -1: unmodifiableSet
+10 -1: ISO_8859_9
+25 -1: NoClassDefFoundError.java
+42 -1: (Ljava/lang/String;)Ljava/util/LinkedList;
+14 -1: parallelPrefix
+22 -1: ARRAY_LONG_INDEX_SCALE
+6 -1: resume
+36 -1: Ljava/lang/invoke/LambdaForm$Hidden;
+50 -1: java/util/Collections$UnmodifiableRandomAccessList
+130 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/Consumer;)V
+6 -1: getInt
+13 -1: getCachedYear
+21 -1: CONNECTOR_PUNCTUATION
+73 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/Object;ILjava/lang/Class;)V
+24 -1: [Lsun/util/calendar/Era;
+22 -1: (Ljava/lang/Object;D)V
+74 -1: (Ljava/security/AccessControlContext;)Ljava/security/AccessControlContext;
+109 -1: <T:Ljava/lang/Object;>(Ljava/lang/Class<*>;Ljava/lang/Class$AnnotationData;Ljava/lang/Class$AnnotationData;)Z
+6 -1: ([CZ)V
+74 -1: (Ljava/util/HashMap$Node;Ljava/util/HashMap$Node;)Ljava/util/HashMap$Node;
+19 -1: TRADITIONAL_CHINESE
+125 -1: (Ljava/lang/Throwable$PrintStreamOrWriter;[Ljava/lang/StackTraceElement;Ljava/lang/String;Ljava/lang/String;Ljava/util/Set;)V
+18 -1: unknown protocol:
+57 -1: (Ljava/lang/reflect/Method;Lsun/reflect/MethodAccessor;)V
+13 -1: writeComments
+9 -1: Negotiate
+14 -1: Closeable.java
+10 -1: asSpreader
+122 -1: (Ljava/nio/file/WatchService;[Ljava/nio/file/WatchEvent$Kind;[Ljava/nio/file/WatchEvent$Modifier;)Ljava/nio/file/WatchKey;
+17 -1: jvm_minor_version
+9 -1: getDouble
+25 -1: Ljava/io/File$PathStatus;
+19 -1: averageCharsPerByte
+22 -1: getConstructorAccessor
+61 -1: (Ljava/lang/String;)Ljava/lang/management/MemoryManagerMBean;
+45 -1: (Ljava/lang/String;)Ljava/util/regex/Pattern;
+25 -1: (JC)Ljava/nio/ByteBuffer;
+20 -1: exclusiveOwnerThread
+85 -1: <T:Ljava/lang/Object;>(Ljava/lang/ClassValue<TT;>;Ljava/lang/ClassValue$Entry<TT;>;)V
+17 -1: getExtensionValue
+14 -1: getLoadAverage
+17 -1: GET_PD_PERMISSION
+6 -1: METHOD
+23 -1: sun/nio/cs/ISO_8859_1$1
+23 -1: (I[Ljava/lang/Object;)I
+4 1: zzz1
+13 -1: createWrapper
+4 1: zzz2
+4 1: zzz3
+33 -1: greater than Character.MAX_RADIX
+37 -1: DIRECTIONALITY_RIGHT_TO_LEFT_OVERRIDE
+6 -1: BRIDGE
+20 -1: canonicalizeLanguage
+13 -1: setPermission
+46 -1: (Ljava/io/OutputStream;)Ljava/io/OutputStream;
+3 -1: 646
+14 -1: java/lang/Long
+55 -1: java/util/concurrent/ConcurrentHashMap$SearchValuesTask
+38 -1: (IC)Ljava/lang/invoke/LambdaForm$Name;
+37 -1: (Ljava/lang/Class;)Ljava/lang/String;
+17 -1: javaUtilJarAccess
+23 -1: registerMethodsToFilter
+34 -1: (Ljava/nio/charset/Charset;[CII)[B
+11 -1: % VERSION 2
+37 -1: ([DI)Ljava/util/Spliterator$OfDouble;
+16 -1: Stack Size:
+52 -1: (Ljava/lang/Class;)Ljava/lang/annotation/Annotation;
+17 -1: putDoubleVolatile
+10 -1: access$500
+10 -1: access$502
+28 -1: malformed input around byte
+13 -1: LF_INVSPECIAL
+32 -1: Non-positive averageCharsPerByte
+14 -1: NF_fieldOffset
+10 -1: access$508
+48 -1: <T:Ljava/lang/Object;>(TT;)Ljava/util/List<TT;>;
+17 -1: defaultReadObject
+17 -1: java/util/TimSort
+13 -1: resolveClass0
+92 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;[Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
+20 -1: setLangReflectAccess
+30 -1: java/lang/reflect/TypeVariable
+56 -1: <T:Ljava/lang/Object;>([TT;)Ljava/util/Spliterator<TT;>;
+8 -1: VOLATILE
+10 -1: Big5-HKSCS
+23 -1: (Ljava/util/Locale$1;)V
+15 -1: ISO_8859-1:1987
+14 -1: no such method
+10 -1: null value
+8 -1: checkURL
+22 -1: ARRAY_BYTE_INDEX_SCALE
+27 -1: (Ljava/lang/ClassLoader;Z)V
+22 -1: java/lang/reflect/Type
+25 -1: java/net/JarURLConnection
+36 -1: java/util/WeakHashMap$KeySpliterator
+26 -1: ()Lsun/misc/JavaAWTAccess;
+50 -1: (I[Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
+9 -1: toDegrees
+12 -1: lowSurrogate
+19 -1: getEnclosingMethod0
+7 -1: bytearr
+35 -1: (Ljava/util/List;Ljava/util/List;)I
+25 -1: [Ljava/lang/reflect/Type;
+34 -1: javaSecurityProtectionDomainAccess
+21 -1: java.launcher.X.usage
+37 -1: sun/util/locale/InternalLocaleBuilder
+33 -1: ()Ljava/lang/invoke/MethodHandle;
+3 -1: scl
+19 -1: synthesizeAllParams
+68 -1: Ljava/util/Map<Ljava/lang/String;[Ljava/security/cert/Certificate;>;
+6 -1: vclass
+35 -1: (Ljava/util/List;Ljava/util/List;)V
+59 -1: Ljava/lang/Number;Ljava/lang/Comparable<Ljava/lang/Float;>;
+13 -1: CallSite.java
+10 1: Bar loaded
+21 -1: ARRAY_INT_BASE_OFFSET
+49 -1: Ljava/util/concurrent/ConcurrentHashMap$TreeNode;
+32 -1: [Ljava/lang/reflect/Constructor;
+4 -1: type
+34 -1: <T:Ljava/lang/Object;>([TT;II)[TT;
+25 -1: BufferedOutputStream.java
+23 -1: java/util/zip/ZipFile$1
+24 -1: ()Ljava/lang/ClassValue;
+50 -1: (Ljava/util/concurrent/CountedCompleter;[F[FIIII)V
+16 -1: getQueuedThreads
+26 -1: getJavaNetHttpCookieAccess
+8 -1: setExtra
+8 -1: implRead
+20 -1: linkMethod => throw
+76 -1: (Ljava/util/function/ToDoubleFunction;Ljava/lang/Object;Ljava/lang/Object;)I
+11 -1: KeyIterator
+39 -1: Ljava/util/List<Ljava/lang/Throwable;>;
+3 -1: " "
+36 -1: Ljava/lang/IllegalArgumentException;
+11 -1: checkBounds
+30 -1: sun/nio/cs/FastCharsetProvider
+11 -1: toLongArray
+107 -1: (Ljava/lang/Class<*>;Ljava/lang/String;Ljava/lang/Class<*>;IILjava/lang/String;[B)Ljava/lang/reflect/Field;
+8 -1: (build
+39 -1: (Ljava/nio/Buffer;ILjava/nio/Buffer;I)V
+31 -1: [Ljava/lang/reflect/Executable;
+3 -1: set
+21 -1: PhantomReference.java
+41 -1: java/util/Collections$CheckedNavigableMap
+53 -1: Can not make a java.lang.Class constructor accessible
+12 -1: ([CII[CIII)I
+55 -1: Ljava/util/HashMap<Ljava/lang/String;Ljava/lang/Void;>;
+12 -1: MICROSECONDS
+11 -1: writeBuffer
+52 -1: and domain that didn't have permission
+37 -1: java/nio/channels/WritableByteChannel
+26 -1: getRawClassTypeAnnotations
+15 -1: putCharVolatile
+33 -1: java/security/InvalidKeyException
+19 -1: Ljava/io/Closeable;
+83 -1: Lsun/util/locale/LocaleObjectCache<Ljava/util/Locale$LocaleKey;Ljava/util/Locale;>;
+10 -1: SetFromMap
+24 -1: JavaFX-Application-Class
+13 -1: asShortBuffer
+10 -1: getReifier
+15 -1: isPositionIndex
+18 -1: SignalHandler.java
+3 -1: JST
+28 -1: (Ljava/io/FileDescriptor;I)I
+28 -1: getStackAccessControlContext
+16 -1: updateByteBuffer
+27 -1: ()Ljava/net/ContentHandler;
+25 -1: (JD)Ljava/nio/ByteBuffer;
+39 -1: ()Lsun/misc/JavaIOFileDescriptorAccess;
+107 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;Ljava/lang/ThreadLocal;)Ljava/lang/ThreadLocal$ThreadLocalMap$Entry;
+42 -1: sun/misc/PerfCounter$WindowsClientCounters
+8 -1: addExact
+28 -1: (Ljava/io/FileDescriptor;I)V
+36 -1: ([Ljava/lang/String;)Ljava/util/Map;
+21 -1: ()Ljava/lang/Process;
+4 -1: UTF8
+5 -1: mkdir
+10 -1: transient
+3 -1: sgp
+15 -1: balanceDeletion
+161 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/net/URL;)Ljava/lang/Package;
+15 -1: SynchronizedMap
+40 -1: sun.misc.URLClassPath.disableJarChecking
+92 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractSet<TE;>;Ljava/util/Set<TE;>;Ljava/io/Serializable;
+17 -1: removeEldestEntry
+35 -1: (I)Ljava/lang/Class$AnnotationData;
+24 -1: Ljava/util/Locale$Cache;
+13 -1: STANDARD_TIME
+17 -1: sun/nio/cs/MS1252
+99 -1: <K:Ljava/lang/Object;>()Ljava/util/concurrent/ConcurrentHashMap$KeySetView<TK;Ljava/lang/Boolean;>;
+23 -1: java/util/LinkedHashSet
+9 -1: iso8859_1
+9 -1: iso8859_2
+9 -1: iso8859_4
+66 -1: <A::Ljava/lang/annotation/Annotation;>(Ljava/lang/Class<TA;>;)[TA;
+9 -1: iso8859_5
+9 -1: iso8859_7
+9 -1: iso8859_9
+21 -1: Ljava/util/Formatter;
+6 -1: isPath
+21 -1: makeReferenceIdentity
+24 -1: sun/net/ApplicationProxy
+23 -1: ClassCastException.java
+11 -1: MethodArray
+12 -1: SingletonMap
+41 -1: java/util/ArrayPrefixHelpers$CumulateTask
+7 -1: seconds
+20 -1: ClassRepository.java
+14 -1: allocateMemory
+24 -1: java.launcher.jar.error1
+24 -1: java.launcher.jar.error2
+24 -1: java.launcher.jar.error3
+45 -1: (Ljava/lang/String;Ljava/util/jar/Manifest;)Z
+3 -1: sin
+7 -1: (J[II)I
+3 -1: Itr
+18 -1: findBootstrapClass
+10 -1: getElement
+15 -1: ISO_8859-4:1988
+34 -1: newGetLongIllegalArgumentException
+7 -1: pending
+17 -1: isNotContinuation
+6 -1: EXTSIG
+13 -1: searchMethods
+32 -1: Lsun/misc/JavaUtilZipFileAccess;
+33 -1: ([Ljava/lang/reflect/Parameter;)V
+31 -1: defaultUncaughtExceptionHandler
+89 -1: (Ljava/nio/file/WatchService;[Ljava/nio/file/WatchEvent$Kind<*>;)Ljava/nio/file/WatchKey;
+5 -1: ASCII
+28 -1: ()Lsun/reflect/ConstantPool;
+20 -1: isJavaIdentifierPart
+6 -1: EXTSIZ
+34 -1: Lsun/misc/JavaNetHttpCookieAccess;
+34 -1: ClassLoader object not initialized
+7 -1: CHECKED
+16 -1: encodeBufferLoop
+37 -1: (Ljava/time/Instant;)Ljava/util/Date;
+24 -1: (Ljava/util/Map$Entry;)Z
+50 -1: java/util/concurrent/ConcurrentHashMap$KeyIterator
+31 -1: ()[Ljava/lang/ClassValue$Entry;
+31 -1: java/lang/IllegalStateException
+43 -1: (Ljava/lang/Appendable;Ljava/util/Locale;)V
+6 -1: CENVEM
+53 -1: Ljava/util/ArrayList<Lsun/misc/URLClassPath$Loader;>;
+17 -1: getHeaderFieldKey
+71 -1: (Ljava/lang/CharSequence;Ljava/text/Normalizer$Form;)Ljava/lang/String;
+6 -1: CENVER
+17 -1: cleanStaleEntries
+9 -1: linkFirst
+57 -1: (Ljava/util/Comparator<-TT;>;)Ljava/util/Comparator<TT;>;
+8 -1: val$file
+27 -1: Invalid parameter modifiers
+6 -1: append
+57 -1: ()Lsun/reflect/generics/repository/ConstructorRepository;
+65 -1: java/util/concurrent/ConcurrentHashMap$MapReduceMappingsToIntTask
+39 -1: (Ljava/lang/String;)Ljava/lang/Integer;
+25 -1: lambda$parallelSetAll$191
+25 -1: lambda$parallelSetAll$192
+25 -1: lambda$parallelSetAll$193
+23 -1: INSERTIONSORT_THRESHOLD
+17 -1: java/time/Instant
+25 -1: lambda$parallelSetAll$194
+14 -1: dynamicInvoker
+9 -1: iso646-us
+8 -1: position
+29 -1: java/nio/channels/FileChannel
+27 -1: java/util/stream/Collectors
+64 -1: (Ljava/lang/CharSequence;Ljava/lang/Iterable;)Ljava/lang/String;
+10 -1: INDEX_NAME
+15 -1: getCommentBytes
+67 -1: (Ljava/io/FileOutputStream;Ljava/lang/String;)Ljava/io/PrintStream;
+22 -1: privateGetPublicFields
+32 -1: java/util/BitSet$1BitSetIterator
+12 -1: PERF_MODE_RO
+89 -1: ([Ljava/lang/ClassValue$Entry;ILjava/lang/ClassValue$Entry;Z)Ljava/lang/ClassValue$Entry;
+30 -1: java/security/PrivilegedAction
+18 -1: host can't be null
+26 -1: package name can't be null
+12 -1: PERF_MODE_RW
+10 -1: isEnqueued
+18 -1: argSlotToParameter
+37 -1: (II)Ljava/lang/AbstractStringBuilder;
+5 -1: tabAt
+53 -1: (Ljava/lang/Object;)Ljava/lang/AbstractStringBuilder;
+11 -1: PATH_OFFSET
+18 -1: unicodebigunmarked
+15 -1: ConditionObject
+6 -1: KOREAN
+13 -1: isNamePresent
+24 -1: ()Ljava/lang/Class<TE;>;
+14 -1: isStandardTime
+8 -1: ([IIII)I
+9 -1: WeakEntry
+12 -1: javaIOAccess
+17 -1: key can't be null
+129 -1: Ljava/lang/Object;Ljava/lang/Comparable<Ljava/nio/file/Path;>;Ljava/lang/Iterable<Ljava/nio/file/Path;>;Ljava/nio/file/Watchable;
+8 -1: handler
+8 -1: ([IIII)V
+10 -1: atBugLevel
+18 -1: makeGuardWithCatch
+18 -1: currentLoadedClass
+11 -1: getCodeBase
+67 -1: <T:Ljava/lang/Object;>(Ljava/util/List<+TT;>;)Ljava/util/List<TT;>;
+12 -1: JarFile.java
+19 -1: (C)Ljava/io/Writer;
+22 -1: createURLStreamHandler
+23 -1: sun/nio/cs/ArrayDecoder
+13 -1: setAccessible
+18 -1: stripOffParameters
+101 -1: ([Ljava/security/ProtectionDomain;[Ljava/security/ProtectionDomain;)[Ljava/security/ProtectionDomain;
+18 -1: Ljava/util/Random;
+16 -1: Pacific/Honolulu
+13 -1: useOldMapping
+65 -1: (Ljava/lang/invoke/LambdaForm$NamedFunction;[Ljava/lang/Object;)V
+14 -1: filterArgument
+12 -1: LF_MH_LINKER
+25 -1: isDirectMemoryPageAligned
+49 -1: (Ljava/util/BitSet;)Ljava/util/function/Supplier;
+54 -1: (Ljava/util/concurrent/ConcurrentHashMap<TK;TV;>;TV;)V
+16 -1: java/time/ZoneId
+4 -1: zfot
+18 -1: isSameClassPackage
+6 -1: julian
+8 -1: (TT;)TT;
+22 -1: java/util/jar/Manifest
+7 -1: charOut
+16 -1: getOffsetsByWall
+19 -1: Illegal replacement
+139 -1: <E:Ljava/lang/Object;>Ljava/util/AbstractList<TE;>;Ljava/util/List<TE;>;Ljava/util/RandomAccess;Ljava/lang/Cloneable;Ljava/io/Serializable;
+96 -1: <T:Ljava/lang/Object;>(Ljava/lang/reflect/Constructor<TT;>;)Ljava/lang/reflect/Constructor<TT;>;
+15 -1: Annotation.java
+24 -1: (Ljava/lang/Class<*>;)[B
+6 -1: CODING
+34 -1: ([Ljava/lang/ClassValue$Entry;II)V
+6 -1: IGNORE
+62 -1: (Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodHandle;
+29 -1: specificToGenericStringHeader
+12 -1: helpTransfer
+8 -1: fastTime
+62 -1: (Ljava/net/URLConnection;[Ljava/lang/Class;)Ljava/lang/Object;
+18 -1: Unhandled signal:
+8 -1: isStrict
+15 -1: ISO_8859-7:1987
+13 -1: getWeekLength
+14 -1: jvmBuildNumber
+40 -1: (Ljava/lang/String;)Ljava/util/Iterator;
+6 -1: short0
+6 -1: short1
+73 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedExceptionAction<TT;>;)TT;
+10 -1: removeNode
+8 -1: setFloat
+18 -1: cspc862latinhebrew
+11 -1: setTimeZone
+34 -1: java/lang/reflect/AccessibleObject
+25 -1: MapReduceKeysToDoubleTask
+25 -1: java/lang/ref/Reference$1
+24 -1: java/nio/HeapByteBufferR
+15 -1: jdkMicroVersion
+117 -1: (Ljava/lang/Class;Ljava/lang/String;[Ljava/lang/Class;Ljava/lang/Class;[Ljava/lang/Class;IILjava/lang/String;[B[B[B)V
+8 -1: (TT;)TV;
+16 -1: Permissions.java
+22 -1: Ljava/util/Comparator;
+17 -1: getDaylightSaving
+25 -1: ([BIILjava/lang/String;)V
+9 -1: stillborn
+11 -1: maxPosition
+28 -1: java/util/ArrayPrefixHelpers
+73 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>()Ljava/util/SortedMap<TK;TV;>;
+14 -1: useCanonCaches
+5 -1: clean
+16 -1: checkPermission2
+34 -1: sun.misc.launcher.useSharedArchive
+13 -1: shutdownHooks
+5 -1: clear
+240 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$MapReduceKeysToLongTask;Ljava/util/function/ToLongFunction;JLjava/util/function/LongBinaryOperator;)V
+67 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<-TV;+TU;>;)TU;
+6 -1: cp1250
+6 -1: cp1251
+6 -1: cp1252
+13 -1: getZipMessage
+6 -1: cp1253
+28 -1: (J)Ljava/lang/ref/Reference;
+6 -1: cp1254
+54 -1: (ILjava/lang/String;)Ljava/lang/AbstractStringBuilder;
+6 -1: cp1257
+10 -1: deepEquals
+17 -1: WRITE_BUFFER_SIZE
+13 -1: copyFromArray
+40 -1: java/util/Collections$ReverseComparator2
+36 -1: sun/reflect/generics/visitor/Reifier
+19 -1: averageBytesPerChar
+13 -1: javaAWTAccess
+6 -1: cp5346
+61 -1: Ljava/util/Map<Ljava/lang/String;Ljava/nio/charset/Charset;>;
+6 -1: cp5347
+6 -1: cp5348
+6 -1: cp5349
+5 -1: field
+23 -1: ()Ljava/nio/LongBuffer;
+103 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/WrongMethodTypeException;
+37 -1: (I)Ljava/lang/Character$UnicodeBlock;
+11 -1: offsetAfter
+79 -1: Ljava/util/HashMap<Ljava/security/CodeSource;Ljava/security/ProtectionDomain;>;
+27 -1: invocationHandlerReturnType
+17 -1: POSITIVE_INFINITY
+11 -1: maybeRebind
+3 -1: str
+18 -1: setSecurityManager
+9 -1: signature
+18 -1: corrupted jar file
+89 -1: <E:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Collection<TE;>;Ljava/io/Serializable;
+87 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
+6 -1: CENATT
+6 -1: cp5350
+12 -1: AF_GETSTATIC
+38 -1: (TE;Ljava/util/LinkedList$Node<TE;>;)V
+8 -1: isLoaded
+6 -1: CENATX
+6 -1: cp5353
+18 -1: Africa/Addis_Ababa
+35 -1: sun/usagetracker/UsageTrackerClient
+11 -1: toUpperCase
+22 -1: java/util/zip/Inflater
+10 -1: iso_8859-1
+10 -1: iso_8859-2
+3 -1: sum
+7 -1: x-Johab
+10 -1: iso_8859-4
+10 -1: iso_8859-5
+85 -1: (Ljava/security/DomainCombiner;Ljava/lang/Class;)Ljava/security/AccessControlContext;
+11 -1: activeCount
+49 -1: (Ljava/lang/ClassLoader;Ljava/lang/ClassLoader;)Z
+51 -1: (Ljava/util/List;Ljava/lang/Class;)Ljava/util/List;
+10 -1: iso_8859-7
+19 -1: appendVmErgoMessage
+10 -1: iso_8859-9
+14 -1: getClassLoader
+6 -1: (CJJ)Z
+15 -1: Lsun/misc/Perf;
+7 -1: getTree
+27 -1: Ljava/text/Normalizer$Form;
+11 -1: ISO-2022-JP
+69 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Object;)Ljava/lang/Object;
+50 -1: java/lang/invoke/DirectMethodHandle$StaticAccessor
+15 -1: fxLauncherClass
+35 -1: (Ljava/net/URL;Ljava/lang/String;)V
+16 -1: getAndAccumulate
+35 -1: (Ljava/net/URL;Ljava/lang/String;)Z
+32 -1: Non-positive averageBytesPerChar
+35 -1: Ljava/lang/Class<Ljava/lang/Void;>;
+15 -1: CLASS_MODIFIERS
+12 -1: checkedQueue
+13 -1: enumConstants
+10 -1: getFactory
+95 -1: Ljava/util/concurrent/ConcurrentMap<TK;Lsun/util/locale/LocaleObjectCache$CacheEntry<TK;TV;>;>;
+13 -1: Africa/Harare
+57 -1: (JLjava/util/TimeZone;)Lsun/util/calendar/Gregorian$Date;
+11 -1: ISO-2022-KR
+19 -1: $assertionsDisabled
+13 -1: PROXY_PACKAGE
+17 -1: copyFromLongArray
+81 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/LinkedHashMap$Entry<TK;TV;>;
+11 -1: checkDelete
+38 -1: sun/management/ManagementFactoryHelper
+7 -1: UTC1900
+20 -1: getBootstrapResource
+23 -1: ()Ljava/lang/Throwable;
+16 -1: CALLER_SENSITIVE
+26 -1: checkSystemClipboardAccess
+32 -1: Can't set default locale to NULL
+16 -1: fxLauncherMethod
+4 -1: >=
+8 -1: provider
+9 -1: Finalizer
+78 -1: (Ljava/io/FileDescriptor;ZZZLjava/lang/Object;)Ljava/nio/channels/FileChannel;
+13 -1: emptyIterator
+15 -1: getZipFileCount
+21 -1: isJavaIdentifierStart
+9 -1: connected
+11 -1: (ITK;TV;I)V
+16 -1: America/Honolulu
+22 -1: SynchronizedCollection
+28 -1: java/util/zip/ZipConstants64
+29 -1: inheritedAccessControlContext
+29 -1: ()[Ljava/security/CodeSigner;
+85 -1: (JLjava/lang/String;Ljava/lang/String;Ljava/lang/String;Lcom/sun/management/GcInfo;)V
+25 -1: (Ljava/nio/CharBuffer;Z)V
+15 -1: java/io/Console
+101 -1: (Ljava/lang/Class<*>;Lsun/reflect/annotation/AnnotationType;Lsun/reflect/annotation/AnnotationType;)Z
+9 -1: | resolve
+81 -1: (BLjava/lang/invoke/MemberName;Ljava/lang/Class<*>;)Ljava/lang/invoke/MemberName;
+33 -1: (Ljava/nio/charset/Charset;FF[B)V
+49 -1: (Ljava/lang/Class;Z)Ljava/lang/invoke/MethodType;
+66 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/io/File;)Ljava/io/File;
+29 -1: ([Ljava/util/HashMap$Node;I)V
+13 -1: filterMethods
+4 -1: jcal
+61 -1: (Ljava/util/List<Ljava/lang/Class<*>;>;)[Ljava/lang/Class<*>;
+6 -1: which=
+46 -1: (Ljava/math/BigInteger;)Ljava/math/BigInteger;
+4 -1: date
+18 -1: internalMemberName
+6 -1: (JJI)Z
+30 -1: [Ljava/lang/invoke/LambdaForm;
+60 -1: <T:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/lang/Object;
+15 -1: ReservationNode
+42 -1: java/lang/ThreadLocal$ThreadLocalMap$Entry
+6 -1: setIn0
+4 -1: sort
+8 -1: ibm00858
+110 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;IILjava/security/ProtectionDomain;Ljava/lang/String;)Ljava/lang/Class;
+28 -1: Ljava/lang/ClassValue$Entry;
+22 -1: ensureExplicitCapacity
+6 -1: rotate
+14 -1: closeRequested
+30 -1: ([CII)Ljava/lang/StringBuffer;
+10 -1: LM_UNKNOWN
+15 -1: Comparable.java
+13 -1: getByteBuffer
+9 -1: getScheme
+15 -1: done with meta!
+17 -1: checkForTypeAlias
+7 -1: getKeys
+7 -1: SIG_DFL
+30 -1: Ljava/nio/charset/CoderResult;
+16 -1: returnTypesMatch
+19 -1: getClassAccessFlags
+18 -1: JavaNioAccess.java
+9 -1: setDouble
+23 -1: Ljava/util/zip/ZipFile;
+83 -1: (JLjava/util/function/ToIntFunction<-TK;>;ILjava/util/function/IntBinaryOperator;)I
+11 -1: ACCESS_READ
+15 -1: nativeByteOrder
+5 -1: hours
+7 -1: toArray
+7 -1: Encoder
+12 -1: resolveClass
+29 -1: (Ljava/io/FileDescriptor;JJ)V
+14 -1: redefinedCount
+8 -1: getTotal
+11 -1: iso_8859-13
+11 -1: iso_8859-15
+9 -1: expected
+18 -1: getDeclaredMethods
+11 -1: elementData
+6 -1: intern
+10 -1: countryKey
+6 -1: setInt
+39 -1: Could not create extension class loader
+24 -1: SELF_SUPPRESSION_MESSAGE
+14 -1: argToSlotTable
+42 -1: Ljava/util/HashMap<TE;Ljava/lang/Object;>;
+5 -1: \t\n\r\x0c
+4 -1: read
+12 -1: Objects.java
+7 -1: aliases
+29 -1: sun/reflect/LangReflectAccess
+6 -1: prefix
+15 -1: superInterfaces
+10 -1: getDoInput
+30 -1: java/nio/CharBufferSpliterator
+6 -1: KOI8_R
+12 -1: Asia/Kolkata
+6 -1: KOI8_U
+6 -1: LOCSIG
+15 -1: UA-Java-Version
+92 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/HashMap<TK;TV;>;Ljava/util/Map<TK;TV;>;
+14 -1: CertificateRep
+17 -1: getSystemResource
+85 -1: (JLjava/util/function/ToLongFunction<-TV;>;JLjava/util/function/LongBinaryOperator;)J
+27 -1: java/lang/reflect/Parameter
+5 -1: quote
+8 -1: not MH:
+46 -1: java/util/Collections$UnmodifiableCollection$1
+6 -1: putVal
+6 -1: LOCSIZ
+6 -1: Atomic
+3 -1: 737
+38 -1: java/lang/UnsupportedClassVersionError
+27 -1: ()Ljava/lang/StringBuilder;
+41 -1: sun/net/www/protocol/jar/JarURLConnection
+60 -1: (Ljava/lang/String;[Ljava/lang/Object;)Ljava/util/Formatter;
+59 -1: <T:Ljava/lang/Object;>(TT;TT;Ljava/util/Comparator<-TT;>;)I
+54 -1: java/util/concurrent/locks/AbstractOwnableSynchronizer
+7 -1: getHost
+36 -1: (F)Ljava/lang/AbstractStringBuilder;
+69 -1: <U:Ljava/lang/Object;>(Ljava/lang/Class<TU;>;)Ljava/lang/Class<+TU;>;
+4 -1: Form
+103 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/SortedMap<TK;+TV;>;)Ljava/util/SortedMap<TK;TV;>;
+6 -1: spread
+8 -1: addHours
+13 -1: contentEquals
+47 -1: (Ljava/lang/String;Ljava/security/Permission;)V
+12 -1: newCondition
+23 -1: (Ljava/lang/Object;IZ)V
+26 -1: (Ljava/util/LinkedList;I)V
+13 -1: ConstantValue
+18 -1: URLConnection.java
+12 -1: Boolean.java
+75 -1: ([Ljava/net/URL;Ljava/lang/ClassLoader;Ljava/net/URLStreamHandlerFactory;)V
+21 -1: EMPTY_THROWABLE_ARRAY
+153 -1: (Ljava/util/Map<Ljava/lang/Class<*>;[Ljava/lang/String;>;Ljava/lang/Class<*>;[Ljava/lang/String;)Ljava/util/Map<Ljava/lang/Class<*>;[Ljava/lang/String;>;
+18 -1: getUnresolvedCerts
+13 -1: Negative time
+28 -1: java/util/WeakHashMap$KeySet
+8 -1: slashify
+16 -1: isOtherLowercase
+17 -1: putObjectVolatile
+5 -1: ERASE
+12 -1: filterFields
+40 -1: Ljava/lang/ReflectiveOperationException;
+12 -1: VM settings:
+57 -1: (ILjava/lang/Object;)Ljava/util/HashMap$TreeNode<TK;TV;>;
+10 -1: access$600
+11 -1: ] return =>
+13 -1: user.timezone
+23 -1: USER_AGENT_JAVA_VERSION
+27 -1: (Ljava/util/HashMap$Node;)V
+19 -1: filterNTLMResponses
+28 -1: (Lsun/misc/VMNotification;)V
+37 -1: ()[[Ljava/lang/annotation/Annotation;
+45 -1: ()Lcom/sun/management/DiagnosticCommandMBean;
+3 -1: tan
+31 -1: getDirectlyAndIndirectlyPresent
+7 -1: prepend
+35 -1: (I)Lsun/util/calendar/CalendarDate;
+8 -1: val$dirs
+4 -1: test
+28 -1: Non-positive maxCharsPerByte
+83 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Map<TK;TV;>;
+12 -1: JAVA_VERSION
+24 -1: ([Ljava/lang/Thread;IZ)I
+70 -1: (Ljava/lang/invoke/LambdaForm$Name;)Ljava/lang/invoke/LambdaForm$Name;
+57 -1: <T:Ljava/lang/Object;>([TT;Ljava/util/Comparator<-TT;>;)V
+42 -1: (Ljava/lang/Class<*>;[I)Ljava/lang/Object;
+27 -1: java/lang/SecurityManager$1
+32 -1: java/security/SignatureException
+27 -1: java/lang/SecurityManager$2
+4 -1: .jar
+20 -1: parameterAnnotations
+31 -1: DIRECTIONALITY_BOUNDARY_NEUTRAL
+21 -1: hasClassPathAttribute
+17 -1: checkParentAccess
+35 -1: java/security/PermissionsEnumerator
+6 -1: FORMAT
+92 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<Ljava/util/Map$Entry<TK;TV;>;+TU;>;)TU;
+3 -1: 775
+11 -1: PROBE_LIMIT
+111 -1: (Ljava/lang/Class;Ljava/lang/Class;Ljava/lang/String;)Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater;
+11 -1: AF_PUTFIELD
+22 -1: (Ljava/lang/Object;Z)V
+20 -1: getGenericReturnType
+9 -1: val$extcl
+13 -1: inClassLoader
+37 -1: sun.urlClassLoader.readClassBytesTime
+35 -1: (JLjava/util/function/BiConsumer;)V
+28 -1: getContentHandlerPkgPrefixes
+10 -1: getChannel
+78 -1: <T:Ljava/lang/Object;>(Ljava/util/List<+TT;>;TT;Ljava/util/Comparator<-TT;>;)I
+16 -1: parseMemberValue
+4 -1: regn
+47 -1: ([Ljava/lang/Object;III)Ljava/util/Spliterator;
+11 -1: but found
+6 -1: adjust
+11 -1: isLowerCase
+29 -1: sun/reflect/ReflectionFactory
+98 -1: <E:Ljava/lang/Object;>(Ljava/util/SortedSet<TE;>;Ljava/lang/Class<TE;>;)Ljava/util/SortedSet<TE;>;
+18 -1: [Ljava/lang/Error;
+5 -1: entry
+14 -1: refreshVersion
+8 -1: (IIIII)V
+22 -1: unmodifiableCollection
+6 -1: putAll
+22 -1: offsetByCodePointsImpl
+26 -1: (Ljava/lang/String;[BII)[C
+46 -1: (Ljava/net/URLClassLoader;Ljava/lang/String;)V
+4 -1: /LF=
+9 -1: Bits.java
+30 -1: [Ljava/util/WeakHashMap$Entry;
+19 -1: getLastModifiedTime
+44 -1: [Ljava/lang/Thread$UncaughtExceptionHandler;
+11 -1: getZoneInfo
+6 -1: lookup
+19 -1: MapReduceValuesTask
+18 -1: isVarargsCollector
+38 -1: java/util/jar/JarFile$JarEntryIterator
+11 -1: getJarIndex
+9 -1: getByName
+42 -1: (Ljava/lang/Object;JLjava/lang/Object;JJ)V
+71 -1: (Ljava/lang/invoke/LambdaForm$Name;I)Ljava/lang/invoke/LambdaForm$Name;
+30 -1: java/net/ContentHandlerFactory
+54 -1: (Ljava/lang/Class<*>;I)Ljava/lang/invoke/MethodHandle;
+12 -1: getSignature
+9 -1: parseLong
+25 -1: DEBUG_METHOD_HANDLE_NAMES
+15 -1: runFinalization
+13 -1: 0000000000000
+28 -1: ()[Ljava/lang/reflect/Field;
+37 -1: ([Ljava/lang/ClassValue$Entry<*>;II)V
+13 -1: gcInfoBuilder
+64 -1: (JLjava/util/function/BiFunction;Ljava/util/function/Consumer;)V
+5 -1: cnfe1
+8 -1: setShort
+28 -1: (C)Ljava/lang/StringBuilder;
+44 -1: (Ljava/nio/LongBuffer;)Ljava/nio/LongBuffer;
+70 -1: (Ljava/lang/String;[BIILjava/security/CodeSource;)Ljava/lang/Class<*>;
+33 -1: java/lang/TypeNotPresentException
+5 -1: \n
+20 -1: acquireInterruptibly
+21 -1: (I)Ljava/lang/String;
+24 -1: (Ljava/io/PrintWriter;)V
+16 -1: convertArguments
+32 -1: Ljava/net/MalformedURLException;
+15 -1: linkToInterface
+39 -1: java/lang/Throwable$PrintStreamOrWriter
+10 -1: iso8859_13
+13 -1: hasPrimitives
+10 -1: iso8859_15
+145 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Class<*>;)Ljava/lang/invoke/CallSite;
+8 -1: equalPDs
+28 -1: (Ljava/io/FileDescriptor;J)V
+7 -1: newLine
+43 -1: (Ljava/lang/Class<*>;I)Ljava/lang/Class<*>;
+8 -1: addEntry
+30 -1: java/util/WeakHashMap$EntrySet
+14 -1: USE_OLDMAPPING
+39 -1: (Ljava/io/DataInput;)Ljava/lang/String;
+12 -1: LF_EX_LINKER
+27 -1: java/lang/invoke/MethodType
+23 -1: JavaSecurityAccess.java
+23 -1: isLocalOrAnonymousClass
+19 -1: Expanded arguments:
+18 -1: sun/nio/cs/Unicode
+40 -1: ()Ljava/nio/charset/spi/CharsetProvider;
+23 -1: ([BLjava/lang/String;)V
+7 -1: default
+13 -1: highestOneBit
+9 -1: isDefault
+28 -1: (IF)Ljava/lang/StringBuffer;
+31 -1: ()Ljava/util/ListIterator<TE;>;
+4 -1: base
+23 -1: newPermissionCollection
+7 -1: version
+15 -1: Permission.java
+41 -1: java/lang/invoke/LambdaForm$NamedFunction
+8 -1: isQueued
+24 -1: ([Ljava/lang/Class<*>;)I
+64 -1: java/util/concurrent/ConcurrentHashMap$MapReduceEntriesToIntTask
+16 -1: checkInitialized
+37 -1: java/lang/ClassLoader$ParallelLoaders
+5 -1: ([B)I
+23 -1: Lsun/misc/URLClassPath;
+9 -1: usr_paths
+10 -1: Queue.java
+43 -1: (Ljava/io/File;Ljava/nio/charset/Charset;)V
+64 -1: (Ljava/lang/invoke/MethodTypeForm;)Ljava/lang/invoke/MemberName;
+3 -1: tid
+23 -1: JarIndex-Version: 1.0\n\n
+33 -1: (I)Ljava/nio/charset/CoderResult;
+5 -1: ([B)V
+10 -1: isInstance
+25 -1: unmappableCharacterAction
+11 -1: queueLength
+5 -1: ([B)Z
+10 -1: freeMemory
+47 -1: java/util/ArrayPrefixHelpers$DoubleCumulateTask
+52 -1: (Ljava/util/Map;Ljava/lang/Class;Ljava/lang/Class;)V
+41 -1: Ljava/util/Collections$ReverseComparator;
+16 -1: copyToShortArray
+206 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>([Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;ILjava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;)Z
+38 -1: sun/launcher/LauncherHelper$SizePrefix
+17 -1: ACCESS_PERMISSION
+17 -1: ReverseComparator
+30 -1: ()Ljava/lang/ClassValue$Entry;
+17 -1: AF_PUTSTATIC_INIT
+6 -1: (IIB)I
+19 -1: java/nio/file/Files
+35 -1: (Z)[Ljava/lang/reflect/Constructor;
+20 -1: INVALID_FIELD_OFFSET
+17 -1: initializeHeaders
+10 -1: management
+10 -1: targetType
+61 -1: (Ljava/util/SortedSet;Ljava/lang/Class;)Ljava/util/SortedSet;
+5 -1: ascii
+8 -1: validate
+78 -1: Ljava/util/concurrent/ConcurrentHashMap<Ljava/lang/String;Ljava/lang/Object;>;
+25 -1: sun/nio/cs/UTF_16$Decoder
+36 -1: sun/management/DiagnosticCommandImpl
+24 -1: unmodifiableNavigableMap
+18 -1: canonicalizeScript
+29 -1: Lsun/misc/JavaSecurityAccess;
+74 -1: ([JLjava/util/function/IntToLongFunction;)Ljava/util/function/IntConsumer;
+38 -1: DIRECTIONALITY_LEFT_TO_RIGHT_EMBEDDING
+11 -1: languageTag
+33 -1: java/lang/invoke/VolatileCallSite
+18 -1: setRequestProperty
+6 -1: 0x%02X
+20 -1: (Ljava/lang/Float;)I
+35 -1: (Ljava/nio/charset/CoderResult$1;)V
+24 -1: (Ljava/lang/Object;JJB)V
+21 -1: synchronizedSortedSet
+59 -1: (Ljava/util/function/ToLongFunction;)Ljava/util/Comparator;
+30 -1: av.length == arity: av.length=
+7 -1: $VALUES
+27 -1: RandomNumberGeneratorHolder
+3 -1: tlr
+43 -1: java/util/ArraysParallelSortHelpers$FJFloat
+28 -1: ()[Ljava/io/File$PathStatus;
+26 -1: invalid extra field length
+13 -1: getExtensions
+7 -1: PARAMS0
+7 -1: PARAMS1
+30 -1: [Ljava/lang/invoke/MemberName;
+7 -1: PARAMS2
+31 -1: java/lang/AbstractStringBuilder
+161 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/function/BiFunction;Ljava/util/function/Consumer;)V
+4 -1: repl
+19 -1: ()Ljava/lang/Class;
+24 -1: BufferedInputStream.java
+9 -1: sizeCache
+8 -1: READLINK
+9 -1: metaIndex
+18 -1: getLocalizedObject
+6 -1: filter
+58 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;I)V
+140 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;[Ljava/lang/Object;)Ljava/lang/invoke/MemberName;
+24 -1: Ljava/util/HashMap$Node;
+35 -1: (Lsun/nio/cs/FastCharsetProvider;)V
+8 -1: dispatch
+19 -1: sun.stderr.encoding
+130 -1: (Ljava/util/List<Ljava/util/Locale$LanguageRange;>;Ljava/util/Collection<Ljava/lang/String;>;)Ljava/util/List<Ljava/lang/String;>;
+51 -1: Ljava/util/concurrent/ConcurrentHashMap$ValuesView;
+30 -1: sun.reflect.inflationThreshold
+20 -1: MutableCallSite.java
+26 -1: invokeWithArgumentsTracing
+7 -1: getters
+38 -1: ()[Ljava/lang/reflect/TypeVariable<*>;
+46 -1: ([DLjava/util/function/DoubleBinaryOperator;)V
+5 -1: klass
+13 -1: publicMethods
+37 -1: ()[Ljava/lang/reflect/Constructor<*>;
+126 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/MethodHandle;
+6 -1: FJLong
+20 -1: canBeStaticallyBound
+17 -1: getTimezoneOffset
+9 -1: ALL_TYPES
+3 -1: toV
+8 -1: packages
+15 -1: codePointBefore
+10 -1: getCountry
+13 -1: getDSTSavings
+100 -1: (Ljava/io/InputStream;Ljava/lang/Object;Ljava/nio/charset/CharsetDecoder;)Lsun/nio/cs/StreamDecoder;
+50 -1: java/util/ArraysParallelSortHelpers$FJFloat$Sorter
+20 -1: hasNonVoidPrimitives
+7 -1: syncAll
+41 -1: domain dump all domains in context
+59 -1: Ljava/util/Hashtable<Ljava/lang/Integer;Lsun/misc/Signal;>;
+16 -1: ForEachEntryTask
+18 -1: vminfoIsConsistent
+26 -1: (ZLjava/util/Comparator;)V
+9 -1: Lock.java
+31 -1: Lsun/reflect/ReflectionFactory;
+8 -1: (I[BII)I
+23 -1: doesExtendFXApplication
+87 -1: java/util/concurrent/atomic/AtomicReferenceFieldUpdater$AtomicReferenceFieldUpdaterImpl
+11 -1: windows-31j
+28 -1: sun/misc/URLClassPath$Loader
+17 -1: getEntryAfterMiss
+47 -1: ([Ljava/lang/reflect/Field;Ljava/lang/String;)J
+44 -1: Ljava/util/List<Ljava/security/Permission;>;
+10 -1: openStream
+31 -1: Ljava/net/UnknownHostException;
+19 -1: bad reference kind
+29 -1: ()Ljava/nio/MappedByteBuffer;
+9 -1: H_UPALPHA
+37 -1: (Ljava/util/function/UnaryOperator;)V
+25 -1: FAKE_METHOD_HANDLE_INVOKE
+4 -1: peek
+25 -1: java/util/Hashtable$Entry
+18 -1: getMemberRefInfoAt
+37 -1: Ljava/util/WeakHashMap$Entry<TK;TV;>;
+14 -1: resolvedHandle
+27 -1: ()Ljava/util/Iterator<TV;>;
+61 -1: Ljava/util/Map<Ljava/lang/String;Ljava/lang/reflect/Method;>;
+6 -1: static
+50 -1: (Ljava/net/URLClassLoader;)Lsun/misc/URLClassPath;
+38 -1: (Ljava/lang/Class;)[Ljava/lang/Object;
+41 -1: (Ljava/util/SortedSet;Ljava/lang/Class;)V
+41 -1: java/lang/invoke/WrongMethodTypeException
+5 -1: group
+10 -1: readObject
+13 -1: getParentFile
+14 -1: daylightSaving
+15 -1: eagerValidation
+36 -1: (Ljava/io/File;)Lsun/misc/MetaIndex;
+18 -1: reduceEntriesToInt
+15 -1: INITIAL_ENTRIES
+18 -1: AtomicInteger.java
+7 -1: .length
+128 -1: Ljava/nio/Buffer;Ljava/lang/Comparable<Ljava/nio/CharBuffer;>;Ljava/lang/Appendable;Ljava/lang/CharSequence;Ljava/lang/Readable;
+6 -1: asList
+21 -1: unmodifiableSortedSet
+22 -1: ([B)Ljava/util/BitSet;
+5 -1: check
+64 -1: (Ljava/util/jar/JarFile;Lsun/misc/MetaIndex;)Lsun/misc/JarIndex;
+35 -1: ()Ljava/nio/charset/CharsetEncoder;
+4 -1: oome
+25 -1: ()Lsun/misc/URLClassPath;
+27 -1: (Ljava/io/FilePermission;)V
+29 -1: IllegalArgumentException.java
+17 -1: jvmSpecialVersion
+21 -1: Ljava/util/ArrayList;
+13 -1: packagePrefix
+27 -1: (Ljava/io/FilePermission;)Z
+11 -1: canonicalID
+82 -1: Ljava/lang/Object;Ljava/util/Comparator<Ljava/lang/String;>;Ljava/io/Serializable;
+24 -1: java.launcher.opt.footer
+13 -1: NativeLibrary
+37 -1: (Ljava/lang/String;J)Ljava/lang/Long;
+16 -1: longBitsToDouble
+6 -1: getKey
+22 -1: (JLjava/lang/String;)V
+14 -1: ensureCapacity
+69 -1: (Ljava/lang/Object;Ljava/util/function/BiFunction;)Ljava/lang/Object;
+22 -1: java/lang/Thread$State
+50 -1: ()Ljava/util/Iterator<Ljava/nio/charset/Charset;>;
+4 -1: 7bit
+46 -1: (Ljava/lang/Class<+Ljava/lang/ClassLoader;>;)Z
+76 -1: (ILjava/util/List<Ljava/lang/Class<*>;>;)[Ljava/lang/invoke/LambdaForm$Name;
+3 -1: ttb
+12 -1: UTF_16LE_BOM
+9 -1: remainder
+40 -1: ()Lsun/reflect/generics/visitor/Reifier;
+22 -1: [Ljava/lang/Throwable;
+17 -1: EMPTY_ENUMERATION
+13 -1: erasedInvoker
+46 -1: Ljava/nio/charset/IllegalCharsetNameException;
+10 -1: UnicodeBig
+53 -1: ()Ljava/util/Map<Ljava/io/File;Lsun/misc/MetaIndex;>;
+12 -1: MAX_EXPONENT
+10 -1: Enumerator
+15 -1: charset decoder
+11 -1: AF_GETFIELD
+12 -1: | getInvoker
+74 -1: (Ljava/nio/ByteBuffer;Ljava/nio/CharBuffer;)Ljava/nio/charset/CoderResult;
+14 -1: toUnsignedLong
+46 -1: java/lang/invoke/MethodHandleNatives$Constants
+29 -1: java version "1.8.0-internal"
+21 -1: ([Ljava/lang/Class;)I
+16 -1: UPPERCASE_LETTER
+22 -1: newConstantPerfCounter
+6 -1: signum
+9 -1: getField0
+38 -1: java/nio/charset/CoderMalfunctionError
+21 -1: [Ljava/lang/Runnable;
+11 -1: putIfAbsent
+30 -1: java/util/Collections$EmptySet
+22 -1: (I)[Ljava/lang/String;
+34 -1: Ljava/security/SecurityPermission;
+49 -1: ([Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
+190 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$ReduceEntriesTask;Ljava/util/function/BiFunction;)V
+22 -1: Not an annotation type
+34 -1: java/io/ObjectInputStream$GetField
+50 -1: (Lsun/reflect/FieldInfo;)Ljava/lang/reflect/Field;
+32 -1: Ljava/lang/NoSuchFieldException;
+70 -1: (Ljava/lang/invoke/MethodHandle;[Ljava/lang/Object;)Ljava/lang/Object;
+9 -1: mergeSort
+77 -1: (ITK;TV;Ljava/util/HashMap$Node<TK;TV;>;)Ljava/util/HashMap$TreeNode<TK;TV;>;
+21 -1: sun/nio/cs/ISO_8859_1
+8 -1: DST_MASK
+21 -1: Ljava/lang/Throwable;
+108 -1: (Ljava/lang/ref/SoftReference<Ljava/lang/Class$ReflectionData<TT;>;>;I)Ljava/lang/Class$ReflectionData<TT;>;
+32 -1: java/util/Arrays$LegacyMergeSort
+59 -1: ()[Ljava/lang/reflect/TypeVariable<Ljava/lang/Class<TT;>;>;
+16 -1: parseUnsignedInt
+36 -1: ([D)Ljava/util/Spliterator$OfDouble;
+26 -1: SPECIFY_HANDLER_PERMISSION
+13 -1: primitiveType
+17 -1: threadStartFailed
+21 -1: (J)Ljava/lang/String;
+23 -1: setClassAssertionStatus
+28 -1: java/util/Hashtable$EntrySet
+28 -1: Non-positive maxBytesPerChar
+19 -1: getApplicationClass
+14 -1: SentinelHolder
+15 -1: staticFieldBase
+25 -1: setDefaultRequestProperty
+66 -1: java/util/concurrent/ConcurrentHashMap$ForEachTransformedValueTask
+8 -1: threadID
+9 -1: getFields
+15 -1: LineNumberTable
+38 -1: java/util/Collections$CheckedSortedSet
+14 -1: jdkBuildNumber
+6 -1: divide
+46 -1: (Ljava/io/BufferedWriter;Ljava/lang/String;Z)V
+20 -1: java/lang/Terminator
+92 -1: (Lsun/misc/URLClassPath$JarLoader;Ljava/lang/String;Ljava/net/URL;Ljava/util/jar/JarEntry;)V
+6 -1: force0
+10 -1: getThreads
+34 -1: java/util/IllformedLocaleException
+115 -1: (Ljava/lang/String;Lsun/reflect/generics/factory/GenericsFactory;)Lsun/reflect/generics/repository/FieldRepository;
+9 -1: testFlags
+11 -1: getLanguage
+36 -1: java/util/function/IntBinaryOperator
+12 -1: Suppressed:
+10 -1: isMandated
+23 -1: MethodAccessorImpl.java
+28 -1: (Ljava/util/zip/ZipEntry;)[B
+27 -1: Ljava/util/Hashtable$Entry;
+5 -1: table
+10 -1: Short.java
+19 -1: ReferenceQueue.java
+8 -1: setTabAt
+26 -1: ()Lsun/invoke/empty/Empty;
+53 -1: (Ljava/lang/Class;Ljava/lang/String;)Ljava/lang/Enum;
+74 -1: (ILjava/lang/Object;)Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
+19 -1: changeParameterType
+61 -1: Ljava/util/Map<Ljava/lang/String;Ljava/security/Permission;>;
+23 -1: (Ljava/lang/Object;IF)V
+32 -1: (I)Ljava/util/ListIterator<TE;>;
+6 -1: unread
+12 -1: isSubclassOf
+6 -1: (JJJ)V
+3 -1: Key
+105 -1: (Ljava/util/HashMap<TK;TV;>;[Ljava/util/HashMap$Node<TK;TV;>;ITK;TV;)Ljava/util/HashMap$TreeNode<TK;TV;>;
+14 -1: x-utf-16le-bom
+22 -1: ()Ljava/nio/IntBuffer;
+104 -1: (Ljava/lang/Class;ILjava/lang/Class;Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle;
+21 -1: removeFirstOccurrence
+21 -1: sun/misc/DoubleConsts
+23 -1: ()Ljava/util/SortedSet;
+11 -1: getManEntry
+23 -1: URI is not hierarchical
+7 -1: replace
+16 -1: getDisplayScript
+11 -1: ISO_8859-15
+16 -1: permuteArguments
+5 -1: (JI)C
+41 -1: Error decoding percent encoded characters
+22 -1: ([I)Ljava/lang/String;
+31 -1: java/lang/management/ThreadInfo
+9 -1: useCaches
+22 -1: withInternalMemberName
+5 -1: (JI)I
+5 -1: (JI)J
+67 -1: <E:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Collection<TE;>;
+95 -1: (Ljava/util/jar/JarFile;[Ljava/security/CodeSource;)Ljava/util/Enumeration<Ljava/lang/String;>;
+7 -1: release
+56 -1: (Ljava/lang/Object;Ljava/lang/String;)Ljava/lang/String;
+5 -1: (JI)V
+46 -1: (Ljava/util/Iterator;I)Ljava/util/Spliterator;
+18 -1: verifyMemberAccess
+9 -1: warning:
+23 -1: java/lang/reflect/Field
+67 -1: (Ljava/lang/String;Lsun/reflect/generics/factory/GenericsFactory;)V
+10 -1: SizePrefix
+15 -1: setJavaIOAccess
+6 -1: (JI)[B
+10 -1: ST_FLUSHED
+10 -1: resolution
+9 -1: ST_CODING
+16 -1: sun/misc/Cleaner
+21 -1: (Ljava/lang/Class;)[B
+18 -1: WeakReference.java
+41 -1: (Ljava/util/List;Ljava/util/Comparator;)V
+18 -1: printPropertyValue
+3 -1: 813
+22 -1: setRunFinalizersOnExit
+4 -1: init
+44 -1: ()Ljava/util/Iterator<Ljava/nio/file/Path;>;
+3 -1: 819
+12 -1: listIterator
+8 -1: , arity=
+24 -1: (Ljava/util/ArrayList;)I
+49 -1: (IJLjava/io/FileDescriptor;Ljava/lang/Runnable;)V
+10 -1: principals
+17 -1: x-ISO-2022-CN-CNS
+22 -1: (Ljava/lang/Object;F)V
+14 -1: setReadTimeout
+19 -1: getProtectionDomain
+13 -1: pathSeparator
+12 -1: getAndSetInt
+58 -1: (Ljava/util/List;Ljava/util/Collection;)Ljava/util/Locale;
+11 -1: setWritable
+4 -1: perf
+50 -1: ()Ljava/util/concurrent/ConcurrentHashMap<TK;TV;>;
+6 -1: LOCTIM
+6 -1: status
+11 -1: replaceName
+52 -1: (Ljava/lang/CharSequence;II)Ljava/lang/StringBuffer;
+9 -1: nextToken
+13 -1: dropArguments
+20 -1: RECOGNIZED_MODIFIERS
+14 -1: getInputStream
+9 -1: readFully
+25 -1: (CLjava/nio/CharBuffer;)I
+24 -1: sun/misc/PathPermissions
+10 -1: malformedN
+9 -1: n is null
+19 -1: instanceof Double:
+13 -1: markSupported
+26 -1: fromMethodDescriptorString
+43 -1: [Ljava/util/concurrent/locks/ReentrantLock;
+17 -1: parseUnsignedLong
+33 -1: Lsun/misc/URLClassPath$JarLoader;
+26 -1: (Ljava/io/OutputStream;I)V
+6 -1: L_DASH
+17 -1: EmptyNavigableMap
+19 -1: CharsetDecoder.java
+18 -1: makeDynamicInvoker
+12 -1: URLUtil.java
+27 -1: ()Ljava/util/Iterator<TT;>;
+9 -1: initTable
+11 -1: getFragment
+7 -1: isLower
+20 -1: getMethodOrFieldType
+29 -1: java/util/function/BiFunction
+10 -1: access$700
+3 -1: 850
+7 -1: UTC2037
+43 -1: java/util/ArraysParallelSortHelpers$FJShort
+9 -1: toSTZTime
+10 -1: access$702
+3 -1: 852
+8 -1: hashCode
+3 -1: 855
+44 -1: (Ljava/lang/ThreadLocal;Ljava/lang/Object;)V
+3 -1: 857
+3 -1: 858
+5 -1: erase
+55 -1: ()Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;
+47 -1: (Ljava/util/Iterator;JI)Ljava/util/Spliterator;
+38 -1: Ljava/nio/charset/spi/CharsetProvider;
+22 -1: can't deserialize enum
+13 -1: LF_EX_INVOKER
+18 -1: java/text/Collator
+18 -1: Zero length string
+49 -1: <T:Ljava/lang/Object;>()Ljava/util/Iterator<TT;>;
+5 -1: amd64
+12 -1: getNameCount
+7 -1: inCheck
+52 -1: (Ljava/util/concurrent/ConcurrentHashMap$TreeNode;)V
+53 -1: (ILjava/lang/CharSequence;II)Ljava/lang/StringBuffer;
+21 -1: java/util/WeakHashMap
+8 -1: throws
+52 -1: (Ljava/util/concurrent/ConcurrentHashMap$TreeNode;)Z
+55 -1: Ljava/lang/ref/SoftReference<Ljava/util/jar/Manifest;>;
+16 -1: emptyEnumeration
+3 -1: 862
+89 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/Object;ILjava/lang/Class;)Ljava/util/List;
+3 -1: 866
+55 -1: Lsun/reflect/generics/repository/ConstructorRepository;
+35 -1: (Ljava/lang/ref/ReferenceQueue$1;)V
+33 -1: java/util/Collections$CheckedList
+18 -1: prefetchReadStatic
+7 -1: (JI[I)I
+78 -1: (Ljava/lang/ThreadLocal$ThreadLocalMap;)Ljava/lang/ThreadLocal$ThreadLocalMap;
+7 -1: ordinal
+22 -1: FilterInputStream.java
+26 -1: java/util/zip/ZipConstants
+28 -1: JVM cannot find invoker for
+43 -1: sun/reflect/generics/parser/SignatureParser
+51 -1: (Ljava/lang/invoke/MethodType;[Ljava/lang/Object;)V
+73 -1: (Ljava/util/function/ToIntFunction;Ljava/lang/Object;Ljava/lang/Object;)I
+17 -1: StringBuffer.java
+62 -1: ([Ljava/lang/Object;Ljava/lang/StringBuilder;Ljava/util/Set;)V
+6 -1: equals
+9 -1: formatter
+3 -1: 874
+35 -1: newGetShortIllegalArgumentException
+74 -1: (Ljava/nio/CharBuffer;Ljava/nio/ByteBuffer;)Ljava/nio/charset/CoderResult;
+3 -1: ucp
+60 -1: ([Ljava/lang/ClassValue$Entry;I)Ljava/lang/ClassValue$Entry;
+6 -1: create
+17 -1: makeReinvokerForm
+18 -1: csisolatincyrillic
+15 -1: incrementAndGet
+24 -1: maybeInstantiateVerifier
+33 -1: ()Ljava/nio/channels/FileChannel;
+6 -1: class
+16 -1: getAnnotatedType
+43 -1: (Ljava/lang/reflect/Type;)Ljava/lang/Class;
+9 -1: HASH_BITS
+12 -1: placeInCache
+38 -1: java/util/Collections$SynchronizedList
+89 -1: (Ljava/net/URL;Ljava/util/jar/JarFile;Ljava/util/jar/JarEntry;)Ljava/security/CodeSource;
+22 -1: (Ljava/lang/String;I)B
+20 -1: Ljava/util/TimeZone;
+16 -1: sun.java.command
+28 -1: java/util/WeakHashMap$Values
+10 -1: X-UTF-16BE
+22 -1: (Ljava/lang/String;I)I
+26 -1: java/nio/DirectCharBufferS
+99 -1: (Ljava/lang/String;[BIILjava/lang/ClassLoader;Ljava/security/ProtectionDomain;)Ljava/lang/Class<*>;
+22 -1: (Ljava/lang/String;I)J
+26 -1: java/nio/DirectCharBufferU
+54 -1: (Ljava/util/function/Supplier;)Ljava/lang/ThreadLocal;
+21 -1: java/util/AbstractSet
+37 -1: (Ljava/lang/String;)Ljava/lang/Short;
+36 -1: Ljava/nio/charset/CoderResult$Cache;
+22 -1: (Ljava/lang/String;I)S
+15 -1: Ljava/util/Map;
+59 -1: (Ljava/lang/reflect/Type;)Ljava/lang/reflect/AnnotatedType;
+22 -1: (Ljava/lang/String;I)V
+10 -1: getAddress
+25 -1: java/nio/DirectIntBufferS
+11 -1: IMPL_LOOKUP
+3 -1: uee
+7 -1: addTime
+37 -1: sun/security/action/GetPropertyAction
+25 -1: java/nio/DirectIntBufferU
+21 -1: javaUtilZipFileAccess
+34 -1: java/util/Collections$CheckedQueue
+11 -1: readResolve
+22 -1: (Ljava/lang/String;I)Z
+11 -1: findVirtual
+63 -1: (Ljava/lang/String;Ljava/lang/String;)Lsun/security/util/Debug;
+22 -1: getDeclaredAnnotations
+16 -1: Collections.java
+18 -1: invalid entry size
+49 -1: java/util/concurrent/ConcurrentHashMap$TableStack
+32 -1: java/util/AbstractSequentialList
+4 -1: int0
+16 -1: MAXIMUM_CAPACITY
+53 -1: ()Ljava/util/concurrent/ConcurrentHashMap$KeySetView;
+4 -1: int1
+4 -1: int2
+4 -1: int3
+119 -1: (Ljava/lang/Class;Ljava/lang/String;[Ljava/lang/Class;Ljava/lang/Class;[Ljava/lang/Class;I)Lsun/reflect/MethodAccessor;
+7 -1: variant
+39 -1: Lsun/reflect/annotation/AnnotationType;
+11 -1: arrayOffset
+24 -1: ()Ljava/util/LinkedList;
+31 -1: java/lang/ClassCircularityError
+17 -1: java/lang/Package
+10 -1: ccsid00858
+27 -1: java/io/ExpiringCache$Entry
+16 -1: newFieldAccessor
+67 -1: (Ljava/lang/Object;Ljava/util/function/Function;)Ljava/lang/Object;
+99 -1: Lsun/reflect/generics/repository/GenericDeclRepository<Lsun/reflect/generics/tree/ClassSignature;>;
+53 -1: (Ljava/lang/invoke/MethodHandle;[Ljava/lang/Object;)V
+53 -1: Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
+58 -1: <T:Ljava/lang/Object;>([TT;)Ljava/util/stream/Stream<TT;>;
+54 -1: (Ljava/lang/CharSequence;Ljava/text/Normalizer$Form;)Z
+8 -1: Kerberos
+29 -1: ()Ljava/nio/channels/Channel;
+12 -1: java_version
+45 -1: (Lsun/reflect/DelegatingMethodAccessorImpl;)V
+10 -1: canConvert
+136 -1: (Ljava/lang/StringBuffer;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;Ljava/lang/String;)V
+26 -1: getDayOfWeekDateOnOrBefore
+7 -1: INVALID
+10 -1: TERMINATED
+41 -1: Ljava/security/cert/CertificateException;
+74 -1: (Ljava/lang/String;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/String;
+30 -1: [Ljava/lang/invoke/MethodType;
+13 -1: getMethodName
+7 -1: Factory
+34 -1: (Ljava/util/function/BiConsumer;)V
+11 -1: unlinkFirst
+37 -1: lambda$getDeclaredAnnotationsByType$0
+77 -1: (Ljava/nio/ByteBuffer;ILjava/nio/CharBuffer;II)Ljava/nio/charset/CoderResult;
+20 -1: java/util/ArrayDeque
+65 -1: (Ljava/lang/ThreadGroup;Ljava/lang/Runnable;Ljava/lang/String;J)V
+49 -1: (Ljava/util/ArrayDeque;Ljava/util/ArrayDeque$1;)V
+22 -1: (J)Ljava/time/Instant;
+17 -1: URLClassPath.java
+6 -1: 8859_1
+25 -1: stopRemoteManagementAgent
+6 -1: 8859_2
+17 -1: containsNullValue
+6 -1: 8859_4
+6 -1: 8859_5
+26 -1: (Ljava/nio/ByteBuffer;IC)V
+76 -1: (Ljava/lang/Runnable;Ljava/security/AccessControlContext;)Ljava/lang/Thread;
+6 -1: 8859_7
+6 -1: 8859_9
+8 -1: setHours
+9 -1: File.java
+21 -1: isIdentifierIgnorable
+5 -1: ([C)I
+4 -1: (B)I
+10 -1: codesource
+77 -1: ([Ljava/net/URL;Ljava/lang/ClassLoader;Ljava/security/AccessControlContext;)V
+4 -1: (B)J
+6 -1: isFair
+30 -1: java/lang/NullPointerException
+10 -1: IMPL_NAMES
+13 -1: Runnable.java
+26 -1: Ill-formed extension key:
+17 -1: ()[Ljava/io/File;
+18 -1: javaSecurityAccess
+16 -1: equalsIgnoreCase
+4 -1: (B)V
+5 -1: ([C)V
+25 -1: Ljava/io/FileInputStream;
+14 -1: trackJavaUsage
+20 -1: Ljava/io/FileSystem;
+10 -1: iso_8859_1
+4 -1: (B)Z
+30 -1: java/lang/NoClassDefFoundError
+152 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/HashMap$TreeNode<TK;TV;>;Ljava/util/HashMap$TreeNode<TK;TV;>;)Ljava/util/HashMap$TreeNode<TK;TV;>;
+19 -1: java/lang/Cloneable
+55 -1: ([Ljava/lang/Object;Ljava/util/function/IntFunction;I)V
+27 -1: (Ljava/nio/ByteBuffer;IJZ)V
+21 -1: ()Lsun/misc/JarIndex;
+72 -1: ([Ljava/security/CodeSource;)Ljava/util/Enumeration<Ljava/lang/String;>;
+64 -1: (Ljava/util/Collection;Ljava/util/Comparator;)Ljava/lang/Object;
+20 -1: invalid entry crc-32
+9 -1: BASECOUNT
+29 -1: java/security/BasicPermission
+52 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/io/File;
+7 -1: ([B[B)Z
+17 -1: EMPTY_ELEMENTDATA
+61 -1: (Ljava/security/PrivilegedExceptionAction;)Ljava/lang/Object;
+49 -1: (ILjava/lang/Class;)Ljava/lang/invoke/MethodType;
+29 -1: sun/reflect/MagicAccessorImpl
+121 -1: (Ljava/lang/String;Lsun/reflect/generics/factory/GenericsFactory;)Lsun/reflect/generics/repository/ConstructorRepository;
+6 -1: ([II)I
+40 -1: (Ljava/lang/String;I)Ljava/lang/Integer;
+25 -1: java.content.handler.pkgs
+63 -1: ()Ljava/util/Set<Ljava/util/Map$Entry<Ljava/lang/String;TV;>;>;
+13 -1: parameterList
+6 -1: rebind
+16 -1: isSuperInterface
+6 -1: ([II)V
+14 -1: currentRuntime
+9 -1: BA_EXISTS
+15 -1: END_PUNCTUATION
+15 -1: no such method
+19 -1: getAndVerifyPackage
+4 -1: wrap
+24 -1: checkAwtEventQueueAccess
+7 -1: ibm-437
+4 -1: open
+47 -1: (Ljava/nio/ByteBuffer;[BI)Ljava/nio/ByteBuffer;
+21 -1: ADDRESS_BITS_PER_WORD
+13 -1: isConstructor
+12 -1: getUseCaches
+27 -1: sun/util/locale/LocaleUtils
+4 -1: koi8
+23 -1: getParameterAnnotations
+9 -1: providers
+57 -1: ([Ljava/lang/Object;Ljava/util/function/BinaryOperator;)V
+24 -1: Lsun/misc/JavaNetAccess;
+22 -1: ([J)Ljava/lang/String;
+7 -1: p-1022$
+6 -1: isType
+63 -1: Ljava/util/Map<Ljava/lang/String;Lsun/util/calendar/ZoneInfo;>;
+21 -1: pageAlignDirectMemory
+18 -1: getManifestDigests
+37 -1: [Ljava/lang/reflect/AccessibleObject;
+7 -1: decrypt
+54 -1: (Lsun/misc/URLClassPath$JarLoader;)Ljava/util/HashMap;
+32 -1: lambda$comparingByKey$bbdbfea9$1
+21 -1: hasGenericInformation
+31 -1: java/nio/charset/CharsetEncoder
+15 -1: setTargetNormal
+3 -1: ulp
+18 -1: argumentTypesMatch
+12 -1: getDayOfYear
+8 -1: closeAll
+76 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/lang/ref/SoftReference<TV;>;
+6 -1: concat
+9 -1: getLongAt
+16 -1: hasBeenFinalized
+32 -1: [Ljava/util/Hashtable$Entry<**>;
+23 -1: CheckedRandomAccessList
+106 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)Ljava/net/URI;
+21 -1: defineClassInPackage.
+11 -1: ([III[III)V
+8 -1: toZoneId
+34 -1: SUBCLASS_IMPLEMENTATION_PERMISSION
+55 -1: java/util/concurrent/atomic/AtomicReferenceFieldUpdater
+8 -1: isDirect
+10 -1: ALL_ACCESS
+12 -1: isRegistered
+29 -1: ForEachTransformedMappingTask
+5 -1: LIJFD
+23 -1: (Ljava/util/TimeZone;)V
+23 -1: (Ljava/util/TimeZone;)Z
+20 -1: java/lang/Appendable
+29 -1: Lsun/util/calendar/Gregorian;
+9 -1: charValue
+8 -1: ONE_HOUR
+38 -1: (Ljava/util/Locale;)Ljava/lang/String;
+7 -1: script=
+10 -1: X-UTF-16LE
+7 -1: ENTRIES
+6 -1: detach
+38 -1: certpath PKIX CertPathBuilder and
+14 -1: setLanguageTag
+13 -1: isAlphaString
+13 -1: interpretName
+9 -1: dayOfWeek
+88 -1: (Ljava/lang/Class;ZLjava/lang/String;Ljava/lang/Class;Ljava/lang/Class;)Ljava/util/List;
+91 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/LambdaForm;)Ljava/lang/invoke/MethodHandle;
+13 -1: addTypeString
+17 -1: VectorSpliterator
+12 -1: MILLISECONDS
+6 -1: CENCOM
+10 -1: KeySetView
+18 -1: getTargetException
+7 -1: H_ALPHA
+32 -1: sun/util/locale/BaseLocale$Cache
+25 -1: [Ljava/lang/CharSequence;
+7 -1: Builder
+4 -1: left
+19 -1: BootClassPathHolder
+12 -1: publicFields
+11 -1: windows-437
+9 -1: EMPTY_SET
+26 -1: GET_STACK_TRACE_PERMISSION
+6 -1: copyOf
+14 -1: aliases_IBM737
+9 -1: writeLong
+35 -1: (JLjava/util/concurrent/TimeUnit;)Z
+70 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction<Ljava/lang/String;>;
+22 -1: getAnnotatedReturnType
+41 -1: (Ljava/lang/String;[BII)Ljava/lang/Class;
+8 -1: ,maxpri=
+29 -1: handleParameterNumberMismatch
+26 -1: ts timestamping
+11 -1: checkListen
+10 -1: SourceFile
+44 -1: (Ljava/lang/String;)Ljava/util/jar/JarEntry;
+17 -1: weakCompareAndSet
+9 -1: timestamp
+21 -1: (Z)Ljava/lang/String;
+12 -1: doneWithMeta
+20 -1: makeCollectArguments
+52 -1: (JLjava/util/function/BiFunction;)Ljava/lang/Object;
+10 -1: searchKeys
+48 -1: sun/reflect/SerializationConstructorAccessorImpl
+69 -1: (Ljava/lang/reflect/Constructor<*>;)Lsun/reflect/ConstructorAccessor;
+19 -1: ()Lsun/misc/Unsafe;
+11 -1: deepEquals0
+7 -1: GB18030
+13 -1: ValueIterator
+75 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)V
+28 -1: java/util/PropertyPermission
+6 -1: CENCRC
+3 -1: url
+3 -1: L_L
+19 -1: Certificate too big
+33 -1: sun/reflect/DelegatingClassLoader
+16 -1: lambda$stream$57
+11 -1: BitSet.java
+13 -1: sun/misc/Perf
+26 -1: Ljava/util/SimpleTimeZone;
+7 -1: (BBBB)I
+24 -1: sun/misc/FloatingDecimal
+21 -1: sun/util/PreHashedMap
+8 -1: utf-16be
+11 -1: isInherited
+83 -1: (Ljava/util/Properties;Ljava/io/OutputStream;Ljava/lang/String;Ljava/lang/String;)V
+52 -1: (Ljava/lang/Class;Ljava/security/ProtectionDomain;)V
+11 -1: getDoOutput
+18 -1: asVarargsCollector
+22 -1: NoSuchMethodError.java
+18 -1: getStackTraceDepth
+30 -1: (Ljava/io/File;)Ljava/net/URL;
+15 -1: CURRENCY_SYMBOL
+24 -1: Lsun/misc/JavaNioAccess;
+6 -1: NATIVE
+22 -1: Lsun/misc/PerfCounter;
+63 -1: java/util/concurrent/ConcurrentHashMap$MapReduceValuesToIntTask
+30 -1: less than Character.MIN_RADIX
+17 -1: isCallerSensitive
+8 -1: shutdown
+11 -1: STATE_GREEN
+4 -1: next
+10 -1: tryPresize
+16 -1: CONSTRUCTOR_NAME
+3 -1: MAY
+21 -1: java.security.manager
+20 -1: Lsun/misc/Contended;
+16 -1: DISPLAY_LANGUAGE
+6 -1: KeySet
+9 -1: getScript
+3 -1: utc
+17 -1: TRACE_INTERPRETER
+39 -1: (Ljava/lang/Object;I)Ljava/lang/String;
+19 -1: getFieldAtIfLoaded0
+15 -1: methodFilterMap
+54 -1: Ljava/util/Map<Ljava/lang/String;Ljava/lang/Boolean;>;
+45 -1: java/security/cert/Certificate$CertificateRep
+43 -1: (Ljava/lang/String;)Lsun/util/calendar/Era;
+34 -1: java/security/cert/X509Certificate
+19 -1: versionsInitialized
+11 -1: isDirectory
+14 -1: aliases_IBM775
+38 -1: (Ljava/util/function/Consumer<-TE;>;)V
+38 -1: (Ljava/lang/String;)Ljava/util/Locale;
+40 -1: (Ljava/lang/String;Z)Lsun/misc/Resource;
+14 -1: setDefaultZone
+14 -1: highResCounter
+78 -1: (Ljava/lang/ClassValue$Version;Ljava/lang/Object;)Ljava/lang/ClassValue$Entry;
+16 -1: defaultUseCaches
+40 -1: (Ljava/util/zip/ZipFile;)Ljava/util/Map;
+24 -1: isSupplementaryCodePoint
+15 -1: ISO_8859_1.java
+13 -1: multiplyExact
+126 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;Lsun/util/locale/LocaleExtensions;)Ljava/util/Locale;
+8 -1: classMap
+8 -1: wildcard
+19 -1: getSimpleBinaryName
+17 -1: illegal signature
+14 -1: == basicType(
+17 -1: ZipConstants.java
+32 -1: [Ljava/lang/VirtualMachineError;
+27 -1: ()Ljava/util/stream/Stream;
+24 -1: (Ljava/lang/Exception;)V
+21 -1: java/util/Enumeration
+13 -1: newSetFromMap
+8 -1: getenv.*
+20 -1: sun/management/Agent
+21 -1: sun/nio/cs/US_ASCII$1
+7 -1: comment
+15 -1: appendAuthority
+11 -1: hasWrappers
+10 -1: dstOffset
+24 -1: sun/reflect/ConstantPool
+75 -1: (Ljava/util/jar/JarFile;[Ljava/security/CodeSource;)Ljava/util/Enumeration;
+52 -1: (Ljava/util/jar/JarFile;)Ljava/util/jar/JarVerifier;
+70 -1: Ljava/lang/Object;Ljava/security/PrivilegedAction<Ljava/lang/Object;>;
+14 -1: previousSetBit
+17 -1: AF_GETSTATIC_INIT
+15 -1: ArrayDeque.java
+7 -1: boolean
+25 -1: (I)Ljava/math/BigInteger;
+146 -1: (Ljava/lang/ref/ReferenceQueue<Ljava/lang/Class<*>;>;Ljava/util/concurrent/ConcurrentMap<+Ljava/lang/ref/WeakReference<Ljava/lang/Class<*>;>;*>;)V
+8 -1: getClass
+8 -1: user.dir
+6 -1: VALUES
+5 -1: raise
+39 -1: (JLjava/util/function/Consumer<-TV;>;)V
+107 -1: <T:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater<TT;TV;>;
+5 -1: print
+8 -1: readChar
+55 -1: (JLjava/util/TimeZone;)Lsun/util/calendar/CalendarDate;
+56 -1: java/util/concurrent/ConcurrentHashMap$MapReduceKeysTask
+60 -1: Ljava/lang/Number;Ljava/lang/Comparable<Ljava/lang/Double;>;
+102 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/SortedMap<TK;TV;>;)Ljava/util/SortedMap<TK;TV;>;
+23 -1: printModifiersIfNonzero
+14 -1: getterFunction
+15 -1: ISO-10646-UCS-2
+14 -1: canonizeString
+13 -1: getTotalSpace
+24 -1: synchronizedNavigableSet
+100 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedAction<TT;>;Ljava/security/AccessControlContext;)TT;
+4 -1: ioex
+24 -1: ()Ljava/nio/FloatBuffer;
+14 -1: toBinaryString
+7 -1: Segment
+34 -1: ()Lsun/misc/JavaUtilZipFileAccess;
+17 -1: setTargetVolatile
+22 -1: (Ljava/util/List<*>;)V
+51 -1: (ILjava/lang/CharSequence;)Ljava/lang/StringBuffer;
+22 -1: (Ljava/util/List<*>;)Z
+5 -1: (FI)F
+11 -1: parseMethod
+8 -1: Compiled
+19 -1: java/util/SortedMap
+7 -1: setByte
+12 -1: getFieldType
+8 -1: pageSize
+14 -1: getCallerClass
+9 -1: ensureObj
+18 -1: refKindHasReceiver
+10 -1: getZoneIds
+24 -1: (Ljava/nio/CharBuffer;)I
+47 -1: ()Lsun/reflect/generics/parser/SignatureParser;
+8 -1: getIndex
+24 -1: (Ljava/lang/Thread;TT;)V
+18 -1: (Ljava/util/Map;)V
+18 -1: (Ljava/util/Map;)Z
+6 -1: random
+10 -1: putAddress
+64 -1: (Ljava/util/function/Consumer<-Ljava/util/Map$Entry<TK;TV;>;>;)V
+24 -1: (Ljava/nio/CharBuffer;)V
+8 -1: canCache
+24 -1: (Ljava/nio/CharBuffer;)Z
+9 -1: getIntAt0
+4 -1: sqrt
+8 -1: makeLong
+54 -1: ([Ljava/lang/Object;Ljava/util/function/IntFunction;)V
+5 -1: (JJ)I
+26 -1: javaIOFileDescriptorAccess
+5 -1: (JJ)J
+15 -1: != basicType:
+36 -1: Ljava/lang/ref/ReferenceQueue<-TT;>;
+5 -1: words
+16 -1: sun.jnu.encoding
+32 -1: (Ljava/lang/invoke/LambdaForm;)V
+22 -1: ensureClassInitialized
+16 -1: Ljava/util/List;
+14 -1: varargsInvoker
+5 -1: (JJ)V
+20 -1: java/util/Properties
+12 -1: getImplClass
+21 -1: argumentTypesToString
+5 -1: (JJ)Z
+50 -1: java/util/Collections$SynchronizedRandomAccessList
+17 -1: makeWrappedMember
+21 -1: UnmodifiableSortedSet
+22 -1: (ILjava/lang/Class;Z)V
+3 -1: MIT
+13 -1: bootClassPath
+50 -1: (JLjava/util/function/Function;)Ljava/lang/Object;
+74 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/HashMap$Node<TK;TV;>;
+45 -1: (Ljava/util/Map$Entry;Ljava/util/Map$Entry;)I
+12 -1: advanceProbe
+10 -1: encoderFor
+14 -1: DataInput.java
+16 -1: java/lang/Double
+3 -1: 912
+3 -1: 914
+3 -1: abs
+3 -1: 915
+13 -1: currentThread
+17 -1: ClassDefiner.java
+32 -1: sun/misc/Launcher$ExtClassLoader
+16 -1: Current state =
+12 -1: elementCount
+10 -1: unmaskNull
+8 -1: csibm857
+32 -1: java/net/UnknownServiceException
+10 -1: x-utf-16be
+3 -1: acc
+37 -1: Ljava/util/List<Ljava/io/Closeable;>;
+23 -1: ([Ljava/lang/Thread;Z)I
+17 -1: impliesIgnoreMask
+23 -1: getGenericComponentType
+51 -1: ()Lsun/reflect/generics/repository/ClassRepository;
+34 -1: " not found. Will use interpreter.
+38 -1: ()Ljava/security/AccessControlContext;
+6 -1: final
+8 -1: utf-16le
+3 -1: 920
+3 -1: 923
+5 -1: (I)[C
+43 -1: (Ljava/nio/ByteOrder;)Ljava/nio/ByteBuffer;
+8 -1: csibm862
+34 -1: (Ljava/lang/ref/Reference<+TT;>;)Z
+8 -1: csibm866
+20 -1: getParameterizedType
+7 -1: (II[C)V
+20 -1: [Ljava/lang/Package;
+84 -1: (Ljava/lang/String;Ljava/security/ProtectionDomain;)Ljava/security/ProtectionDomain;
+28 -1: SynchronizedRandomAccessList
+18 -1: sun/misc/VMSupport
+61 -1: java/lang/invoke/MethodType$ConcurrentWeakInternSet$WeakEntry
+3 -1: add
+16 -1: ZipEntryIterator
+11 -1: next_target
+87 -1: (Ljava/lang/String;Ljava/nio/ByteBuffer;Ljava/security/CodeSource;)Ljava/lang/Class<*>;
+4 -1: amod
+12 -1: markedSkipLF
+55 -1: java/util/concurrent/ConcurrentHashMap$EntrySpliterator
+5 -1: lim=
+29 -1: java/security/PermissionsHash
+50 -1: (Ljava/lang/CharSequence;II)Ljava/lang/Appendable;
+19 -1: makePairwiseConvert
+58 -1: <T:Ljava/lang/Object;>(Ljava/lang/ClassValue$Entry<TT;>;)V
+8 -1: contents
+11 -1: user.region
+17 -1: RandomAccess.java
+13 -1: singletonList
+13 -1: policy,access
+64 -1: Ljava/util/Map<Ljava/lang/String;Ljava/io/ExpiringCache$Entry;>;
+25 -1: (Ljava/lang/Appendable;)V
+19 -1: (Ljava/util/List;)V
+43 -1: (Ljava/lang/ClassLoader;Ljava/lang/Class;)V
+19 -1: (Ljava/util/List;)Z
+15 -1: America/Chicago
+25 -1: (II)Ljava/nio/CharBuffer;
+12 -1: getDayOfWeek
+8 -1: ([BIIZ)V
+28 -1: (Ljava/lang/reflect/Field;)I
+28 -1: (Ljava/lang/reflect/Field;)J
+18 -1: getDeclaringClass0
+11 -1: counterTime
+30 -1: (Ljava/util/Collection<TE;>;)V
+28 -1: (Ljava/lang/reflect/Field;)V
+31 -1: (IIIILjava/io/FileDescriptor;)V
+25 -1: java/net/SocketPermission
+20 -1: bad parameter count
+18 -1: getHeaderFieldLong
+26 -1: GetReflectionFactoryAction
+19 -1: MIN_TRANSFER_STRIDE
+17 -1: java/nio/Bits$1$1
+7 -1: getSize
+33 -1: java/util/function/ToLongFunction
+46 -1: (IILjava/lang/String;)Ljava/lang/StringBuffer;
+10 -1: access$800
+65 -1: sun/misc/JavaSecurityProtectionDomainAccess$ProtectionDomainCache
+26 -1: (Ljava/lang/ClassLoader;)V
+25 -1: java/util/IdentityHashMap
+26 -1: (Ljava/lang/ClassLoader;)Z
+91 -1: <T:Ljava/lang/Object;>(Ljava/util/function/ToIntFunction<-TT;>;)Ljava/util/Comparator<TT;>;
+26 -1: ([CIILjava/lang/String;I)I
+12 -1: canonicalize
+3 -1: val
+8 -1: putCharB
+12 -1: UTF_32LE_BOM
+60 -1: (Ljava/security/CodeSource;)Ljava/security/ProtectionDomain;
+44 -1: (Lsun/misc/SignalHandler;Lsun/misc/Signal;)V
+26 -1: (Ljava/util/Enumeration;)V
+11 -1: INVALIDATED
+8 -1: putCharL
+22 -1: (II)Ljava/lang/String;
+7 -1: hasNext
+5 -1: WRITE
+20 -1: MIN_INITIAL_CAPACITY
+13 -1: propertyNames
+9 -1: Gregorian
+13 -1: getExpiration
+7 -1: minutes
+7 -1: ostream
+9 -1: java.lang
+17 -1: forceStandardTime
+9 -1: initWords
+41 -1: java/lang/Thread$UncaughtExceptionHandler
+9 -1: theUnsafe
+27 -1: ForEachTransformedEntryTask
+10 -1: forEncoder
+31 -1: needsClassLoaderPermissionCheck
+5 -1: ctime
+25 -1: ()Ljava/nio/DoubleBuffer;
+8 -1: getValue
+66 -1: (Lsun/util/locale/BaseLocale$Key;)Lsun/util/locale/BaseLocale$Key;
+42 -1: (Ljava/io/InputStream;Ljava/lang/String;)V
+6 -1: august
+14 -1: compileClasses
+13 -1: javaNetAccess
+22 -1: interpretWithArguments
+4 -1: url:
+14 -1: EMPTY_ITERATOR
+60 -1: Ljava/util/WeakHashMap<Ljava/io/Closeable;Ljava/lang/Void;>;
+24 -1: java/util/jar/Attributes
+12 -1: getOrDefault
+19 -1: Pacific/Guadalcanal
+33 -1: ()Ljava/lang/reflect/Constructor;
+38 -1: java/util/Collections$UnmodifiableList
+13 -1: basicTypeChar
+22 -1: (Ljava/lang/String;J)J
+14 -1: memberDefaults
+42 -1: (Ljava/lang/Class<*>;[Ljava/lang/String;)V
+38 -1: (Ljava/util/function/Consumer<-TK;>;)V
+16 -1: LF_NEWINVSPECIAL
+10 -1: classDepth
+28 -1: [Ljava/io/ObjectStreamField;
+46 -1: (Ljava/util/Collection;)Ljava/util/Collection;
+91 -1: ([Ljava/lang/reflect/Method;Ljava/lang/String;[Ljava/lang/Class;)Ljava/lang/reflect/Method;
+11 -1: getLocation
+39 -1: (Ljava/lang/Class;[Ljava/lang/Class;Z)V
+9 -1: loadTable
+55 -1: Directory separator should not appear in library name:
+7 -1: setTime
+14 -1: getConstructor
+4 -1: urls
+25 -1: dispatchUncaughtException
+77 -1: (ILjava/lang/Object;Ljava/lang/Class<*>;)Ljava/util/HashMap$TreeNode<TK;TV;>;
+8 -1: modCount
+8 -1: Opening
+6 -1: ENDHDR
+4 -1: cnfe
+34 -1: DIRECTIONALITY_PARAGRAPH_SEPARATOR
+10 -1: Asia/Amman
+3 -1: MST
+28 -1: DIRECTIONALITY_ARABIC_NUMBER
+3 -1: all
+4 -1: enum
+8 -1: copyWith
+12 -1: ([JI[IIJII)I
+29 -1: Ljava/lang/annotation/Target;
+7 -1: Thread-
+14 -1: x-utf-32le-bom
+38 -1: (ILjava/lang/management/MemoryUsage;)V
+33 -1: Signal already used by VM or OS:
+27 -1: (I)Ljava/lang/StringBuffer;
+25 -1: java/text/Normalizer$Form
+10 -1: x-utf-16le
+34 -1: can not access a member of class
+27 -1: (Ljava/nio/ByteBuffer;IFZ)V
+28 -1: (Ljava/lang/ClassValue<*>;)V
+16 -1: INITIAL_CAPACITY
+23 -1: DirectMethodHandle.java
+18 -1: reduceValuesToLong
+41 -1: (Ljava/lang/String;Ljava/lang/Class<*>;)V
+6 -1: unwrap
+12 -1: threadStatus
+5 -1: (DI)D
+11 -1: fieldOffset
+52 -1: java/util/concurrent/ConcurrentHashMap$EntryIterator
+14 -1: ACCESS_EXECUTE
+44 -1: (Ljava/nio/ByteBuffer;)Ljava/nio/CharBuffer;
+29 -1: ([Ljava/lang/ThreadGroup;IZ)I
+18 -1: LocalVariableTable
+17 -1: ConstantPool.java
+26 -1: (Ljava/nio/ByteBuffer;ID)V
+4 -1: (C)B
+3 -1: and
+4 -1: head
+126 -1: (Ljava/lang/reflect/GenericDeclaration;Lsun/reflect/generics/scope/Scope;)Lsun/reflect/generics/factory/CoreReflectionFactory;
+4 -1: (C)C
+16 -1: Pacific/Auckland
+7 -1: Thread[
+5 -1: ([D)I
+4 -1: (C)I
+98 -1: <U:Ljava/lang/Object;>([Ljava/lang/reflect/Constructor<TU;>;)[Ljava/lang/reflect/Constructor<TU;>;
+11 -1: fileHandler
+30 -1: DIRECTIONALITY_NONSPACING_MARK
+10 -1: (this Map)
+14 -1: malformedCache
+5 -1: ([D)V
+4 -1: (C)V
+26 -1: getUnicodeLocaleAttributes
+4 -1: (C)Z
+81 -1: (JLjava/util/function/ToLongBiFunction;JLjava/util/function/LongBinaryOperator;)J
+46 -1: [Ljava/util/concurrent/ConcurrentHashMap$Node;
+20 -1: Max. Heap Size:
+24 -1: Ljava/lang/reflect/Type;
+13 -1: EmptyIterator
+8 -1: allocate
+7 -1: FLUSHED
+8 -1: exitVM.*
+59 -1: (Ljava/lang/String;)Lsun/util/locale/InternalLocaleBuilder;
+19 -1: reduceEntriesToLong
+15 -1: getISOLanguages
+13 -1: CONSTANT_ZERO
+23 -1: (I)Ljava/util/Iterator;
+96 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/AbstractMap<TK;TV;>;Ljava/util/Map<TK;TV;>;
+11 -1: isSynthetic
+7 -1: lineBuf
+30 -1: java/lang/annotation/Inherited
+65 -1: <E:Ljava/lang/Object;>Ljava/lang/Object;Ljava/lang/Iterable<TE;>;
+35 -1: (Ljava/lang/String;)[Ljava/io/File;
+27 -1: java/security/cert/CertPath
+26 -1: startRemoteManagementAgent
+9 -1: shiftLeft
+5 -1: stack
+42 -1: (Ljava/lang/Class<*>;[Ljava/lang/Object;)V
+11 -1: CheckedList
+10 -1: replaceAll
+86 -1: (Ljava/util/HashMap$TreeNode;Ljava/util/HashMap$TreeNode;)Ljava/util/HashMap$TreeNode;
+24 -1: (I)Ljava/nio/CharBuffer;
+13 -1: image/vnd.fpx
+15 -1: iso_8859-1:1987
+19 -1: (Ljava/lang/Long;)I
+22 -1: sun/misc/SignalHandler
+15 -1: ifModifiedSince
+42 -1: (Ljava/lang/Class;)Ljava/lang/ClassLoader;
+105 -1: (Ljava/lang/Class;Ljava/lang/String;Ljava/lang/String;ILjava/lang/Class;I[Ljava/lang/invoke/MemberName;)I
+22 -1: Negative timeout value
+38 -1: Ljava/io/UnsupportedEncodingException;
+11 -1: removeRange
+13 -1: Compiler.java
+6 -1: Sorter
+8 -1: aliasSet
+10 -1: UNASSIGNED
+34 -1: lambda$comparingByValue$1065357e$1
+34 -1: ()Ljava/lang/Class$AnnotationData;
+25 -1: sun/misc/Launcher$Factory
+15 -1: getLongVolatile
+8 -1: vmloader
+10 -1: unicodebig
+10 -1: closeables
+31 -1: JavaIOFileDescriptorAccess.java
+7 -1: static
+3 -1: arg
+21 -1: library can't be null
+42 -1: java/util/ArraysParallelSortHelpers$FJByte
+22 -1: getDeclaringExecutable
+19 -1: runFinalizersOnExit
+20 -1: simpleTimeZoneParams
+13 -1: Modifier.java
+14 -1: pkcs11keystore
+6 -1: shared
+30 -1: java/net/MalformedURLException
+26 -1: ()[Lsun/util/calendar/Era;
+13 -1: x-MS950-HKSCS
+10 -1: relativize
+40 -1: (Ljava/lang/String;JJ)Ljava/lang/String;
+31 -1: java/util/HashMap$ValueIterator
+29 -1: MODIFY_THREADGROUP_PERMISSION
+38 -1: (Ljava/lang/String;)Ljava/lang/Object;
+7 -1: destroy
+37 -1: (Ljava/util/List;)[Ljava/lang/String;
+18 -1: (Ljava/io/File;Z)V
+32 -1: Ljava/util/HashMap$Node<TK;TV;>;
+18 -1: interfaceModifiers
+34 -1: java/util/LinkedList$LLSpliterator
+7 -1: REF_???
+23 -1: java/net/ContentHandler
+20 -1: <compiledLambdaForm>
+17 -1: [Ljava/lang/Byte;
+6 -1: exitVM
+3 -1: att
+27 -1: sun/nio/cs/UTF_16BE$Encoder
+6 -1: exists
+28 -1: Ljava/util/Collection<+TE;>;
+48 -1: (Ljava/lang/CharSequence;)Ljava/lang/Appendable;
+6 -1: getMap
+52 -1: ([Ljava/lang/Class;I)Ljava/lang/reflect/Constructor;
+11 -1: stackTrace[
+21 -1: slowCheckMemberAccess
+33 -1: ReflectiveOperationException.java
+9 -1: versionId
+56 -1: Wrong number of parameters in MethodParameters attribute
+14 -1: isLowSurrogate
+8 -1: csPCp852
+16 -1: copyConstructors
+25 -1: ()Ljava/util/Spliterator;
+9 -1: closeLock
+17 -1: readUnsignedShort
+7 -1: 8859_13
+7 -1: 8859_15
+13 -1: TARGET_OFFSET
+26 -1: (Ljava/util/Hashtable;IZ)V
+44 -1: (Ljava/nio/CharBuffer;)Ljava/nio/CharBuffer;
+46 -1: (Ljava/lang/reflect/Type;)Ljava/lang/Class<*>;
+25 -1: DEFAULT_CONCURRENCY_LEVEL
+36 -1: Ljava/util/List<Ljava/lang/String;>;
+29 -1: sun.nio.PageAlignDirectMemory
+37 -1: (Ljava/lang/Class;I)Ljava/lang/Class;
+12 -1: encryptBlock
+8 -1: parentOf
+5 -1: H_HEX
+11 -1: getFloatAt0
+24 -1: VirtualMachineError.java
+18 -1: getDeclaredClasses
+59 -1: (Ljava/lang/AbstractStringBuilder;)Ljava/lang/StringBuffer;
+42 -1: (Ljava/util/List<Ljava/lang/Class<*>;>;)[C
+37 -1: (Ljava/lang/String;)Ljava/lang/Float;
+13 -1: Iterator.java
+25 -1: (Ljava/io/PrintStream;I)V
+9 -1: getObject
+19 -1: [Ljava/lang/String;
+7 -1: SIZECTL
+11 -1: isUnderflow
+27 -1: sun.nio.MaxDirectMemorySize
+21 -1: isNonPublicProxyClass
+13 -1: toCalendarDOW
+9 -1: Type.java
+14 -1: aliases_IBM850
+17 -1: emptyNavigableMap
+14 -1: aliases_IBM852
+14 -1: aliases_IBM855
+14 -1: aliases_IBM857
+14 -1: aliases_IBM858
+15 -1: iso_8859-4:1988
+13 -1: UnicodeScript
+8 -1: getCharB
+17 -1: constructorMethod
+27 -1: java/util/function/Function
+20 -1: getProtectionDomain0
+8 -1: getCharL
+32 -1: ([Ljava/io/File;)[Ljava/net/URL;
+51 -1: (Ljava/lang/Class;Z)Ljava/lang/invoke/MethodHandle;
+7 -1: getenv.
+5 -1: stale
+14 -1: aliases_IBM862
+32 -1: java/util/spi/LocaleNameProvider
+14 -1: aliases_IBM866
+51 -1: ([Ljava/lang/Class;)Ljava/lang/reflect/Constructor;
+6 -1: CENDSK
+36 -1: java/util/Comparators$NullComparator
+34 -1: UnsafeStaticFieldAccessorImpl.java
+17 -1: staticFieldOffset
+12 -1: prefetchRead
+4 -1: help
+34 -1: (Ljava/util/concurrent/TimeUnit;)J
+8 -1: getChars
+19 -1: java/lang/Throwable
+34 -1: Annotation Type:\n Member types:
+55 -1: (Ljava/lang/Class<*>;Ljava/security/ProtectionDomain;)V
+14 -1: aliases_IBM874
+17 -1: getDisplayVariant
+24 -1: Ljava/net/NetPermission;
+15 -1: jvmMinorVersion
+11 -1: subSequence
+3 -1: x86
+6 -1: double
+14 -1: checkSlotCount
+20 -1: java/net/InetAddress
+14 -1: Principal.java
+8 -1: $,;:@&=+
+17 -1: ByteBuffered.java
+21 -1: sun.misc.Perf.getPerf
+11 -1: finishEntry
+27 -1: sun.timezone.ids.oldmapping
+26 -1: (ZLjava/io/OutputStream;)V
+41 -1: (Ljava/lang/String;Z)Ljava/lang/Class<*>;
+32 -1: generateSerializationConstructor
+6 -1: Value
+40 -1: (Ljava/lang/String;Ljava/lang/String;Z)V
+16 -1: previousClearBit
+7 -1: theProp
+51 -1: (Ljava/io/OutputStream;Ljava/nio/charset/Charset;)V
+39 -1: com.sun.javafx.application.LauncherImpl
+21 -1: URLStreamHandler.java
+4 -1: in
+14 -1: BIT_INDEX_MASK
+125 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/Comparator<-TK;>;)Ljava/util/Comparator<Ljava/util/Map$Entry<TK;TV;>;>;
+49 -1: (Ljava/util/Set;Ljava/lang/Class;)Ljava/util/Set;
+10 -1: scaleValue
+27 -1: (Ljava/nio/ByteBuffer;IDZ)V
+78 -1: (Ljava/util/Collection<Ljava/lang/reflect/Field;>;[Ljava/lang/reflect/Field;)V
+53 -1: <T:Ljava/lang/Object;>(I)Ljava/util/Enumeration<TT;>;
+38 -1: java/lang/IncompatibleClassChangeError
+60 -1: java/util/concurrent/ConcurrentHashMap$MapReduceMappingsTask
+23 -1: not a method or field:
+35 -1: Ljava/nio/BufferUnderflowException;
+4 -1: i386
+13 -1: US_ASCII.java
+80 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/Class;)Ljava/lang/reflect/AnnotatedType;
+21 -1: initializeSystemClass
+6 -1: ([CI)I
+18 -1: getBooleanProperty
+35 -1: java/util/function/ToDoubleFunction
+37 -1: (Ljava/lang/String;)Ljava/lang/Class;
+28 -1: MapReduceEntriesToDoubleTask
+38 -1: java/util/LinkedHashMap$LinkedEntrySet
+8 -1: copySign
+6 -1: ([CI)V
+55 -1: sun/util/calendar/ZoneInfoFile$ZoneOffsetTransitionRule
+12 -1: parseBoolean
+3 -1: NET
+3 -1: NEW
+6 -1: Values
+17 -1: getJavaLangAccess
+9 -1: LocaleKey
+3 -1: :-1
+30 -1: (Ljava/io/ObjectInputStream;)V
+3 -1: NFC
+3 -1: NFD
+18 -1: SIMPLIFIED_CHINESE
+28 -1: ()Ljava/lang/reflect/Method;
+9 -1: localInit
+37 -1: sun/util/locale/LocaleSyntaxException
+15 -1: LambdaForm.java
+5 -1: rtype
+8 -1: field "
+50 -1: (Ljava/lang/Class;Ljava/lang/ref/ReferenceQueue;)V
+80 -1: (Ljava/lang/Class;[Ljava/lang/Class;[Ljava/lang/Class;IILjava/lang/String;[B[B)V
+36 -1: java/lang/invoke/MethodHandleNatives
+22 -1: (Ljava/util/Map<**>;)Z
+22 -1: Ljava/lang/Class<TV;>;
+7 -1: SubList
+14 -1: connect,accept
+19 -1: declaredAnnotations
+38 -1: Ljava/lang/ThreadLocal$ThreadLocalMap;
+11 -1: isSpaceChar
+10 -1: offerFirst
+20 -1: sun/nio/ByteBuffered
+17 -1: packageDefinition
+7 -1: trigger
+35 -1: [Ljava/lang/invoke/LambdaForm$Name;
+19 -1: sun.stdout.encoding
+5 -1: start
+26 -1: (Ljava/util/HashMap;IIII)V
+65 -1: (JLjava/util/function/Consumer<-Ljava/util/Map$Entry<TK;TV;>;>;)V
+6 -1: LOCVER
+3 -1: ://
+42 -1: (CLjava/lang/Class<*>;Ljava/lang/Object;)Z
+6 -1: friday
+45 -1: sun/reflect/DelegatingConstructorAccessorImpl
+15 -1: iso_8859-7:1987
+15 -1: newCalendarDate
+24 -1: getAnnotatedReceiverType
+32 -1: java/util/NoSuchElementException
+50 -1: (Ljava/util/NavigableSet;)Ljava/util/NavigableSet;
+26 -1: java/text/SimpleDateFormat
+16 -1: threadInitNumber
+55 -1: <T:Ljava/lang/Object;>(TT;)Ljava/util/Spliterator<TT;>;
+23 -1: (Ljava/lang/Object;)TT;
+3 1: bar
+37 -1: getFunctionalInterfaceMethodSignature
+5 -1: state
+39 -1: [Ljava/lang/reflect/GenericDeclaration;
+22 -1: sun/net/ProgressSource
+13 -1: LLSpliterator
+93 -1: <T:Ljava/lang/Object;>Ljava/lang/Object;Ljava/util/Enumeration<TT;>;Ljava/util/Iterator<TT;>;
+5 -1: JAPAN
+11 -1: SPACE_TOTAL
+20 -1: CharsetProvider.java
+12 -1: CR_UNDERFLOW
+7 -1: ITALIAN
+11 -1: getCallerPD
+13 -1: isMemberClass
+38 -1: (Ljava/util/function/Consumer<-TT;>;)V
+18 -1: malformedForLength
+14 -1: ReflectionData
+34 -1: (BZI)Ljava/lang/invoke/LambdaForm;
+16 -1: forPrimitiveType
+31 -1: field found in java.lang.Class
+60 -1: (Ljava/lang/Void;Ljava/lang/ThreadGroup;Ljava/lang/String;)V
+18 -1: DescendingIterator
+25 -1: (IZLjava/lang/Runnable;)V
+35 -1: ()[Ljava/lang/reflect/TypeVariable;
+3 -1: bcp
+23 -1: (Ljava/lang/Object;)TV;
+25 -1: setDefaultAssertionStatus
+10 -1: ([BIIIII)V
+150 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>(Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;)Ljava/util/concurrent/ConcurrentHashMap$Node<TK;TV;>;
+14 -1: Inherited:
+17 -1: fileTimeToWinTime
+7 -1: ([BI)[B
+26 -1: java/io/OutputStreamWriter
+58 -1: <T:Ljava/lang/Object;>(Ljava/util/ListIterator<+TT;>;I)TT;
+39 -1: sun/reflect/annotation/AnnotationParser
+71 -1: (Ljava/nio/file/Path;Ljava/lang/String;)Ljava/nio/file/DirectoryStream;
+47 -1: Ljava/util/concurrent/locks/ReentrantLock$Sync;
+44 -1: (Ljava/util/Collection;[Ljava/lang/Object;)Z
+43 -1: ([ILjava/util/function/IntBinaryOperator;)V
+29 -1: reverseAllValidSurrogatePairs
+20 -1: Ljava/nio/file/Path;
+20 -1: getGenericSignature0
+42 -1: (Ljava/lang/String;Ljava/lang/Class<*>;Z)V
+8 -1: manEntry
+64 -1: (Ljava/lang/String;)Ljava/util/Enumeration<Lsun/misc/Resource;>;
+36 -1: newGetDoubleIllegalArgumentException
+63 -1: (Ljava/util/Collection;Ljava/lang/Class;)Ljava/util/Collection;
+30 -1: Ergonomics Machine Class:
+40 -1: ()Ljava/util/Map<Ljava/lang/String;TT;>;
+50 -1: (Ljava/lang/StringBuffer;)Ljava/lang/StringBuffer;
+30 -1: CHECK_MEMBER_ACCESS_PERMISSION
+22 -1: (Ljava/lang/Boolean;)I
+10 -1: V_Variable
+68 -1: java/util/concurrent/ConcurrentHashMap$ForEachTransformedMappingTask
+61 -1: (Ljava/lang/String;IILjava/lang/String;)Ljava/nio/ByteBuffer;
+21 -1: accessClassInPackage.
+44 -1: java/util/WeakHashMap$WeakHashMapSpliterator
+11 -1: nextElement
+9 -1: separator
+48 -1: java/util/zip/ZipFile$ZipFileInflaterInputStream
+44 -1: java/security/UnresolvedPermissionCollection
+10 -1: access$900
+44 -1: java/util/ArraysParallelSortHelpers$FJDouble
+84 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodHandle;
+52 -1: (Ljava/lang/ref/Finalizer;)Ljava/lang/ref/Finalizer;
+19 -1: getDeclaredMethods0
+29 -1: (IJ)Ljava/lang/StringBuilder;
+11 -1: Member.java
+61 -1: (Ljava/lang/String;ZJJ)Ljava/lang/management/MemoryPoolMBean;
+35 -1: java/lang/AssertionStatusDirectives
+23 -1: Declaring class is null
+56 -1: (Ljava/lang/Class;Ljava/lang/Object;Ljava/lang/Object;)I
+12 -1: java/io/File
+41 -1: java/util/ConcurrentModificationException
+47 -1: (Ljava/lang/CharSequence;)Ljava/nio/CharBuffer;
+19 -1: parameterClassCache
+8 -1: US_ASCII
+15 -1: tryMonitorEnter
+22 -1: Ljava/util/Collection;
+67 -1: (Lsun/misc/Signal;Lsun/misc/SignalHandler;)Lsun/misc/SignalHandler;
+27 -1: (Lsun/misc/JavaNioAccess;)V
+9 -1: DigitOnes
+5 -1: write
+31 -1: NF_internalMemberNameEnsureInit
+18 -1: comparableClassFor
+20 -1: defineAnonymousClass
+49 -1: (Ljava/io/InputStream;Lsun/net/ProgressSource;J)V
+31 -1: java/lang/NumberFormatException
+17 -1: remainderUnsigned
+62 -1: <T::Ljava/lang/Comparable<-TT;>;>()Ljava/util/Comparator<TT;>;
+4 -1: Kind
+20 -1: (Ljava/lang/Short;)I
+8 -1: OfDouble
+51 -1: ([Ljava/lang/Object;Ljava/lang/invoke/MethodType;)Z
+22 -1: [Ljava/util/Map$Entry;
+13 -1: instanceClass
+29 -1: ()Ljava/lang/SecurityManager;
+12 -1: isUnmappable
+17 -1: getAllStackTraces
+19 -1: LinkedValueIterator
+7 -1: isDigit
+10 -1: rangeCheck
+89 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;)Ljava/util/List<Ljava/lang/invoke/MemberName;>;
+13 -1: getMethodType
+21 -1: FileOutputStream.java
+22 -1: ()Ljava/text/Collator;
+64 -1: <T:Ljava/lang/Object;>(Ljava/security/PrivilegedAction<TT;>;)TT;
+15 -1: defaultTimeZone
+14 -1: emptySortedMap
+35 -1: (Ljava/util/function/IntConsumer;)V
+45 -1: java/util/Collections$CheckedRandomAccessList
+11 -1: getPriority
+7 -1: signals
+6 -1: Subset
+15 -1: invokeInterface
+16 -1: nameRefsAreLegal
+38 -1: (Ljava/lang/Object;)Ljava/lang/Object;
+37 -1: Ljava/util/Collections$EmptyIterator;
+9 -1: Perf.java
+20 -1: java/math/BigInteger
+38 -1: java/util/WeakHashMap$ValueSpliterator
+71 -1: (Ljava/nio/charset/CodingErrorAction;)Ljava/nio/charset/CharsetEncoder;
+50 -1: (Ljava/lang/invoke/MemberName;Ljava/lang/Object;)V
+21 -1: [Ljava/lang/Class<*>;
+13 -1: getProperties
+63 -1: (Ljava/lang/Class<*>;[B[Ljava/lang/Object;)Ljava/lang/Class<*>;
+65 -1: (Ljava/util/Set<Ljava/lang/Class<*>;>;)[Ljava/lang/reflect/Field;
+21 -1: sun/util/calendar/Era
+21 -1: Ljava/nio/CharBuffer;
+23 -1: (Ljava/lang/Object;JS)V
+24 -1: oracle/jrockit/jfr/VMJFR
+15 -1: access allowed
+34 -1: ()Lsun/util/calendar/CalendarDate;
+97 -1: (Ljava/security/PrivilegedExceptionAction;Ljava/security/AccessControlContext;)Ljava/lang/Object;
+44 -1: ([Ljava/lang/Object;[Ljava/lang/Object;III)V
+48 -1: (Ljava/util/Collection;I)Ljava/util/Spliterator;
+11 -1: SimpleEntry
+63 -1: (Ljava/net/URL;Ljava/net/URLStreamHandler;Ljava/util/HashMap;)V
+8 -1: putFloat
+20 -1: linkToCallSiteMethod
+8 -1: invokers
+35 -1: (J)Lsun/util/calendar/BaseCalendar;
+6 -1: FRENCH
+26 -1: getRawParameterAnnotations
+9 -1: wordIndex
+29 -1: JNI_COPY_FROM_ARRAY_THRESHOLD
+20 -1: sun/nio/cs/Surrogate
+48 -1: (Lsun/misc/JavaSecurityProtectionDomainAccess;)V
+45 -1: (Ljava/lang/ThreadLocal;Ljava/lang/Object;I)V
+3 -1: NST
+14 -1: getHeaderField
+27 -1: (Ljava/util/jar/JarFile;Z)V
+10 -1: findNative
+38 -1: The following can be used with access:
+29 -1: convertCertArrayToSignerArray
+4 -1: .DSA
+12 -1: dependencies
+12 -1: SYNCHRONIZED
+14 -1: x-euc-jp-linux
+28 -1: URLStreamHandlerFactory.java
+11 -1: checkPtypes
+68 -1: (Ljava/io/InputStream;Ljava/lang/Object;Ljava/nio/charset/Charset;)V
+13 -1: addDayOfMonth
+10 -1: isAncestor
+16 -1: entryDislocation
+12 -1: tableSizeFor
+29 -1: (ID)Ljava/lang/StringBuilder;
+19 -1: getLastRuleInstance
+24 -1: getGenericParameterTypes
+8 -1: ,offset=
+37 -1: (Ljava/net/URL;Ljava/lang/String;II)V
+13 -1: UTF_16LE.java
+12 -1: setTimestamp
+31 -1: AtomicReferenceFieldUpdaterImpl
+6 -1: L_URIC
+4 -1: (D)D
+14 -1: DeqSpliterator
+13 -1: LF_INVVIRTUAL
+171 -1: <U:Ljava/lang/Object;W:Ljava/lang/Object;>(Ljava/lang/Class<TU;>;Ljava/lang/Class<TW;>;Ljava/lang/String;)Ljava/util/concurrent/atomic/AtomicReferenceFieldUpdater<TU;TW;>;
+4 -1: (D)I
+22 -1: Ljava/lang/Class<TT;>;
+4 -1: (D)J
+196 -1: (Ljava/lang/invoke/MethodHandles$Lookup;Ljava/lang/String;Ljava/lang/invoke/MethodType;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/Object;)Ljava/lang/Object;
+13 -1: ,transitions=
+30 -1: (Lsun/net/www/MessageHeader;)I
+4 -1: (D)V
+12 -1: segmentShift
+4 -1: (D)Z
+14 -1: Reference.java
+26 -1: [Ljava/lang/reflect/Field;
+26 -1: java/nio/DirectByteBufferR
+31 -1: lambda$thenComparing$36697e65$1
+30 -1: (Lsun/net/www/MessageHeader;)V
+55 -1: No java.nio.charset.StandardCharsets instances for you!
+59 -1: (Ljava/lang/Class<*>;Ljava/lang/Object;Ljava/lang/Object;)I
+19 -1: thenComparingDouble
+31 -1: ()Ljava/lang/invoke/LambdaForm;
+9 -1: getMillis
+21 -1: StandardCharsets.java
+15 -1: postDefineClass
+8 -1: getExtra
+3 -1: box
+10 -1: nextSetBit
+27 -1: java/util/ArrayList$SubList
+43 -1: (Ljava/util/concurrent/ConcurrentHashMap;)V
+52 -1: (Lsun/misc/URLClassPath;)Ljava/net/URLStreamHandler;
+7 -1: putLong
+40 -1: <T::Ljava/lang/Comparable<-TT;>;>([TT;)V
+8 -1: ([DII)[D
+8 -1: ([SIIS)I
+8 -1: argument
+12 -1: linkCallSite
+56 -1: <T:Ljava/lang/Object;>Ljava/lang/ref/WeakReference<TT;>;
+15 -1: returnSlotCount
+68 -1: (Ljava/lang/String;[Ljava/lang/Class<*>;Z)Ljava/lang/reflect/Method;
+20 -1: defaultDisplayLocale
+21 -1: (Ljava/util/Vector;)V
+49 -1: (Lsun/reflect/generics/visitor/TypeTreeVisitor;)V
+12 -1: isAlphabetic
+5 -1: perms
+13 -1: dosToJavaTime
+8 -1: ([SIIS)V
+7 -1: valueOf
+27 -1: Ljava/util/LinkedList$Node;
+41 -1: (Ljava/lang/String;I)Ljava/lang/Class<*>;
+38 -1: ()Ljava/nio/charset/CodingErrorAction;
+4 -1: MASK
+5 -1: Field
+101 -1: (Ljava/lang/Class;Ljava/nio/ByteBuffer;Lsun/reflect/ConstantPool;Ljava/lang/Class;)Ljava/lang/Object;
+56 -1: (Ljava/lang/String;Lsun/misc/Resource;)Ljava/lang/Class;
+9 -1: SURROGATE
+72 -1: (Ljava/lang/invoke/DirectMethodHandle$StaticAccessor;)Ljava/lang/Object;
+19 -1: PARAMETER_MODIFIERS
+48 -1: ([Ljava/lang/Object;II)Ljava/util/stream/Stream;
+56 -1: (TK;TV;Ljava/util/function/BiFunction<-TV;-TV;+TV;>;)TV;
+118 -1: <U:Ljava/lang/Object;>(JLjava/util/function/BiFunction<-TK;-TV;+TU;>;Ljava/util/function/BiFunction<-TU;-TU;+TU;>;)TU;
+29 -1: (Lsun/nio/ch/Interruptible;)V
+45 -1: Ljava/lang/ref/Reference<Ljava/lang/Object;>;
+17 -1: isHeldExclusively
+3 -1: NYI
+15 -1: getByteVolatile
+20 -1: compareAndSwapObject
+29 -1: (Z)[Ljava/lang/reflect/Field;
+7 -1: ([SII)V
+13 -1: toLanguageTag
+18 -1: StreamEncoder.java
+25 -1: (IF)Ljava/nio/ByteBuffer;
+18 -1: afterNodeInsertion
+11 -1: accessOrder
+60 -1: Lsun/reflect/annotation/TypeAnnotation$TypeAnnotationTarget;
+20 -1: META-INF/MANIFEST.MF
+18 -1: getSuperInterfaces
+26 -1: (Ljava/nio/ByteBuffer;IZ)C
+26 -1: (Ljava/nio/ByteBuffer;IZ)D
+9 -1: PROTECTED
+18 -1: not visible from
+26 -1: java/lang/RuntimeException
+26 -1: (Ljava/nio/ByteBuffer;IZ)F
+20 -1: java/net/FileNameMap
+15 -1: insertArguments
+8 -1: diagprop
+26 -1: (Ljava/nio/ByteBuffer;IZ)I
+26 -1: (Ljava/nio/ByteBuffer;IZ)J
+20 -1: createContentHandler
+11 -1: getProtocol
+26 -1: (Ljava/nio/ByteBuffer;IZ)S
+33 -1: Ljava/lang/NoSuchMethodException;
+19 -1: entry name too long
+40 -1: java/util/jar/JarVerifier$VerifierStream
+6 -1: server
+7 -1: OCTOBER
+26 -1: sun/invoke/util/VerifyType
+6 -1: domain
+9 -1: getUnsafe
+5 -1: ([Z)I
+4 -1: cons
+42 -1: ()Ljava/lang/ReflectiveOperationException;
+4 -1: byte
+29 -1: java/util/function/BiConsumer
+24 -1: getJavaUtilZipFileAccess
+37 -1: ([Ljava/lang/Object;)Ljava/util/List;
+27 -1: timeout can not be negative
+62 -1: Ljava/util/Map<Ljava/io/InputStream;Ljava/util/zip/Inflater;>;
+16 -1: getOurStackTrace
+34 -1: (J)Ljava/lang/ref/Reference<+TT;>;
+50 -1: Lsun/reflect/generics/repository/MethodRepository;
+20 -1: MIN_BYTE_BUFFER_SIZE
+3 -1: buf
+13 -1: getAttributes
+6 -1: GERMAN
+38 -1: java/security/NoSuchAlgorithmException
+20 -1: Direct buffer memory
+6 -1: (IIZ)V
+27 -1: JVMTI_THREAD_STATE_RUNNABLE
+26 -1: [Ljava/io/File$PathStatus;
+36 -1: (Ljava/util/List;Ljava/lang/Class;)V
+13 -1: JarIndex.java
+34 -1: java/lang/Character$CharacterCache
+8 -1: csIBM857
+10 -1: LineReader
+28 -1: Ljava/lang/RuntimeException;
+30 -1: ()Ljava/util/Enumeration<TV;>;
+12 -1: getSeparator
+124 -1: (Ljava/security/PrivilegedAction;Ljava/security/AccessControlContext;Ljava/security/AccessControlContext;)Ljava/lang/Object;
+97 -1: Ljava/util/Map<Ljava/lang/Integer;Ljava/lang/ref/WeakReference<Ljava/nio/charset/CoderResult;>;>;
+21 -1: ConstantCallSite.java
+40 -1: sun/util/locale/provider/LocaleResources
+101 -1: <U::Ljava/lang/Comparable<-TU;>;>(Ljava/util/function/Function<-TT;+TU;>;)Ljava/util/Comparator<TT;>;
+4 -1: copy
+23 -1: sun/security/util/Debug
+10 -1: isAbsolute
+34 -1: (Ljava/lang/invoke/MethodHandle;)V
+34 -1: (Ljava/lang/invoke/MethodHandle;)Z
+48 -1: ()[Ljava/util/concurrent/ConcurrentHashMap$Node;
+34 -1: (Lsun/reflect/LangReflectAccess;)V
+8 -1: csIBM862
+8 -1: csIBM866
+64 -1: java/util/concurrent/ConcurrentHashMap$MapReduceKeysToDoubleTask
+39 -1: No java.util.Objects instances for you!
+68 -1: (Ljava/util/PrimitiveIterator$OfInt;JI)Ljava/util/Spliterator$OfInt;
+19 -1: Illegal class name
+24 -1: uncaughtExceptionHandler
+12 -1: runFinalizer
+23 -1: java/io/FileInputStream
+41 -1: (Ljava/lang/Class<*>;Ljava/lang/String;)V
+98 -1: (Ljava/util/HashMap$Node<TK;TV;>;Ljava/util/HashMap$Node<TK;TV;>;)Ljava/util/HashMap$Node<TK;TV;>;
+30 -1: java/nio/charset/CoderResult$1
+20 -1: SourceDebugExtension
+30 -1: java/nio/charset/CoderResult$2
+69 -1: ([Ljava/security/ProtectionDomain;[Ljava/security/ProtectionDomain;)Z
+14 -1: 1.8.0-internal
+16 -1: ReduceValuesTask
+13 -1: toLowerString
+14 -1: newPrintStream
+13 -1: unicodelittle
+19 -1: getClassLoadingLock
+9 -1: DigitTens
+80 -1: (Ljava/lang/Class<*>;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodType;
+12 -1: sun_eu_greek
+21 -1: getBootstrapClassPath
+9 -1: volatile
+15 -1: UnmodifiableMap
+21 -1: enumConstantDirectory
+10 -1: getContent
+4 -1: cosh
+74 -1: (Ljava/lang/String;Ljava/lang/String;Ljava/lang/String;)Ljava/util/Locale;
+11 -1: ([JII[JII)V
+28 -1: java/lang/reflect/Executable
+17 -1: MapReduceKeysTask
+6 -1: isOpen
+17 -1: AnnotationDefault
+17 -1: Already connected
+27 -1: (Lsun/misc/JavaNetAccess;)V
+34 -1: ([BILjava/nio/charset/Charset;Z)[B
+55 -1: Ljava/lang/invoke/DirectMethodHandle$EnsureInitialized;
+8 -1: Set.java
+10 -1: DEAD_ENTRY
+7 -1: nextInt
+3 -1: wtb
+23 -1: java/util/Collections$1
+86 -1: (Lsun/reflect/generics/factory/GenericsFactory;)Lsun/reflect/generics/visitor/Reifier;
+23 -1: java/util/Collections$2
+23 -1: java/util/Collections$3
+18 -1: DoubleCumulateTask
+22 -1: skip value is negative
+85 -1: (Ljava/io/InputStream;Ljava/lang/Object;Ljava/lang/String;)Lsun/nio/cs/StreamDecoder;
+5 -1: \\[\\]$
+34 -1: Ljava/util/NoSuchElementException;
+3 -1: NaN
+30 -1: sun/util/calendar/CalendarDate
+10 -1: V_Constant
+20 -1: java/lang/Comparable
+9 -1: text/html
+20 -1: -9223372036854775808
+20 -1: DataInputStream.java
+20 -1: Member defaults:
+35 -1: Ljava/lang/ref/ReferenceQueue$Lock;
+8 -1: getBytes
+17 -1: CodePointIterator
+11 -1: Signal.java
+19 -1: javaHomePrefixCache
+12 -1: replaceFirst
+37 -1: Ljava/lang/IndexOutOfBoundsException;
+39 -1: (Ljava/lang/String;ZI)Ljava/lang/Class;
+21 -1: initSystemClassLoader
+28 -1: America/Indiana/Indianapolis
+47 -1: (Ljava/security/Permission;Ljava/lang/Object;)V
+27 -1: java/net/URISyntaxException
+21 -1: createSecurityManager
+7 -1: suspend
+12 -1: L_UNRESERVED
+17 -1: checkMemberAccess
+12 -1: CoreCounters
+19 -1: java/net/HttpCookie
+8 -1: isGetter
+17 -1: setDaylightSaving
+27 -1: java.launcher.javafx.error1
+53 -1: java/util/concurrent/ConcurrentHashMap$CollectionView
+16 -1: readUnsignedByte
+47 -1: (Ljava/lang/String;)Ljava/net/URLStreamHandler;
+40 -1: (Z)[Ljava/lang/reflect/Constructor<TT;>;
+14 -1: javaLangAccess
+5 -1: apply
+8 -1: getFloat
+15 -1: getD3DAvailable
+25 -1: startLocalManagementAgent
+7 -1: RUNTIME
+22 -1: LocalVariableTypeTable
+8 -1: doOutput
+16 -1: CheckedSortedSet
+10 -1: zoneOffset
+64 -1: (Ljava/security/Permission;)Ljava/security/PermissionCollection;
+13 -1: hasUnresolved
+13 -1: user.language
+11 -1: getDoubleAt
+14 -1: getQueueLength
+37 -1: java/nio/DirectByteBuffer$Deallocator
+6 -1: ASHIFT
+9 -1: checkPath
+80 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;Ljava/lang/Class;)V
+6 -1: CENEXT
+16 -1: doubleToLongBits
+11 -1: copyToArray
+9 -1: copyField
+36 -1: ()Lsun/util/calendar/Gregorian$Date;
+53 -1: (ILjava/lang/Object;)Ljava/util/HashMap$Node<TK;TV;>;
+44 -1: (TK;TV;Ljava/lang/ref/ReferenceQueue<TV;>;)V
+35 -1: java/util/Collections$EmptyIterator
+38 -1: sealing violation: can't seal package
+37 -1: (Ljava/util/Queue;Ljava/lang/Class;)V
+129 -1: (Ljava/lang/Class<*>;Ljava/lang/String;[Ljava/lang/Class<*>;Ljava/lang/Class<*>;[Ljava/lang/Class<*>;IILjava/lang/String;[B[B[B)V
+18 -1: HashMapSpliterator
+8 -1: putShort
+23 -1: (Ljava/lang/Object;II)V
+7 -1: GERMANY
+13 -1: toTitleString
+102 -1: (Ljava/util/ArrayPrefixHelpers$CumulateTask;Ljava/util/function/BinaryOperator;[Ljava/lang/Object;II)V
+44 -1: ([Ljava/lang/Object;)Ljava/util/Spliterator;
+6 -1: unused
+25 -1: java/net/URLClassLoader$1
+25 -1: java/net/URLClassLoader$2
+25 -1: java/net/URLClassLoader$3
+25 -1: java/net/URLClassLoader$4
+12 -1: getFixedDate
+25 -1: java/net/URLClassLoader$5
+4 -1: time
+25 -1: java/net/URLClassLoader$6
+25 -1: java/net/URLClassLoader$7
+14 -1: historicalName
+12 -1: normalizeKey
+13 -1: MIN_SURROGATE
+41 -1: java/nio/charset/CharacterCodingException
+18 -1: java/lang/Iterable
+8 -1: ([JII)[J
+103 -1: Ljava/util/Map<Ljava/lang/Class<+Ljava/lang/annotation/Annotation;>;Ljava/lang/annotation/Annotation;>;
+18 -1: putBooleanVolatile
+5 -1: Entry
+11 -1: CounterCell
+12 -1: monitorEnter
+10 -1: skipBuffer
+15 -1: hasMoreElements
+24 -1: newIllegalStateException
+24 -1: Ljava/lang/LinkageError;
+12 -1: getEntryFlag
+44 -1: (Ljava/lang/Throwable$PrintStreamOrWriter;)V
+18 -1: java/nio/IntBuffer
+17 -1: jdk_minor_version
+28 -1: DIRECTIONALITY_RIGHT_TO_LEFT
+15 -1: getAndSetObject
+7 -1: sizeCtl
+15 -1: Ljava/util/Set;
+32 -1: (I)Ljava/lang/invoke/LambdaForm;
+16 -1: runFinalization0
+30 -1: Ljava/lang/reflect/Executable;
+15 -1: compareUnsigned
+5 -1: nkeys
+31 -1: Ljava/nio/channels/FileChannel;
+40 -1: sun/reflect/generics/tree/ClassSignature
+22 -1: (Ljava/lang/Object;I)B
+22 -1: (Ljava/lang/Object;I)C
+22 -1: (Ljava/lang/Object;I)D
+7 -1: JANUARY
+30 -1: newGetIllegalArgumentException
+22 -1: (Ljava/lang/Object;I)F
+22 -1: (Ljava/lang/Object;I)I
+22 -1: (Ljava/lang/Object;I)J
+28 -1: generateNamedFunctionInvoker
+38 -1: (Ljava/lang/String;)Ljava/time/ZoneId;
+19 -1: lambda$codePoints$2
+4 -1: Null
+7 -1: setEras
+15 -1: lambda$chars$15
+14 -1: CollectionView
+24 -1: (C)Ljava/io/PrintStream;
+22 -1: (Ljava/lang/Object;I)S
+96 -1: (Ljava/security/AccessControlContext;Lsun/security/util/Debug;Ljava/security/ProtectionDomain;)V
+17 -1: getJulianCalendar
+22 -1: (Ljava/lang/Object;I)V
+17 -1: getMethodAccessor
+9 -1: not owner
+35 -1: java/lang/reflect/ParameterizedType
+15 -1: ValueCollection
+22 -1: (Ljava/lang/Object;I)Z
+4 -1: utf8
+5 -1: CHINA
+9 -1: sprintf0d
+18 -1: java/nio/file/Path
+35 -1: DIRECTIONALITY_RIGHT_TO_LEFT_ARABIC
+30 -1: URI has an authority component
+43 -1: (Ljava/lang/Object;)Ljava/util/Spliterator;
+15 -1: <no principals>
+62 -1: (Lsun/util/locale/BaseLocale$Key;)Lsun/util/locale/BaseLocale;
+6 -1: ([ZZ)V
+10 -1: getContext
+12 -1: content-type
+99 -1: (Ljava/lang/Object;Ljava/lang/Object;Ljava/lang/ref/ReferenceQueue;ILjava/util/WeakHashMap$Entry;)V
+51 -1: (Ljava/util/concurrent/ConcurrentHashMap<TK;TV;>;)V
+27 -1: Invalid constant pool index
+20 -1: getUnicodeLocaleType
+43 -1: Ljava/nio/charset/CharacterCodingException;
+113 -1: (Ljava/net/URL;Ljava/net/URLStreamHandler;Ljava/util/HashMap<Ljava/lang/String;Lsun/misc/URLClassPath$Loader;>;)V
+56 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/util/Locale;
+24 -1: Lsun/misc/SignalHandler;
+8 -1: readlink
+125 -1: (Ljava/nio/file/WatchService;[Ljava/nio/file/WatchEvent$Kind<*>;[Ljava/nio/file/WatchEvent$Modifier;)Ljava/nio/file/WatchKey;
+11 -1: initStatics
+15 -1: unmappableCache
+13 -1: fixMethodType
+25 -1: sun/net/www/MessageHeader
+3 -1: cdt
+27 -1: Ljava/util/Locale$Category;
+59 -1: (ILjava/lang/Object;Ljava/lang/Object;ZZ)Ljava/lang/Object;
+8 -1: Accessor
+14 -1: mapLibraryName
+54 -1: (Lsun/misc/URLClassPath$JarLoader;)Lsun/misc/JarIndex;
+24 -1: ZoneOffsetTransitionRule
+7 -1: getChar
+3 -1: cee
+25 -1: MapReduceValuesToLongTask
+20 -1: declaredPublicFields
+44 -1: (Ljava/lang/ClassLoader;Ljava/lang/String;)J
+13 -1: removeElement
+20 -1: Ljava/nio/ByteOrder;
+8 -1: parallel
+67 -1: (Ljava/lang/reflect/Constructor;Lsun/reflect/ConstructorAccessor;)V
+22 -1: java/util/zip/ZipCoder
+8 -1: ([ZIIZ)V
+45 -1: (Ljava/lang/String;Ljava/lang/CharSequence;)Z
+8 -1: february
+40 -1: java/util/zip/ZipFile$ZipFileInputStream
+47 -1: java/nio/charset/Charset$ExtendedProviderHolder
+13 -1: IEEEremainder
+15 -1: sun/misc/Perf$1
+9 -1: abstract
+20 -1: ()Ljava/time/ZoneId;
+7 -1: ONE_DAY
+92 -1: (Ljava/util/concurrent/ConcurrentHashMap$Node;)Ljava/util/concurrent/ConcurrentHashMap$Node;
+45 -1: (Ljava/util/ListIterator;I)Ljava/lang/Object;
+16 -1: Buffer size <= 0
+9 -1: checkName
+11 -1: getJarEntry
+20 -1: Replacement too long
+53 -1: (Ljava/lang/String;)Ljava/nio/charset/CharsetDecoder;
+12 -1: isWhitespace
+15 -1: csISOLatinGreek
+70 -1: (Ljava/lang/reflect/Constructor<*>;Lsun/reflect/ConstructorAccessor;)V
+20 -1: TypeAnnotationTarget
+3 -1: No
+27 -1: Lsun/reflect/FieldAccessor;
+12 -1: doPrivileged
+83 -1: (JLjava/util/function/ToIntFunction<-TV;>;ILjava/util/function/IntBinaryOperator;)I
+60 -1: (Ljava/nio/file/attribute/FileTime;)Ljava/util/zip/ZipEntry;
+11 -1: changeEntry
+18 -1: MessageHeader.java
+51 -1: ([Ljava/lang/String;Ljava/util/Map;)Ljava/util/Map;
+9 -1: castEntry
+16 -1: ACCESS_MODIFIERS
+11 -1: newInstance
+24 -1: lastIndexOfSupplementary
+13 -1: JZENTRY_EXTRA
+5 -1: LONGS
+7 -1: domain
+16 -1: protocolPathProp
+21 -1: java/util/Hashtable$1
+10 -1: isSameDate
+23 -1: (I)Ljava/nio/file/Path;
+33 -1: java/util/PrimitiveIterator$OfInt
+7 -1: ([II)[I
+8 -1: variant=
+29 -1: (Ljava/util/Collection<*>;Z)Z
+38 -1: already loaded in another classloader
+10 -1: setSeconds
+9 -1: makeShort
+59 -1: ClassLoader.findLibrary failed to return an absolute path:
+26 -1: java/util/jar/JarException
+9 -1: setCharAt
+13 -1: initCauseFrom
+13 -1: val$fieldName
+18 -1: MIN_HIGH_SURROGATE
+60 -1: (Lsun/util/calendar/ZoneInfoFile$ZoneOffsetTransitionRule;)B
+25 -1: getDayOfWeekFromFixedDate
+10 -1: maybeReBox
+9 -1: getHandle
+60 -1: (Lsun/util/calendar/ZoneInfoFile$ZoneOffsetTransitionRule;)I
+59 -1: ([Ljava/lang/Class<*>;)Ljava/lang/reflect/Constructor<TT;>;
+3 -1: cis
+11 -1: getIssuerDN
+9 -1: codebase=
+80 -1: (ILjava/lang/invoke/BoundMethodHandle$SpeciesData;)Ljava/lang/invoke/LambdaForm;
+29 -1: addThreadDumpForSynchronizers
+6 -1: FRANCE
+77 -1: <T:Ljava/lang/Object;U:Ljava/lang/Object;>([TU;ILjava/lang/Class<+[TT;>;)[TT;
+45 -1: <T:Ljava/lang/Object;>()Ljava/util/List<TT;>;
+16 -1: putFloatVolatile
+34 -1: (Ljava/lang/Class;)Ljava/util/Map;
+28 -1: ()Ljava/security/Permission;
+28 -1: (Ljava/lang/CharSequence;I)I
+51 -1: ()Ljava/util/Enumeration<Ljava/util/jar/JarEntry;>;
+25 -1: (II)Ljava/nio/ByteBuffer;
+20 -1: BasicPermission.java
+5 -1: isNaN
+48 -1: (Ljava/lang/Throwable;)Ljava/lang/InternalError;
+10 -1: ONE_MINUTE
+55 -1: (Ljava/lang/invoke/DirectMethodHandle$StaticAccessor;)J
+13 -1: DAYS_IN_MONTH
+7 -1: domains
+10 -1: isUnshared
+58 -1: Ljava/lang/Number;Ljava/lang/Comparable<Ljava/lang/Long;>;
+47 -1: (Ljava/util/List;)Ljava/security/cert/CertPath;
+28 -1: ()Ljava/util/Enumeration<*>;
+34 -1: sun/misc/Launcher$ExtClassLoader$1
+22 -1: (CLjava/lang/Object;)Z
+64 -1: Ljava/lang/ref/WeakReference<Ljava/nio/charset/CharsetDecoder;>;
+7 -1: ENGLISH
+27 -1: (Ljava/util/zip/Inflater;)V
+24 -1: makeArrayElementAccessor
+72 -1: (Ljava/lang/Class<*>;[Ljava/lang/Class<*>;)Ljava/lang/invoke/MethodType;
+48 -1: (Ljava/util/jar/JarFile;)Ljava/util/Enumeration;
+48 -1: (Ljava/lang/Class;)Ljava/lang/invoke/MethodType;
+15 -1: getNthDayOfWeek
+16 -1: printHelpMessage
+15 -1: getAbsoluteFile
+9 -1: OPEN_READ
+19 -1: willGMTOffsetChange
+28 -1: (Ljava/util/LinkedHashMap;)V
+37 -1: java/security/AllPermissionCollection
+5 -1: [id="
+34 -1: java/lang/invoke/BoundMethodHandle
+31 -1: ()Ljava/security/cert/CertPath;
+50 -1: java/util/ArraysParallelSortHelpers$FJShort$Sorter
+14 -1: StaticAccessor
+22 -1: synchronizedCollection
+53 -1: ([Ljava/io/File;)Ljava/security/AccessControlContext;
+37 -1: (Ljava/lang/Class;Ljava/lang/Class;)Z
+14 -1: codePointCount
+13 -1: is param at
+37 -1: Ljava/lang/invoke/MemberName$Factory;
+20 -1: annotationDataOffset
+31 -1: protocol doesn't support output
+11 -1: hostAddress
+12 -1: ,dstSavings=
+35 -1: java.lang.Integer.IntegerCache.high
+15 -1: ParallelLoaders
+48 -1: (Ljava/util/Locale;)Lsun/util/locale/BaseLocale;
+8 -1: getSize0
+22 -1: checkCreateClassLoader
+8 -1: transfer
+32 -1: (Lsun/misc/JavaSecurityAccess;)V
+26 -1: ()Ljava/net/URLConnection;
+3 -1: cmp
+9 -1: setMillis
+34 -1: sun/util/calendar/AbstractCalendar
+19 -1: getDirectBufferPool
+7 -1: ([FII)V
+28 -1: ([C)Ljava/lang/StringBuffer;
+54 -1: (Ljava/lang/Class<*>;)Ljava/security/ProtectionDomain;
+26 -1: (Ljava/nio/ByteBuffer;IF)V
+11 -1: discardMark
+71 -1: (Ljava/lang/Class;)Lsun/util/locale/provider/LocaleServiceProviderPool;
+30 -1: java/io/UTFDataFormatException
+53 -1: (Ljava/nio/CharBuffer;)Ljava/nio/charset/CoderResult;
+48 -1: java/util/concurrent/ConcurrentHashMap$Traverser
+5 -1: ([F)I
+37 -1: (IC)Ljava/lang/AbstractStringBuilder;
+27 -1: Ljava/util/jar/JarVerifier;
+22 -1: java/util/Spliterators
+32 -1: java/lang/invoke/MutableCallSite
+20 -1: java/io/Serializable
+5 -1: ([F)V
+35 -1: (Ljava/security/ProtectionDomain;)V
+33 -1: ()Ljava/lang/ref/Reference<+TT;>;
+10 -1: unlinkLast
+6 -1: (JSZ)V
+8 -1: isStatic
+14 -1: subclassAudits
+23 -1: (Ljava/lang/String;)TT;
+17 -1: java.awt.headless
+9 -1: <Unknown>
+39 -1: Lsun/util/locale/LocaleSyntaxException;
+8 -1: location
+3 -1: cos
+27 -1: createGarbageCollectorMBean
+20 -1: MAX_MH_INVOKER_ARITY
+75 -1: (Ljava/nio/ByteBuffer;Ljava/nio/CharBuffer;Z)Ljava/nio/charset/CoderResult;
+14 -1: Cloneable.java
+50 -1: (Lsun/reflect/DelegatingConstructorAccessorImpl;)V
+26 -1: sun/nio/ch/FileChannelImpl
+51 -1: (Ljava/lang/Class;Ljava/lang/reflect/Constructor;)V
+18 -1: Unknown byte order
+28 -1: ()[Lsun/invoke/util/Wrapper;
+21 -1: getReadClassBytesTime
+64 -1: (Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodTypeForm;
+11 -1: setDelegate
+20 -1: (Ljava/util/List;)[C
+7 -1: usemmap
+22 -1: (CC)Ljava/lang/String;
+34 -1: sun/invoke/util/BytecodeDescriptor
+21 -1: getJavaSecurityAccess
+53 -1: (Ljava/nio/ByteBuffer;)Ljava/nio/charset/CoderResult;
+7 -1: ibm-737
+19 -1: (Ljava/lang/Enum;)I
+4 -1: rint
+11 -1: Constructor
+9 -1: arraycopy
+35 -1: ([D)Ljava/util/stream/DoubleStream;
+13 -1: comparingLong
+40 -1: <T:Ljava/lang/Object;>Ljava/lang/Object;
+23 -1: OutputStreamWriter.java
+8 -1: getShort
+17 -1: CLASSPATH_LASTOCC
+13 -1: createNewFile
+14 -1: internalValues
+34 -1: Ljava/lang/IllegalAccessException;
+23 -1: (JILjava/lang/Object;)V
+27 -1: sun.misc.URLClassPath.debug
+45 -1: [Ljava/lang/ThreadLocal$ThreadLocalMap$Entry;
+35 -1: ()Lsun/reflect/ConstructorAccessor;
+12 -1: classEnabled
+23 -1: cachedFixedDateNextJan1
+48 -1: (Ljava/util/Locale$LocaleKey;)Ljava/util/Locale;
+26 -1: (Ljava/lang/ThreadGroup;)V
+7 -1: setErr0
+6 -1: CENFLG
+26 -1: (Ljava/lang/ThreadGroup;)Z
+18 -1: sun/misc/MetaIndex
+3 -1: crc
+34 -1: (Z)Ljava/lang/invoke/MethodHandle;
+12 -1: replaceNames
+15 -1: java/util/Stack
+57 -1: Ljava/util/Vector<Ljava/lang/ClassLoader$NativeLibrary;>;
+89 -1: (JLjava/util/function/ToDoubleFunction<-TV;>;DLjava/util/function/DoubleBinaryOperator;)D
+24 -1: permission can't be null
+22 -1: Unable to connect to:
+44 -1: (Ljava/nio/ByteBuffer;)Ljava/nio/ByteBuffer;
+14 -1: floatToIntBits
+11 -1: getLastRule
+6 -1: EXTCRC
+26 -1: java/net/InetSocketAddress
+36 -1: (Lsun/misc/URLClassPath$JarLoader;)V
+27 3: sun/launcher/LauncherHelper
+8 -1: ecma-118
+49 -1: (Ljava/net/URL;Ljava/lang/String;)[Ljava/net/URL;
+13 -1: hashCodeValue
+5 -1: CESU8
+21 -1: appendVmSelectMessage
+13 -1: bindImmediate
+12 -1: closeLoaders
+16 -1: emptySpliterator
+28 -1: (J)Ljava/time/LocalDateTime;
+22 -1: [Ljava/lang/Character;
+5 -1: certs
+6 -1: (null)
+25 -1: java/io/ObjectInputStream
+27 -1: ([Ljava/lang/ThreadGroup;)I
+3 -1: cst
+3 -1: csu
+20 -1: java/nio/ShortBuffer
+53 -1: (Ljava/lang/ClassValue;Ljava/lang/ClassValue$Entry;)V
+4 -1: (Z)I
+24 -1: Ljava/io/FileDescriptor;
+6 -1: cclass
+10 -1: , profile
+39 -1: (Ljava/lang/String;)Ljava/lang/Process;
+4 -1: (Z)V
+5 -1: toURI
+24 -1: ConstructorAccessor.java
+5 -1: toURL
+18 -1: addAllIfNotPresent
+4 -1: (Z)Z
+5 -1: parse
+11 -1: isPrimitive
+42 -1: (Ljava/io/File;)Ljava/lang/ProcessBuilder;
+36 -1: (Ljava/util/Date;)Ljava/lang/String;
+23 -1: getFormalTypeParameters
+13 -1: Resource.java
+7 -1: ibm-775
+6 -1: isEnum
+24 -1: setJavaUtilZipFileAccess
+21 -1: \t[CIRCULAR REFERENCE:
+51 -1: (Ljava/lang/CharSequence;)Ljava/util/regex/Matcher;
+24 -1: (I)Ljava/nio/ByteBuffer;
+53 -1: sun/reflect/generics/repository/GenericDeclRepository
+3 -1: xor
+17 -1: invokeBasicMethod
+27 -1: java/lang/invoke/LambdaForm
+99 -1: (Ljava/util/jar/Manifest;Ljava/util/jar/JarEntry;Ljava/io/InputStream;Ljava/util/jar/JarVerifier;)V
+46 -1: Lsun/reflect/generics/factory/GenericsFactory;
+37 -1: sun/misc/Launcher$BootClassPathHolder
+10 -1: BindCaller
+24 -1: java/lang/reflect/Member
+32 -1: java/lang/management/ThreadState
+5 -1: (IB)V
+21 -1: RuntimeException.java
+5 -1: ended
+17 -1: java/util/TreeSet
+7 -1: : no !/
+16 -1: java/util/Vector
+9 -1: nextAfter
+22 -1: Ljava/lang/Deprecated;
+20 -1: requestedCharsetName
+37 -1: ([JIII)Ljava/util/Spliterator$OfLong;
+14 -1: internArgument
+11 -1: getTimeZone
+10 -1: isValidKey
+11 -1: LAST_RESULT
+43 -1: sun/reflect/annotation/TypeAnnotationParser
+13 -1: encodedInPath
+52 -1: (Ljava/security/PrivilegedAction;)Ljava/lang/Object;
+4 -1: LL_L
+34 -1: java/nio/charset/CodingErrorAction
+10 -1: copyFields
+11 -1: getConstant
+9 -1: threshold
+13 -1: aliases_UTF_8
+27 -1: (Ljava/util/ArrayDeque;II)V
+29 -1: Ljava/lang/ref/SoftReference;
+19 -1: indexedBinarySearch
+11 -1: containsKey
+81 -1: ([Ljava/lang/ClassValue$Entry;Ljava/lang/ClassValue;)Ljava/lang/ClassValue$Entry;
+86 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/Class<*>;II)Ljava/lang/invoke/MethodHandle;
+15 -1: cannot convert
+25 -1: getSystemResourceAsStream
+46 -1: (Ljava/util/Properties;)Ljava/util/Properties;
+12 -1: reverseOrder
+16 -1: getSystemPackage
+8 -1: ([SII)[S
+19 -1: makeAccessException
+100 -1: <U:Ljava/lang/Object;>(JLjava/util/function/Function<-TK;+TU;>;Ljava/util/function/Consumer<-TU;>;)V
+39 -1: ([Ljava/lang/Class;I)[Ljava/lang/Class;
+19 -1: Ljava/lang/Boolean;
+6 -1: Hidden
+47 -1: java/lang/invoke/MethodHandleImpl$ArrayAccessor
+5 -1: APRIL
+8 -1: emptySet
+11 -1: getCombiner
+58 -1: (Ljava/lang/String;I[Ljava/lang/invoke/LambdaForm$Name;I)V
+24 -1: java.system.class.loader
+14 -1: Can't handle:
+16 -1: isNullConversion
+38 -1: ()Ljava/util/HashMap$TreeNode<TK;TV;>;
+29 -1: referenceKindIsConsistentWith
+11 -1: flushBuffer
+8 -1: putField
+27 -1: ()Ljava/security/PublicKey;
+53 -1: ()Ljava/util/stream/Stream<Ljava/util/jar/JarEntry;>;
+10 -1: pathToURLs
+26 -1: throwIllegalStateException
+10 -1: markedChar
+14 -1: isNativeMethod
+36 -1: (I)Ljava/lang/AbstractStringBuilder;
+54 -1: java/util/concurrent/ConcurrentHashMap$ReservationNode
+45 -1: Lsun/misc/JavaSecurityProtectionDomainAccess;
+62 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;Ljava/lang/Object;I)V
+7 -1: subList
+8 -1: UTF_32BE
+6 -1: U_None
+50 -1: sun/reflect/generics/repository/AbstractRepository
+62 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;Ljava/lang/Object;I)Z
+43 -1: sun/net/www/protocol/file/FileURLConnection
+13 -1: setZoneOffset
+43 -1: Underlying input stream returned zero bytes
+54 -1: [a-zA-Z_$][a-zA-Z0-9_$]*([.][a-zA-Z_$][a-zA-Z0-9_$]*)*
+13 -1: containsValue
+44 -1: (Ljava/nio/CharBuffer;)Ljava/nio/ByteBuffer;
+25 -1: isNullReferenceConversion
+38 -1: Ljava/util/Vector<Ljava/lang/String;>;
+6 -1: toFile
+7 -1: getSlot
+17 -1: (Ljava/net/URI;)V
+32 -1: java.security.cert.Certificate:
+24 -1: ()Lsun/misc/PerfCounter;
+11 -1: Asia/Hebron
+16 -1: createMemoryPool
+10 -1: addToCache
+29 -1: Ljava/lang/invoke/DontInline;
+39 -1: java/lang/ref/Finalizer$FinalizerThread
+58 -1: (Ljava/lang/Class;)Lsun/reflect/generics/scope/ClassScope;
+20 -1: getBooleanAttributes
+15 -1: parallelLockMap
+34 -1: java/util/Vector$VectorSpliterator
+21 -1: createMemoryPoolMBean
+15 -1: no content-type
+41 -1: Couldn't find 3-letter language code for
+5 -1: slash
+34 -1: Ljava/lang/annotation/ElementType;
+8 -1: isSetter
+26 -1: (ZLjava/lang/String;JJJZ)V
+6 -1: GMT_ID
+73 -1: ()[Ljava/lang/reflect/TypeVariable<Ljava/lang/reflect/Constructor<TT;>;>;
+56 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/lang/Object;
+32 -1: (Ljava/util/Set;)Ljava/util/Set;
+4 -1: stop
+62 -1: (Ljava/lang/String;IILjava/lang/String;I)Ljava/nio/ByteBuffer;
+11 -1: genericInfo
+11 -1: listToArray
+26 -1: ()Ljava/util/jar/Manifest;
+13 -1: putOrderedInt
+5 -1: flush
+13 -1: ArrayAccessor
+4 -1: Name
+95 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;[Ljava/util/concurrent/ConcurrentHashMap$Node;)V
+68 -1: (Ljava/lang/Class;Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle;
+23 -1: java/lang/ref/Reference
+37 -1: (Ljava/nio/file/attribute/FileTime;)J
+14 -1: MIN_CODE_POINT
+9 -1: ISO8859-1
+9 -1: ISO8859-2
+9 -1: ISO8859-5
+34 -1: ([CILjava/nio/charset/Charset;Z)[C
+9 -1: ISO8859-9
+9 -1: getUTF8At
+12 -1: java/net/URI
+67 -1: (Ljava/io/DataInput;Ljava/lang/String;)Lsun/util/calendar/ZoneInfo;
+22 -1: ListCompositionPattern
+67 -1: (Ljava/lang/String;[BIILjava/security/CodeSource;)Ljava/lang/Class;
+3 1: xxx
+12 -1: java/net/URL
+27 -1: Can't overwrite cause with
+30 -1: sun/util/locale/BaseLocale$Key
+22 -1: forkSecondaryFinalizer
+23 -1: java/security/Principal
+8 -1: makeSite
+17 -1: NEGATIVE_INFINITY
+12 -1: addUnstarted
+12 -1: internalForm
+9 -1: cellsBusy
+23 -1: (Ljava/lang/Object;IJ)V
+13 -1: getParameters
+6 -1: H_PATH
+10 -1: L_REG_NAME
+139 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/AbstractMap<TK;TV;>;Ljava/util/Map<TK;TV;>;Ljava/lang/Cloneable;Ljava/io/Serializable;
+6 -1: latin0
+10 -1: addSeconds
+6 -1: latin1
+6 -1: latin2
+6 -1: latin4
+6 -1: latin5
+17 -1: getWaitingThreads
+6 -1: latin9
+21 -1: java/util/Comparators
+10 -1: trimToSize
+96 -1: <T:Ljava/lang/Object;>(Ljava/util/Collection<TT;>;Ljava/lang/Object;)Ljava/util/Collection<TT;>;
+43 -1: ([JLjava/util/function/IntToLongFunction;)V
+23 -1: GET_COMBINER_PERMISSION
+20 -1: lambda$replaceAll$14
+5 -1: KOREA
+20 -1: getJvmSpecialVersion
+9 -1: dumpStack
+16 -1: CACHE_LOAD_LIMIT
+43 -1: GSS LoginConfigImpl debugging
+26 -1: (DLjava/lang/Appendable;)V
+8 -1: forName0
+35 -1: java/lang/ClassLoader$NativeLibrary
+46 -1: java/util/concurrent/ConcurrentHashMap$Segment
+24 -1: getDeclaredAnnotationMap
+89 -1: java/util/concurrent/atomic/AtomicReferenceFieldUpdater$AtomicReferenceFieldUpdaterImpl$1
+20 -1: java_runtime_version
+26 -1: java/util/stream/IntStream
+16 -1: Ljava/io/Writer;
+69 -1: ()Ljava/util/SortedMap<Ljava/lang/String;Ljava/nio/charset/Charset;>;
+15 -1: getClassLoader0
+6 -1: x86_64
+11 -1: isInterface
+15 -1: MODIFIER_SYMBOL
+44 -1: Note: Separate multiple options with a comma
+9 -1: recursive
+19 -1: java/nio/CharBuffer
+8 -1: capacity
+17 -1: validateMainClass
+50 -1: (Ljava/util/Set;Ljava/lang/Object;)Ljava/util/Set;
+22 -1: (Ljava/lang/Object;J)B
+22 -1: (Ljava/lang/Object;J)C
+22 -1: (Ljava/lang/Object;J)D
+17 -1: not a method type
+22 -1: (Ljava/lang/Object;J)F
+5 -1: count
+32 -1: AtomicReferenceFieldUpdater.java
+22 -1: (Ljava/lang/Object;J)I
+14 -1: methodAccessor
+22 -1: (Ljava/lang/Object;J)J
+7 -1: isError
+51 -1: (Ljava/nio/Buffer;II)Ljava/nio/charset/CoderResult;
+53 -1: (BZLjava/lang/Class<*>;)Ljava/lang/invoke/LambdaForm;
+25 -1: <no signer certificates>
+5 -1: [pos=
+14 -1: lambda$chars$1
+9 -1: CELLVALUE
+16 -1: haveLeftoverChar
+22 -1: ([Ljava/lang/String;)V
+32 -1: java/lang/InstantiationException
+7 -1: SIG_IGN
+13 -1: ZipUtils.java
+50 -1: Ljava/lang/ref/ReferenceQueue<Ljava/lang/Object;>;
+22 -1: (Ljava/lang/Object;J)S
+69 -1: Ljava/util/HashMap<Ljava/lang/String;Lsun/misc/URLClassPath$Loader;>;
+16 -1: newInternalError
+22 -1: (Ljava/lang/Object;J)V
+9 -1: ABBR_MASK
+5 -1: array
+22 -1: (Ljava/lang/Object;J)Z
+13 -1: FilteringMode
+30 -1: java/util/stream/StreamSupport
+19 -1: retrieveDisplayName
+56 -1: (Ljava/util/TimeZone;)Lsun/util/calendar/Gregorian$Date;
+10 -1: val$values
+9 -1: normalize
+28 -1: (II)Ljava/lang/CharSequence;
+16 -1: serialVersionUID
+7 -1: getPath
+25 -1: (ILjava/lang/Class<*>;Z)V
+13 -1: thenComparing
+51 -1: (Ljava/lang/Object;)Ljava/lang/invoke/MethodHandle;
+36 -1: ()[Ljava/lang/annotation/Annotation;
+14 -1: MetaIndex.java
+8 -1: identity
+15 -1: findSystemClass
+24 -1: privateGetDeclaredFields
+27 -1: java/lang/ref/SoftReference
+19 -1: useCanonPrefixCache
+3 -1: dec
+3 -1: PLT
+8 -1: UTF_32LE
+17 -1: java/util/HashMap
+12 -1: toEpochMilli
+9 -1: intStream
+11 -1: Caused by:
+31 -1: java/nio/charset/CharsetDecoder
+30 -1: is being checked
+11 -1: parseHeader
+25 -1: ACCUMULATED_DAYS_IN_MONTH
+34 -1: newGetByteIllegalArgumentException
+21 -1: checkPropertiesAccess
+13 -1: StackMapTable
+8 -1: addCount
+51 -1: (Ljava/lang/invoke/MethodHandle;)Ljava/lang/String;
+9 -1: authority
+15 -1: iso-10646-ucs-2
+6 -1: SUNDAY
+22 -1: LocalGregorianCalendar
+9 -1: listRoots
+32 -1: Lsun/reflect/generics/tree/Tree;
+38 -1: [Ljava/util/WeakHashMap$Entry<TK;TV;>;
+11 -1: nativeOrder
+5 -1: long0
+5 -1: long1
+5 -1: long2
+5 -1: long3
+17 -1: capacityIncrement
+5 -1: long4
+97 -1: (Ljava/lang/String;Ljava/lang/invoke/MethodType;[Ljava/lang/Object;)Ljava/lang/invoke/MemberName;
+31 -1: Ljava/lang/CharacterDataLatin1;
+5 -1: long5
+5 -1: long6
+5 -1: long7
+17 -1: reduceValuesToInt
+13 -1: package2certs
+13 -1: isTypeVisible
+30 -1: java/lang/ref/PhantomReference
+47 -1: ()Ljava/util/stream/Stream<Ljava/lang/String;>;
+9 -1: longValue
+3 -1: PNT
+10 -1: storeToXML
+10 -1: getMethod0
+12 -1: constantZero
+7 -1: promise
+116 -1: (Ljava/lang/String;Lsun/reflect/generics/factory/GenericsFactory;)Lsun/reflect/generics/repository/MethodRepository;
+32 -1: DIRECTIONALITY_SEGMENT_SEPARATOR
+9 -1: byteOrder
+9 -1: isPromise
+4 -1: isOn
+6 -1: LOCCRC
+10 -1: setDefault
+9 -1: setHandle
+15 -1: java/nio/Buffer
+37 -1: (Ljava/lang/String;I)Ljava/lang/Long;
+10 -1: Float.java
+12 -1: showSettings
+27 -1: (Ljava/io/FileDescriptor;)I
+27 -1: (Ljava/io/FileDescriptor;)J
+21 -1: java/util/Spliterator
+22 -1: CodingErrorAction.java
+11 -1: isMalformed
+27 -1: java/util/PrimitiveIterator
+15 -1: THROW_EXCEPTION
+15 -1: copyToCharArray
+26 -1: ()Ljava/util/jar/JarEntry;
+27 -1: (Ljava/io/FileDescriptor;)V
+11 -1: getEncoding
+48 -1: (Ljava/lang/ThreadLocal<*>;Ljava/lang/Object;I)V
+17 -1: java.runtime.name
+28 -1: (Lsun/invoke/util/Wrapper;)Z
+20 -1: annotationTypeOffset
+27 -1: (J)Ljava/lang/StringBuffer;
+15 -1: METHOD_RECEIVER
+10 -1: startEntry
+29 -1: (I)Ljava/lang/reflect/Member;
+7 -1: setOut0
+10 -1: getMethods
+26 -1: ()Lsun/misc/JavaNioAccess;
+18 -1: linkToTargetMethod
+8 -1: INSTANCE
+3 -1: dir
+41 -1: ([Ljava/net/URL;Ljava/lang/ClassLoader;)V
+9 -1: unboxCast
+58 -1: <T:Ljava/lang/Throwable;>(TT;)Lsun/invoke/empty/Empty;^TT;
+12 -1: java.version
+50 -1: (Ljava/io/InputStream;Ljava/nio/charset/Charset;)V
+32 2: sun/net/www/protocol/jar/Handler
+20 -1: java/lang/Compiler$1
+9 -1: LongCache
+14 -1: FILL_THRESHOLD
+22 -1: getRawClassAnnotations
+9 -1: (JI[CII)I
+13 -1: hasMoreTokens
+13 -1: getSuperclass
+3 -1: PRC
+12 -1: MAX_PRIORITY
+14 -1: checkCacheLoad
+7 -1: lowMask
+8 -1: LM_CLASS
+7 -1: initIDs
+27 -1: Ljava/util/Collection<TV;>;
+3 -1: yes
+3 -1: PRT
+91 -1: (Ljava/lang/invoke/MethodType;Ljava/lang/invoke/MethodHandle;)Ljava/lang/invoke/LambdaForm;
+27 -1: ()Lsun/security/util/Debug;
+8 -1: VM start
+9 -1: setMemory
+7 -1: getName
+10 -1: findSignal
+19 -1: startsWithLocHeader
+37 -1: java/util/Collections$SynchronizedMap
+51 -1: (ICLjava/lang/Object;)Ljava/lang/invoke/LambdaForm;
+62 -1: (Ljava/util/Locale;)Lsun/util/locale/provider/LocaleResources;
+17 -1: lastParameterType
+9 -1: NO_PTYPES
+116 -1: <T:Ljava/lang/Object;>([Ljava/lang/ClassValue$Entry<*>;Ljava/lang/ClassValue<TT;>;)Ljava/lang/ClassValue$Entry<TT;>;
+18 -1: DisplayNamePattern
+8 -1: getField
+5 -1: flags
+3 -1: PST
+17 -1: annotationDefault
+18 -1: java/nio/ByteOrder
+8 -1: highMask
+6 -1: ascii7
+29 -1: getGregorianYearFromFixedDate
+125 -1: (Ljava/lang/String;[Ljava/lang/invoke/LambdaForm$Name;[Ljava/lang/invoke/LambdaForm$Name;Ljava/lang/invoke/LambdaForm$Name;)V
+8 -1: =Lambda(
+29 -1: Ljava/util/WeakHashMap$Entry;
+18 -1: multiValueIterator
+74 -1: Ljava/util/LinkedHashMap<Ljava/lang/String;Ljava/io/ExpiringCache$Entry;>;
+13 -1: CONV_OP_LIMIT
+6 -1: sclSet
+81 -1: (Lsun/misc/URLClassPath$JarLoader;Ljava/util/jar/JarFile;)Ljava/util/jar/JarFile;
+14 -1: appendFragment
+46 -1: java/util/Collections$SynchronizedNavigableMap
+36 -1: application/x-java-serialized-object
+13 -1: setNativeName
+53 -1: java/util/concurrent/ConcurrentHashMap$ForwardingNode
+16 -1: setJavaAWTAccess
+30 -1: methodHandleInvokeLinkerMethod
+15 -1: reduceKeysToInt
+20 -1: ensureCapacityHelper
+23 -1: createFileURLConnection
+12 -1: d3dAvailable
+69 -1: (Ljava/lang/Object;Ljava/lang/invoke/MethodHandle;)Ljava/lang/String;
+49 -1: java/util/ArraysParallelSortHelpers$FJLong$Sorter
+21 -1: explicitCastArguments
+24 -1: JAVAFX_LAUNCH_MODE_CLASS
+9 -1: invoke_MT
+18 -1: ensureMemberAccess
+74 -1: (Ljava/util/concurrent/locks/AbstractQueuedSynchronizer$ConditionObject;)I
+36 -1: java/nio/charset/spi/CharsetProvider
+23 -1: (Ljava/lang/String;II)V
+14 -1: initProperties
+4 -1: (F)F
+35 -1: [[Ljava/lang/annotation/Annotation;
+4 -1: (F)I
+106 -1: Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/Comparable<Ljava/lang/String;>;Ljava/lang/CharSequence;
+46 -1: java/lang/invoke/BoundMethodHandle$SpeciesData
+74 -1: (Ljava/util/concurrent/locks/AbstractQueuedSynchronizer$ConditionObject;)Z
+24 -1: java.launcher.opt.header
+37 -1: ([Ljava/security/ProtectionDomain;Z)V
+10 -1: lineBuffer
+7 -1: ibm-813
+9 -1: isBuiltin
+4 -1: (F)V
+7 -1: ibm-819
+9 -1: H_ESCAPED
+4 -1: (F)Z
+20 -1: suppressedExceptions
+12 -1: UTF-32LE-BOM
+19 -1: CalendarSystem.java
+8 -1: readOnly
+81 -1: (JLjava/util/function/Function;Ljava/util/function/BiFunction;)Ljava/lang/Object;
+32 -1: sun/misc/Launcher$AppClassLoader
+78 -1: Ljava/lang/Object;Ljava/io/Serializable;Ljava/lang/Comparable<Ljava/io/File;>;
+17 -1: [Ljava/lang/Enum;
+41 -1: java/util/Collections$CheckedNavigableSet
+8 -1: asSetter
+3 -1: dom
+41 -1: (I)[Ljava/util/WeakHashMap$Entry<TK;TV;>;
+16 -1: localeExtensions
+21 -1: sun/net/www/ParseUtil
+21 -1: Ljava/nio/ByteBuffer;
+29 -1: java/util/concurrent/TimeUnit
+25 -1: java/lang/CharacterData00
+15 -1: sun/misc/Unsafe
+28 -1: java/io/ByteArrayInputStream
+3 -1: dow
+25 -1: java/lang/CharacterData01
+25 -1: java/lang/CharacterData02
+6 -1: STORED
+11 -1: isTransient
+8 -1: function
+16 -1: getCanonicalFile
+13 -1: ,useDaylight=
+24 -1: domain (context is null)
+12 -1: Cleaner.java
+17 -1: CalendarDate.java
+49 -1: Lsun/reflect/generics/repository/FieldRepository;
+14 -1: forInputString
+25 -1: java/lang/CharacterData0E
+67 -1: (Ljava/lang/Object;Ljava/util/function/Supplier;)Ljava/lang/Object;
+19 -1: codePointBeforeImpl
+6 -1: script
+21 -1: systemNativeLibraries
+38 -1: ([Ljava/lang/Class;)Ljava/lang/String;
+14 -1: CONTENT_LENGTH
+19 -1: HeapCharBuffer.java
+22 -1: ExtendedProviderHolder
+41 -1: java/lang/invoke/InvokerBytecodeGenerator
+12 -1: basicInvoker
+26 -1: ([Ljava/lang/Comparable;)V
+10 -1: val$tclass
+47 -1: (Ljava/lang/Throwable;)Lsun/invoke/empty/Empty;
+18 -1: isLegalReplacement
+22 -1: spliteratorUnknownSize
+15 -1: SynchronizedSet
+16 -1: MethodParameters
+22 -1: desiredAssertionStatus
+29 -1: ()Ljava/util/ArrayDeque<TE;>;
+36 -1: ()Ljava/lang/reflect/Constructor<*>;
+66 -1: ()Ljava/util/Map<Ljava/lang/String;Ljava/lang/invoke/LambdaForm;>;
+58 -1: (Ljava/lang/String;Ljava/lang/String;ILjava/lang/String;)V
+50 -1: (Ljava/util/concurrent/CountedCompleter;[J[JIIII)V
+14 -1: requireNonNull
+21 -1: java/lang/ThreadGroup
+95 -1: ([Ljava/util/concurrent/ConcurrentHashMap$Node;ILjava/util/concurrent/ConcurrentHashMap$Node;)V
+76 -1: (Ljava/nio/channels/WritableByteChannel;Ljava/nio/charset/CharsetEncoder;I)V
+14 -1: reflectionData
+33 -1: Ljava/lang/invoke/MethodTypeForm;
+7 -1: tuesday
+31 -1: ()Lsun/misc/JavaSecurityAccess;
+14 -1: fieldFilterMap
+28 -1: ([Ljava/lang/ThreadGroup;Z)I
+7 -1: ibm-850
+83 -1: (Ljava/lang/String;Ljava/lang/String;)Ljava/lang/management/GarbageCollectorMXBean;
+7 -1: ibm-852
+5 -1: cesu8
+14 -1: ForwardingNode
+29 -1: (Ljava/nio/ByteBuffer;IIIII)V
+7 -1: ibm-855
+12 -1: SingletonSet
+16 -1: isOtherUppercase
+15 -1: FIELD_UNDEFINED
+9 -1: makeEntry
+7 -1: ibm-857
+10 -1: extensions
+10 -1: longStream
+19 -1: getGenericSignature
+7 -1: newNode
+8 -1: jarNames
+25 -1: java/util/jar/JarVerifier
+49 -1: ()[Lsun/reflect/generics/tree/ClassTypeSignature;
+4 -1: wait
+115 -1: (Ljava/lang/String;Lsun/reflect/generics/factory/GenericsFactory;)Lsun/reflect/generics/repository/ClassRepository;
+56 -1: (Ljava/lang/String;Ljava/lang/Object;)Ljava/lang/Object;
+65 -1: (Lsun/util/locale/BaseLocale;Lsun/util/locale/LocaleExtensions;)V
+7 -1: ibm-862
+9 -1: ISO646-US
+7 -1: ibm-866
+16 -1: extendedProvider
+7 -1: ([C[C)Z
+93 -1: (Ljava/lang/invoke/MethodHandle;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MethodHandle;
+8 -1: getHours
+21 -1: ()[Ljava/lang/String;
+187 -1: (Ljava/util/concurrent/ConcurrentHashMap$BulkTask;III[Ljava/util/concurrent/ConcurrentHashMap$Node;Ljava/util/concurrent/ConcurrentHashMap$ReduceKeysTask;Ljava/util/function/BiFunction;)V
+106 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/concurrent/locks/ReentrantLock;Ljava/io/Serializable;
+24 -1: java/nio/file/FileSystem
+14 -1: ForEachKeyTask
+13 -1: defaultLocale
+20 -1: constructorModifiers
+13 -1: asWrapperType
+42 -1: (Ljava/lang/String;ZI)Ljava/lang/Class<*>;
+17 -1: BaseCalendar.java
+76 -1: (Ljava/util/jar/JarFile;Ljava/util/jar/JarEntry;)[Ljava/security/CodeSigner;
+14 -1: isSynchronized
+27 -1: java/nio/DirectByteBuffer$1
+3 -1: ()B
+7 -1: ibm-874
+12 -1: exactInvoker
+3 -1: ()C
+39 -1: (Ljava/lang/Thread;Ljava/lang/Object;)V
+3 -1: ()D
+3 -1: ()F
+27 -1: [Ljava/lang/reflect/Method;
+10 -1: floatValue
+3 -1: ()I
+3 -1: ()J
+18 -1: getLocaleResources
+59 -1: java/util/concurrent/ConcurrentHashMap$MapReduceEntriesTask
+67 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/Hashtable$Entry;)V
+11 -1: maxPriority
+11 -1: getStringAt
+60 -1: (Ljava/lang/ClassValue$Version;)Ljava/lang/ClassValue$Entry;
+3 -1: ()S
+49 -1: (Ljava/lang/String;)Ljava/io/ExpiringCache$Entry;
+42 -1: (III)Lsun/util/calendar/BaseCalendar$Date;
+82 -1: <T:Ljava/lang/Object;>(Ljava/util/Set<TT;>;Ljava/lang/Object;)Ljava/util/Set<TT;>;
+62 -1: ([BLsun/reflect/ConstantPool;Ljava/lang/Class;)Ljava/util/Map;
+3 -1: ()V
+24 -1: ()Ljava/nio/ShortBuffer;
+29 -1: file descriptor can't be null
+3 -1: ()Z
+7 -1: matcher
+66 -1: (Ljava/lang/reflect/Constructor;)Lsun/reflect/ConstructorAccessor;
+7 -1: matches
+12 -1: getAuthority
+16 -1: java/lang/Object
+5 -1: (IC)V
+17 -1: EmptyListIterator
+8 -1: charsets
+8 -1: sameFile
+47 -1: (TT;Ljava/util/function/UnaryOperator<TV;>;)TV;
+16 -1: overwrittenEntry
+15 -1: reinvokerTarget
+11 -1: isUpperCase
+5 -1: toUri
+9 -1: GMT+00:00
+33 -1: java/util/concurrent/ForkJoinPool
+10 -1: parseFloat
+53 -1: java/util/concurrent/ConcurrentHashMap$SearchKeysTask
+48 -1: (Ljava/lang/Object;Ljava/util/LinkedList$Node;)V
+82 -1: (Ljava/lang/Class<*>;Ljava/lang/Class<*>;Ljava/lang/Object;ILjava/lang/Class<*>;)V
+15 -1: reduceCacheLoad
+76 -1: (Ljava/lang/Class<*>;[Ljava/lang/reflect/Method;)[Ljava/lang/reflect/Method;
+20 -1: singletonSpliterator
+24 -1: getTransitionEpochSecond
+24 -1: MapReduceValuesToIntTask
+13 -1: ALLOWED_FLAGS
+55 -1: (Ljava/lang/reflect/Field;Z)Lsun/reflect/FieldAccessor;
+34 -1: [Ljava/lang/annotation/Annotation;
+10 -1: readBuffer
+21 -1: Illegal month value:
+31 -1: java/security/SecureClassLoader
+12 -1: reinitialize
+5 -1: limit
+4 -1: grow
+15 -1: getCreationTime
+7 -1: , from
+25 -1: (Ljava/lang/ClassValue;)V
+13 -1: java.compiler
+37 -1: ()Ljava/util/Set<Ljava/lang/String;>;
+6 -1: FJChar
+16 -1: getFieldAccessor
+4 -1: eras
+11 -1: isSupported
+24 -1: ()Ljava/text/DateFormat;
+32 -1: java/util/Collections$CopiesList
+32 -1: java/io/NotSerializableException
+15 -1: typeAnnotations
+27 -1: defaultAllowUserInteraction
+57 -1: (Ljava/lang/String;I[Ljava/lang/invoke/LambdaForm$Name;)V
+18 -1: checkArgumentTypes
+71 -1: (Lsun/util/calendar/BaseCalendar$Date;)Lsun/util/calendar/BaseCalendar;
+10 -1: isMirrored
+27 -1: (I)Ljava/lang/Thread$State;
+26 -1: (Ljava/util/Collection;Z)Z
+6 -1: ibm367
+16 -1: isAssignableFrom
+7 -1: readUTF
+35 -1: Ljava/lang/ref/ReferenceQueue<TV;>;
+56 -1: ([Ljava/util/HashMap$Node;Ljava/util/HashMap$TreeNode;)V
+8 -1: MANDATED
+18 -1: canonicalizeRegion
+11 -1: checkAccept
+44 -1: (Ljava/net/Proxy;)Lsun/net/ApplicationProxy;
+8 -1: ECMA-118
+22 -1: ReflectPermission.java
+4 -1: _put
+41 -1: java.lang.invoke.MethodHandle.DEBUG_NAMES
+47 -1: java/util/concurrent/ConcurrentHashMap$TreeNode
+44 -1: (Ljava/net/URL;[Ljava/security/CodeSigner;)V
+5 -1: april
+44 -1: ([Ljava/lang/Class<*>;Ljava/lang/Class<*>;)V
+150 -1: <K:Ljava/lang/Object;V:Ljava/lang/Object;>Ljava/util/concurrent/ConcurrentHashMap$CollectionView<TK;TV;TK;>;Ljava/util/Set<TK;>;Ljava/io/Serializable;
+91 -1: (ILjava/lang/Object;Ljava/lang/Object;Ljava/util/HashMap$Node;)Ljava/util/HashMap$TreeNode;
+26 -1: sun/net/util/IPAddressUtil
+8 -1: Modifier
+9 -1: isVarargs
+24 -1: -- listing properties --
+16 -1: hasAllPermission
+27 -1: MapReduceMappingsToLongTask
+29 -1: sharedGetParameterAnnotations
+9 -1: argCounts
+11 -1: toLocalTime
+89 -1: (Ljava/lang/invoke/LambdaForm;Ljava/lang/invoke/MethodType;)Ljava/lang/invoke/MemberName;
+4 -1: ROOT
+20 -1: sun.reflect.noCaches
+18 -1: UnicodeBigUnmarked
+4 -1: Lazy
+35 -1: java/lang/invoke/SimpleMethodHandle
+20 -1: (I)Ljava/nio/Buffer;
+48 -1: ()Lsun/reflect/generics/tree/ClassTypeSignature;
+31 -1: (I[CII)Ljava/lang/StringBuffer;
+17 -1: America/Anchorage
+7 -1: markpos
+9 -1: enumerate
+11 -1: parseLocale
+24 -1: java.launcher.cls.error1
+46 -1: (ILjava/lang/Object;)Ljava/lang/StringBuilder;
+24 -1: java.launcher.cls.error2
+24 -1: java.launcher.cls.error3
+24 -1: java.launcher.cls.error4
+21 -1: java/util/ArrayList$1
+17 -1: getExceptionTypes
+24 -1: java.launcher.cls.error5
+30 -1: java/util/Spliterator$OfDouble
+10 -1: forDecoder
+8 -1: getEntry
+10 -1: checkGuard
+12 -1: checkInitted
+34 -1: Lsun/util/locale/LocaleExtensions;
+41 -1: java/util/ArraysParallelSortHelpers$FJInt
+10 -1: findStatic
+22 -1: setConstructorAccessor
+34 -1: Lsun/misc/URLClassPath$FileLoader;
+20 -1: not a reinvoker MH:
+16 -1: LongCumulateTask
+11 -1: checkAccess
+14 -1: SearchKeysTask
+36 -1: ()[Ljava/lang/reflect/AnnotatedType;
+11 -1: initDefault
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/FieldAnnotationsTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,67 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Test for field annotations.
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/FieldAnnotationsApp.java test-classes/MyAnnotation.java
+ * @run main FieldAnnotationsTest
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+
+// This is a test for the handling of multi-dimensional Arrays in MetaspaceClosure.
+//
+// We choose FieldAnnotations because they happen to be implemented as a multi-dimension
+// Array (Annotations::_fields_annotations, which is of type Array<Array<unsigned char>*>*,
+// and is handled by the template class PointerArrayRef<T> in metaspaceClosure.hpp).
+//
+// Specifically, we are testing the following C code, where _fields_annotations is non-NULL:
+//
+// void Annotations::metaspace_pointers_do(MetaspaceClosure* it) {
+// ...
+// it->push(&_fields_annotations);
+//
+// which will be matched with the function
+//
+// template <typename T> void MetaspaceClosure::push(Array<T*>** mpp, Writability w = _default)
+//
+public class FieldAnnotationsTest {
+ public static void main(String[] args) throws Exception {
+ String[] ARCHIVE_CLASSES = {"FieldAnnotationsApp", "MyAnnotation"};
+ String appJar = JarBuilder.build("FieldAnnotationsTest", ARCHIVE_CLASSES);
+
+ OutputAnalyzer dumpOutput = TestCommon.dump(
+ appJar, ARCHIVE_CLASSES);
+ TestCommon.checkDump(dumpOutput);
+
+ OutputAnalyzer execOutput = TestCommon.exec(appJar, "FieldAnnotationsApp");
+ TestCommon.checkExec(execOutput, "Field annotations are OK.");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/FreeUnusedMetadata.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,118 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Unused metadata created during dump time should be freed from the CDS archive.
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules jdk.jartool/sun.tools.jar
+ * @compile test-classes/MethodNoReturn.jasm test-classes/Hello.java
+ * @run main FreeUnusedMetadata
+ */
+
+import java.nio.file.Files;
+import java.nio.file.Paths;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class FreeUnusedMetadata {
+ static byte iconst_1 = 4;
+ static byte pop = 87;
+ static byte[] pattern = { // This has the same sequence as in test-classes/MethodNoReturn.jasm
+ iconst_1,
+ pop,
+ iconst_1,
+ pop,
+ iconst_1,
+ pop,
+ iconst_1,
+ pop,
+ iconst_1,
+ pop,
+ iconst_1,
+ pop,
+ iconst_1,
+ pop,
+ iconst_1,
+ pop,
+ iconst_1,
+ pop,
+ iconst_1,
+ pop,
+ iconst_1,
+ iconst_1,
+ iconst_1,
+ iconst_1,
+ iconst_1,
+ iconst_1,
+ iconst_1,
+ iconst_1,
+ pop,
+ pop,
+ pop,
+ pop,
+ pop,
+ pop,
+ pop,
+ pop
+ };
+
+ public static void main(String[] args) throws Exception {
+ String[] ARCHIVE_CLASSES = {"Hello", "MethodNoReturn"};
+ String appJar = JarBuilder.build("FreeUnusedMetadata", ARCHIVE_CLASSES);
+
+ OutputAnalyzer dumpOutput = TestCommon.dump(
+ appJar, ARCHIVE_CLASSES);
+ TestCommon.checkDump(dumpOutput, "Loading classes to share");
+
+ OutputAnalyzer execOutput = TestCommon.exec(appJar, "Hello");
+ TestCommon.checkExec(execOutput, "Hello World");
+
+
+ String archive = TestCommon.getCurrentArchiveName();
+ System.out.println("Checking for pattern inside " + archive + "...");
+
+ byte[] data = Files.readAllBytes(Paths.get(archive));
+ int max = data.length - pattern.length;
+ for (int i=0; i<max; i++) {
+ if (data[i+0] == iconst_1 && data[i+1] == pop &&
+ data[i+2] == iconst_1 && data[i+3] == pop) {
+ boolean match = true;
+ for (int x=4; x<pattern.length; x++) {
+ if (data[i+x] != pattern[x]) {
+ match = false;
+ break;
+ }
+ }
+
+ if (match) {
+ throw new RuntimeException("method of unverifiable class should have been " +
+ "removed from the archive " + archive +
+ " , but was found at offset " + i);
+ }
+ }
+ }
+ System.out.println("Not found: method from unverifiable class has been removed");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/HelloExtTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,72 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary a simple test for loading a class using the ext class loader in AppCDS
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * jdk.internal.jvmstat/sun.jvmstat.monitor
+ * @compile test-classes/HelloExt.java
+ * @build sun.hotspot.WhiteBox
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @run main HelloExtTest
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class HelloExtTest {
+
+ public static void main(String[] args) throws Exception {
+ JarBuilder.build("helloExt", "HelloExt");
+
+ String appJar = TestCommon.getTestJar("helloExt.jar");
+ JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox");
+ String whiteBoxJar = TestCommon.getTestJar("WhiteBox.jar");
+ String bootClassPath = "-Xbootclasspath/a:" + whiteBoxJar;
+
+ TestCommon.dump(appJar,
+ TestCommon.list("org/omg/CORBA/ORB", "[Ljava/lang/Comparable;"),
+ bootClassPath, "-verbose:class", "--add-modules", "java.corba");
+
+ OutputAnalyzer output = TestCommon.execCommon("-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI",
+ "-cp", appJar, bootClassPath, "-verbose:class", "--add-modules", "java.corba", "HelloExt");
+
+ String prefix = ".class.load. ";
+ String class_pattern = ".*LambdaForm[$]MH[/][0123456789].*";
+ String suffix = ".*source: shared objects file.*";
+ String pattern = prefix + class_pattern + suffix;
+ output.shouldNotMatch(pattern);
+
+ output = TestCommon.execCommon("-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI",
+ "-cp", appJar, bootClassPath, "-verbose:class",
+ "-XX:+PrintSharedArchiveAndExit", "-XX:+PrintSharedDictionary",
+ "--add-modules", "java.corba", "HelloExt");
+ output.shouldNotMatch(class_pattern);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/HelloTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,44 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Hello World test for AppCDS
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java
+ * @run main HelloTest
+ */
+
+public class HelloTest {
+
+ public static void main(String[] args) throws Exception {
+ TestCommon.test(JarBuilder.getOrCreateHelloJar(),
+ TestCommon.list("Hello"), "Hello");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/IgnoreEmptyClassPaths.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,63 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Test the -XX:+IgnoreEmptyClassPaths flag
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java
+ * @compile test-classes/HelloMore.java
+ * @run main IgnoreEmptyClassPaths
+ */
+
+import java.io.File;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class IgnoreEmptyClassPaths {
+
+ public static void main(String[] args) throws Exception {
+ String jar1 = JarBuilder.getOrCreateHelloJar();
+ String jar2 = JarBuilder.build("IgnoreEmptyClassPaths_more", "HelloMore");
+
+ String sep = File.pathSeparator;
+ String cp_dump = jar1 + sep + jar2 + sep;
+ String cp_exec = sep + jar1 + sep + sep + jar2 + sep;
+
+ TestCommon.testDump(cp_dump, TestCommon.list("Hello", "HelloMore"),
+ "-XX:+TraceClassPaths", "-XX:+IgnoreEmptyClassPaths");
+
+ OutputAnalyzer output = TestCommon.execCommon(
+ "-verbose:class",
+ "-cp", cp_exec,
+ "-XX:+IgnoreEmptyClassPaths", // should affect classpath even if placed after the "-cp" argument
+ "-XX:+TraceClassPaths",
+ "HelloMore");
+ TestCommon.checkExec(output);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/JarBuilder.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,235 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @summary Simple jar builder
+ * Input: jarName className1 className2 ...
+ * do not specify extensions, just the names
+ * E.g. prot_domain ProtDomainA ProtDomainB
+ * Output: A jar containing compiled classes, placed in a test classes folder
+ * @library /open/test/lib
+ */
+
+import jdk.test.lib.JDKToolFinder;
+import jdk.test.lib.process.OutputAnalyzer;
+import jdk.test.lib.process.ProcessTools;
+import java.io.File;
+import java.util.ArrayList;
+import sun.tools.jar.Main;
+
+public class JarBuilder {
+ // to turn DEBUG on via command line: -DJarBuilder.DEBUG=[true, TRUE]
+ private static final boolean DEBUG = Boolean.parseBoolean(System.getProperty("JarBuilder.DEBUG", "false"));
+ private static final String classDir = System.getProperty("test.classes");
+
+ public static String getJarFilePath(String jarName) {
+ return classDir + File.separator + jarName + ".jar";
+ }
+
+ // jar all files under dir, with manifest file man, with an optional versionArgs
+ // for generating a multi-release jar.
+ // The jar command is as follows:
+ // jar cmf \
+ // <path to output jar> <path to the manifest file>\
+ // -C <path to the base classes> .\
+ // --release 9 -C <path to the versioned classes> .
+ // the last line begins with "--release" corresponds to the optional versionArgs.
+ public static void build(String jarName, File dir, String man, String ...versionArgs)
+ throws Exception {
+ ArrayList<String> args = new ArrayList<String>();
+ if (man != null) {
+ args.add("cfm");
+ } else {
+ args.add("cf");
+ }
+ args.add(classDir + File.separator + jarName + ".jar");
+ if (man != null) {
+ args.add(man);
+ }
+ args.add("-C");
+ args.add(dir.getAbsolutePath());
+ args.add(".");
+ for (String verArg : versionArgs) {
+ args.add(verArg);
+ }
+ createJar(args);
+ }
+
+ public static String build(String jarName, String ...classNames)
+ throws Exception {
+
+ return createSimpleJar(classDir, getJarFilePath(jarName), classNames);
+ }
+
+ public static String build(boolean classesInWorkDir, String jarName, String ...classNames)
+ throws Exception {
+ if (classesInWorkDir) {
+ return createSimpleJar(".", getJarFilePath(jarName), classNames);
+ } else {
+ return build(jarName, classNames);
+ }
+ }
+
+
+ public static String buildWithManifest(String jarName, String manifest,
+ String jarClassesDir, String ...classNames) throws Exception {
+ String jarPath = getJarFilePath(jarName);
+ ArrayList<String> args = new ArrayList<String>();
+ args.add("cvfm");
+ args.add(jarPath);
+ args.add(System.getProperty("test.src") + File.separator + "test-classes"
+ + File.separator + manifest);
+ addClassArgs(args, jarClassesDir, classNames);
+ createJar(args);
+
+ return jarPath;
+ }
+
+
+ // Execute: jar uvf $jarFile -C $dir .
+ static void update(String jarFile, String dir) throws Exception {
+ String jarExe = JDKToolFinder.getJDKTool("jar");
+
+ ArrayList<String> args = new ArrayList<>();
+ args.add(jarExe);
+ args.add("uvf");
+ args.add(jarFile);
+ args.add("-C");
+ args.add(dir);
+ args.add(".");
+
+ executeProcess(args.toArray(new String[1]));
+ }
+
+
+ private static String createSimpleJar(String jarclassDir, String jarName,
+ String[] classNames) throws Exception {
+
+ ArrayList<String> args = new ArrayList<String>();
+ args.add("cf");
+ args.add(jarName);
+ addClassArgs(args, jarclassDir, classNames);
+ createJar(args);
+
+ return jarName;
+ }
+
+ private static void addClassArgs(ArrayList<String> args, String jarclassDir,
+ String[] classNames) {
+
+ for (String name : classNames) {
+ args.add("-C");
+ args.add(jarclassDir);
+ args.add(name + ".class");
+ }
+ }
+
+ private static void createJar(ArrayList<String> args) {
+ if (DEBUG) printIterable("createJar args: ", args);
+
+ Main jarTool = new Main(System.out, System.err, "jar");
+ if (!jarTool.run(args.toArray(new String[1]))) {
+ throw new RuntimeException("jar operation failed");
+ }
+ }
+
+ // Many AppCDS tests use the same simple "Hello.jar" which contains
+ // simple Hello.class and does not specify additional attributes.
+ // For this common use case, use this method to get the jar path.
+ // The method will check if the jar already exists
+ // (created by another test or test run), and will create the jar
+ // if it does not exist
+ public static String getOrCreateHelloJar() throws Exception {
+ String jarPath = getJarFilePath("hello");
+
+ File jarFile = new File(jarPath);
+ if (jarFile.exists()) {
+ return jarPath;
+ } else {
+ return build("hello", "Hello");
+ }
+ }
+
+ public static void compile(String dstPath, String source, String... extraArgs) throws Exception {
+ ArrayList<String> args = new ArrayList<String>();
+ args.add(JDKToolFinder.getCompileJDKTool("javac"));
+ args.add("-d");
+ args.add(dstPath);
+ if (extraArgs != null) {
+ for (String s : extraArgs) {
+ args.add(s);
+ }
+ }
+ args.add(source);
+
+ if (DEBUG) printIterable("compile args: ", args);
+
+ ProcessBuilder pb = new ProcessBuilder(args);
+ OutputAnalyzer output = new OutputAnalyzer(pb.start());
+ output.shouldHaveExitValue(0);
+ }
+
+ public static void signJar() throws Exception {
+ String keyTool = JDKToolFinder.getJDKTool("keytool");
+ String jarSigner = JDKToolFinder.getJDKTool("jarsigner");
+ String classDir = System.getProperty("test.classes");
+ String FS = File.separator;
+
+ executeProcess(keyTool,
+ "-genkey", "-keystore", "./keystore", "-alias", "mykey",
+ "-storepass", "abc123", "-keypass", "abc123",
+ "-dname", "CN=jvmtest")
+ .shouldHaveExitValue(0);
+
+ executeProcess(jarSigner,
+ "-keystore", "./keystore", "-storepass", "abc123", "-keypass",
+ "abc123", "-signedjar", classDir + FS + "signed_hello.jar",
+ classDir + FS + "hello.jar", "mykey")
+ .shouldHaveExitValue(0);
+ }
+
+ private static OutputAnalyzer executeProcess(String... cmds)
+ throws Exception {
+
+ JarBuilder.printArray("executeProcess: ", cmds);
+ return ProcessTools.executeProcess(new ProcessBuilder(cmds));
+ }
+
+ // diagnostic
+ public static void printIterable(String msg, Iterable<String> l) {
+ StringBuilder sum = new StringBuilder();
+ for (String s : l) {
+ sum.append(s).append(' ');
+ }
+ System.out.println(msg + sum.toString());
+ }
+
+ public static void printArray(String msg, String[] l) {
+ StringBuilder sum = new StringBuilder();
+ for (String s : l) {
+ sum.append(s).append(' ');
+ }
+ System.out.println(msg + sum.toString());
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/JvmtiAddPath.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,107 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary JvmtiEnv::AddToBootstrapClassLoaderSearch and JvmtiEnv::AddToSystemClassLoaderSearch should disable AppCDS
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @bug 8060592
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @build sun.hotspot.WhiteBox
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @compile test-classes/Hello.java
+ * @compile test-classes/JvmtiApp.java
+ * @run main JvmtiAddPath
+ */
+
+import java.io.File;
+import jdk.test.lib.process.OutputAnalyzer;
+import sun.hotspot.WhiteBox;
+
+public class JvmtiAddPath {
+ static String use_whitebox_jar;
+ static String[] no_extra_matches = {};
+ static String[] check_appcds_enabled = {
+ "[class,load] ExtraClass source: shared object"
+ };
+ static String[] check_appcds_disabled = {
+ "[class,load] ExtraClass source: file:"
+ };
+
+ static void run(String cp, String... args) throws Exception {
+ run(no_extra_matches, cp, args);
+ }
+
+ static void run(String[] extra_matches, String cp, String... args) throws Exception {
+ String[] opts = {"-cp", cp, "-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI", use_whitebox_jar};
+ opts = TestCommon.concat(opts, args);
+ OutputAnalyzer output = TestCommon.execCommon(opts);
+ TestCommon.checkExec(output, extra_matches);
+ }
+
+ public static void main(String[] args) throws Exception {
+ JarBuilder.build("jvmti_addboot", "Hello");
+ JarBuilder.build("jvmti_addapp", "Hello");
+ JarBuilder.build("jvmti_app", "JvmtiApp", "ExtraClass");
+ JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox");
+
+ // In all the test cases below, appJar does not contain Hello.class. Instead, we
+ // append JAR file(s) that contain Hello.class to the boot classpath, the app
+ // classpath, or both, and verify that Hello.class is loaded by the expected ClassLoader.
+ String appJar = TestCommon.getTestJar("jvmti_app.jar"); // contains JvmtiApp.class
+ String addappJar = TestCommon.getTestJar("jvmti_addapp.jar"); // contains Hello.class
+ String addbootJar = TestCommon.getTestJar("jvmti_addboot.jar"); // contains Hello.class
+ String twoAppJars = appJar + File.pathSeparator + addappJar;
+ String wbJar = TestCommon.getTestJar("WhiteBox.jar");
+ use_whitebox_jar = "-Xbootclasspath/a:" + wbJar;
+
+ TestCommon.testDump(appJar, TestCommon.list("JvmtiApp", "ExtraClass"), use_whitebox_jar);
+
+ System.out.println("Test case 1: not adding any paths - Hello.class should not be found");
+ run(check_appcds_enabled, appJar, "-Xlog:class+load", "JvmtiApp", "noadd"); // appcds should be enabled
+
+ System.out.println("Test case 2: add to boot classpath only - should find Hello.class in boot loader");
+ run(check_appcds_disabled, appJar, "-Xlog:class+load", "JvmtiApp", "bootonly", addbootJar); // appcds should be disabled
+
+ System.out.println("Test case 3: add to app classpath only - should find Hello.class in app loader");
+ run(appJar, "JvmtiApp", "apponly", addappJar);
+
+ System.out.println("Test case 4: add to boot and app paths - should find Hello.class in boot loader");
+ run(appJar, "JvmtiApp", "appandboot", addbootJar, addappJar);
+
+ System.out.println("Test case 5: add to app using -cp, but add to boot using JVMTI - should find Hello.class in boot loader");
+ run(twoAppJars, "JvmtiApp", "bootonly", addappJar);
+
+ System.out.println("Test case 6: add to app using AppCDS, but add to boot using JVMTI - should find Hello.class in boot loader");
+ TestCommon.testDump(twoAppJars, TestCommon.list("JvmtiApp", "ExtraClass", "Hello"), use_whitebox_jar);
+ run(twoAppJars, "JvmtiApp", "bootonly", addappJar);
+
+ System.out.println("Test case 7: add to app using AppCDS, no JVMTI calls - should find Hello.class in app loader");
+ run(twoAppJars, "JvmtiApp", "noadd-appcds");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/MismatchedUseAppCDS.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,81 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Try different combination of mismatched UseAppCDS between dump time and run time.
+ * (Note: AppCDS does not support uncompressed oops.)
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/CheckIfShared.java
+ * @build sun.hotspot.WhiteBox
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @run main MismatchedUseAppCDS
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class MismatchedUseAppCDS {
+ public static void main(String[] args) throws Exception {
+ String wbJar = JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox");
+ String use_whitebox_jar = "-Xbootclasspath/a:" + wbJar;
+
+ String appJar = JarBuilder.build("MismatchedUseAppCDS", "CheckIfShared");
+
+ OutputAnalyzer output;
+
+ // (1): dump with -XX:+UseAppCDS, but run with -XX:-UseAppCDS
+ TestCommon.testDump(appJar, TestCommon.list("CheckIfShared"),
+ // command-line arguments ...
+ "-XX:+UseAppCDS",
+ use_whitebox_jar);
+
+ output = TestCommon.exec(appJar,
+ // command-line arguments ...
+ use_whitebox_jar,
+ "-XX:-UseAppCDS",
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+WhiteBoxAPI",
+ "CheckIfShared", "false");
+ TestCommon.checkExec(output);
+
+ // (2): dump with -XX:-UseAppCDS, but run with -XX:+UseAppCDS
+ TestCommon.testDump(appJar, TestCommon.list("CheckIfShared"),
+ // command-line arguments ...
+ "-XX:-UseAppCDS",
+ use_whitebox_jar);
+
+ output = TestCommon.exec(appJar,
+ // command-line arguments ...
+ use_whitebox_jar,
+ "-XX:+UseAppCDS",
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+WhiteBoxAPI",
+ "CheckIfShared", "false");
+ TestCommon.checkExec(output);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/MissingSuperTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,52 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary When super class is missing during dumping, no crash should happen.
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/MissingSuper.java
+ * @run main MissingSuperTest
+ */
+
+public class MissingSuperTest {
+
+ public static void main(String[] args) throws Exception {
+ // The classes "MissingSuperSup" and "MissingSuperIntf" are intentionally not
+ // included into the jar to provoke the test condition
+ JarBuilder.build("missing_super", "MissingSuper",
+ "MissingSuperSub", "MissingSuperImpl");
+
+ String appJar = TestCommon.getTestJar("missing_super.jar");
+ TestCommon.test(appJar, TestCommon.list("MissingSuper",
+ "MissingSuperSub",
+ "MissingSuperImpl"),
+ "MissingSuper");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/MultiProcessSharing.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,144 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Run multiple processes with the same archive, ensure they share
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @build sun.hotspot.WhiteBox
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @compile test-classes/MultiProcClass.java
+ * @run main MultiProcessSharing
+ */
+
+import java.io.File;
+import jdk.test.lib.Asserts;
+import jdk.test.lib.Platform;
+import jdk.test.lib.process.OutputAnalyzer;
+import sun.hotspot.WhiteBox;
+
+
+public class MultiProcessSharing {
+ static String useWbJar;
+ static String sharedClass1Jar;
+ static boolean checkPmap = false;
+
+ public static void main(String[] args) throws Exception {
+ String wbJar = JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox");
+ useWbJar = "-Xbootclasspath/a:" + wbJar;
+ sharedClass1Jar = JarBuilder.build("shared_class1", "MultiProcClass");
+
+ // create an archive
+ OutputAnalyzer out = TestCommon.dump(sharedClass1Jar,
+ TestCommon.list("MultiProcClass"), useWbJar);
+ TestCommon.checkDump(out);
+
+ // determine whether OK to use pmap for extra test verification
+ long myPid = ProcessHandle.current().pid();
+ checkPmap = (Platform.isLinux() && (MultiProcClass.runPmap(myPid, false) == 0));
+ System.out.println("MultiProcessSharing: checkPmap is " + checkPmap);
+
+ // use an archive in several processes concurrently
+ int numProcesses = 3;
+ Thread[] threads = new Thread[numProcesses];
+ ProcessHandler[] processHandlers = new ProcessHandler[numProcesses];
+ for (int i = 0; i < numProcesses; i++) {
+ processHandlers[i] = new ProcessHandler(i);
+ threads[i] = new Thread(processHandlers[i]);
+ }
+
+ for (Thread t : threads) {
+ t.start();
+ }
+
+ for (Thread t : threads) {
+ try {
+ t.join();
+ } catch (InterruptedException ie) {
+ throw ie;
+ }
+ }
+
+ // check results
+ for (ProcessHandler ph : processHandlers) {
+ TestCommon.checkExec(ph.out);
+ if (checkPmap && !TestCommon.isUnableToMap(ph.out)) {
+ checkPmapOutput(ph.out.getOutput());
+ }
+ }
+ }
+
+
+ static class ProcessHandler implements Runnable {
+ int processNumber;
+ OutputAnalyzer out;
+
+ ProcessHandler(int processNumber) {
+ this.processNumber = processNumber;
+ }
+
+ @Override
+ public void run() {
+ try {
+ out = TestCommon.exec(sharedClass1Jar,
+ "-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI", useWbJar,
+ "MultiProcClass", "" + processNumber, "" + checkPmap);
+ } catch (Exception e) {
+ throw new RuntimeException("Error occurred when using archive, exec()" + e);
+ }
+ }
+ }
+
+
+ private static void checkPmapOutput(String stdio) {
+ System.out.println("Checking pmap output ...");
+ String[] lines = stdio.split("\n");
+
+ boolean foundJsa = false;
+ boolean foundReadOnlyJsaSection = false;
+
+ for (String line : lines) {
+ if (line.contains(TestCommon.getCurrentArchiveName()))
+ System.out.println(line);
+ foundJsa = true;
+ if (line.contains("r--")) {
+ foundReadOnlyJsaSection = true;
+ }
+
+ // On certain ARM platforms system maps r/o memory mapped files
+ // as r/x; see JDK-8145694 for details
+ if ( (Platform.isARM() || Platform.isAArch64()) && line.contains("r-x") ) {
+ foundReadOnlyJsaSection = true;
+ }
+ }
+
+ Asserts.assertTrue(foundJsa && foundReadOnlyJsaSection);
+ }
+
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/MultiReleaseJars.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,238 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test MultiReleaseJars
+ * @bug 8170105
+ * @summary Test multi-release jar with AppCDS.
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * jdk.jartool/sun.tools.jar
+ * @run main/othervm MultiReleaseJars
+ */
+
+import java.io.File;
+import java.io.FileOutputStream;
+import java.io.PrintStream;
+import java.io.IOException;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class MultiReleaseJars {
+
+ static final int MAJOR_VERSION = Runtime.version().major();
+ static final String MAJOR_VERSION_STRING = String.valueOf(Runtime.version().major());
+
+ static String[] getMain() {
+ String[] sts = {
+ "package version;",
+ "public class Main {",
+ " public static void main(String[] args) {",
+ " Version version = new Version();",
+ " System.out.println(\"I am running on version \" + version.getVersion());",
+ " }",
+ "}"
+ };
+ return sts;
+ }
+
+ static String[] getVersion(int version) {
+ String[] sts = {
+ "package version;",
+ "public class Version {",
+ " public int getVersion(){ return " + version + "; }",
+ "}"
+ };
+ return sts;
+ }
+
+ static void writeFile(File file, String... contents) throws Exception {
+ if (contents == null) {
+ throw new java.lang.RuntimeException("No input for writing to file" + file);
+ }
+ FileOutputStream fos = new FileOutputStream(file);
+ PrintStream ps = new PrintStream(fos);
+ for (String str : contents) {
+ ps.println(str);
+ }
+ ps.close();
+ fos.close();
+ }
+
+ /* version.jar entries and files:
+ * META-INF/
+ * META-INF/MANIFEST.MF
+ * version/
+ * version/Main.class
+ * version/Version.class
+ * META-INF/versions/
+ * META-INF/versions/<major-version>/
+ * META-INF/versions/<major-version>/version/
+ * META-INF/versions/<major-version>/version/Version.class
+ */
+ static void createClassFilesAndJar() throws Exception {
+ String tempDir = System.getProperty("test.classes");
+ File baseDir = new File(tempDir + File.separator + "base");
+ File vDir = new File(tempDir + File.separator + MAJOR_VERSION_STRING);
+
+ baseDir.mkdirs();
+ vDir.mkdirs();
+
+ File fileMain = TestCommon.getOutputSourceFile("Main.java");
+ writeFile(fileMain, getMain());
+
+ File fileVersion = TestCommon.getOutputSourceFile("Version.java");
+ writeFile(fileVersion, getVersion(7));
+ JarBuilder.compile(baseDir.getAbsolutePath(), fileVersion.getAbsolutePath(), "--release", "7");
+ JarBuilder.compile(baseDir.getAbsolutePath(), fileMain.getAbsolutePath(),
+ "-cp", baseDir.getAbsolutePath(), "--release", MAJOR_VERSION_STRING);
+
+ String[] meta = {
+ "Multi-Release: true",
+ "Main-Class: version.Main"
+ };
+ File metainf = new File(tempDir, "mf.txt");
+ writeFile(metainf, meta);
+
+ fileVersion = TestCommon.getOutputSourceFile("Version.java");
+ writeFile(fileVersion, getVersion(MAJOR_VERSION));
+ JarBuilder.compile(vDir.getAbsolutePath(), fileVersion.getAbsolutePath(), "--release", MAJOR_VERSION_STRING);
+
+ JarBuilder.build("version", baseDir, metainf.getAbsolutePath(),
+ "--release", MAJOR_VERSION_STRING, "-C", vDir.getAbsolutePath(), ".");
+
+ // the following jar file is for testing case-insensitive "Multi-Release"
+ // attibute name
+ String[] meta2 = {
+ "multi-Release: true",
+ "Main-Class: version.Main"
+ };
+ metainf = new File(tempDir, "mf2.txt");
+ writeFile(metainf, meta2);
+ JarBuilder.build("version2", baseDir, metainf.getAbsolutePath(),
+ "--release", MAJOR_VERSION_STRING, "-C", vDir.getAbsolutePath(), ".");
+ }
+
+ static void checkExecOutput(OutputAnalyzer output, String expectedOutput) throws Exception {
+ try {
+ TestCommon.checkExec(output, expectedOutput);
+ } catch (java.lang.RuntimeException re) {
+ String cause = re.getMessage();
+ if (!expectedOutput.equals(cause)) {
+ throw re;
+ }
+ }
+ }
+
+ public static void main(String... args) throws Exception {
+ // create version.jar which contains Main.class and Version.class.
+ // Version.class has two versions: 8 and the current version.
+ createClassFilesAndJar();
+
+ String mainClass = "version.Main";
+ String loadInfo = "[class,load] version.Version source: shared objects file";
+ String appClasses[] = {"version/Main", "version/Version"};
+ String appJar = TestCommon.getTestJar("version.jar");
+ String appJar2 = TestCommon.getTestJar("version2.jar");
+ String verboseMode = "-verbose:class";
+ String enableMultiRelease = "-Djdk.util.jar.enableMultiRelease=true";
+ String jarVersion = null;
+ String expectedOutput = null;
+
+ // 1. default to highest version
+ // if META-INF/versions exists, no other commandline options like -Djdk.util.jar.version and
+ // -Djdk.util.jar.enableMultiRelease passed to vm
+ OutputAnalyzer output = TestCommon.dump(appJar, appClasses);
+ output.shouldContain("Loading classes to share: done.");
+ output.shouldHaveExitValue(0);
+
+ output = TestCommon.exec(appJar, verboseMode, mainClass);
+ checkExecOutput(output, "I am running on version " + MAJOR_VERSION_STRING);
+
+ // 2. Test versions 7 and the current major version.
+ // -Djdk.util.jar.enableMultiRelease=true (or force), default is true.
+ // a) -Djdk.util.jar.version=7 does not exist in jar.
+ // It will fallback to the root version which is also 7 in this test.
+ // b) -Djdk.util.jar.version=MAJOR_VERSION exists in the jar.
+ for (int i : new int[] {7, MAJOR_VERSION}) {
+ jarVersion = "-Djdk.util.jar.version=" + i;
+ expectedOutput = "I am running on version " + i;
+ output = TestCommon.dump(appJar, appClasses, enableMultiRelease, jarVersion);
+ output.shouldContain("Loading classes to share: done.");
+ output.shouldHaveExitValue(0);
+
+ output = TestCommon.exec(appJar, verboseMode, mainClass);
+ checkExecOutput(output, expectedOutput);
+ }
+
+ // 3. For unsupported version, 5 and current major version + 1, the multiversion
+ // will be turned off, so it will use the default (root) version.
+ for (int i : new int[] {5, MAJOR_VERSION + 1}) {
+ jarVersion = "-Djdk.util.jar.version=" + i;
+ output = TestCommon.dump(appJar, appClasses, enableMultiRelease, jarVersion);
+ output.shouldHaveExitValue(0);
+ // With the fix for 8172218, multi-release jar is being handled in
+ // jdk corelib which doesn't emit the following warning message.
+ //output.shouldContain("JDK" + i + " is not supported in multiple version jars");
+
+ output = TestCommon.exec(appJar, verboseMode, mainClass);
+ if (i == 5)
+ checkExecOutput(output, "I am running on version 7");
+ else
+ checkExecOutput(output, "I am running on version " + MAJOR_VERSION_STRING);
+ }
+
+ // 4. If explicitly disabled from command line for multiversion jar, it will use default
+ // version at root regardless multiversion versions exists.
+ // -Djdk.util.jar.enableMultiRelease=false (not 'true' or 'force')
+ for (int i = 6; i < MAJOR_VERSION + 1; i++) {
+ jarVersion = "-Djdk.util.jar.version=" + i;
+ output = TestCommon.dump(appJar, appClasses, "-Djdk.util.jar.enableMultiRelease=false", jarVersion);
+ output.shouldHaveExitValue(0);
+
+ output = TestCommon.exec(appJar, verboseMode, mainClass);
+ expectedOutput = "I am running on version 7";
+ checkExecOutput(output, expectedOutput);
+ }
+
+ // 5. Sanity test with -Xbootclasspath/a
+ // AppCDS behaves the same as the non-AppCDS case. A multi-release
+ // jar file in the -Xbootclasspath/a will be ignored.
+ output = TestCommon.dump(appJar, appClasses, "-Xbootclasspath/a:" + appJar, enableMultiRelease, jarVersion);
+ output.shouldContain("Loading classes to share: done.");
+ output.shouldHaveExitValue(0);
+
+ output = TestCommon.exec(appJar, "-Xbootclasspath/a:" + appJar, verboseMode, mainClass);
+ checkExecOutput(output, "I am running on version 7");
+
+ // 6. Sanity test case-insensitive "Multi-Release" attribute name
+ output = TestCommon.dump(appJar2, appClasses);
+ output.shouldContain("Loading classes to share: done.");
+ output.shouldHaveExitValue(0);
+
+ output = TestCommon.exec(appJar2, verboseMode, mainClass);
+ checkExecOutput(output, "I am running on version " + MAJOR_VERSION_STRING);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/OldClassTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,167 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary classes with major version < JDK_1.5 (48) should not be included in CDS
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.org.objectweb.asm
+ * java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java
+ * @run build TestCommon JarBuilder
+ * @run main OldClassTest
+ */
+
+import java.io.File;
+import java.io.FileOutputStream;
+import jdk.test.lib.process.OutputAnalyzer;
+import java.nio.file.Files;
+
+import java.util.*;
+import jdk.internal.org.objectweb.asm.*;
+
+public class OldClassTest implements Opcodes {
+
+ public static void main(String[] args) throws Exception {
+ File jarSrcFile = new File(JarBuilder.getOrCreateHelloJar());
+
+ File dir = new File(System.getProperty("test.classes", "."));
+ File jarFile = new File(dir, "OldClassTest_old.jar");
+ String jar = jarFile.getPath();
+
+ if (!jarFile.exists() || jarFile.lastModified() < jarSrcFile.lastModified()) {
+ createTestJarFile(jarSrcFile, jarFile);
+ } else {
+ System.out.println("Already up-to-date: " + jarFile);
+ }
+
+ String appClasses[] = TestCommon.list("Hello");
+
+ // CASE 1: pre-JDK 1.5 compiled classes should be excluded from the dump
+ OutputAnalyzer output = TestCommon.dump(jar, appClasses);
+ TestCommon.checkExecReturn(output, 0, true, "Pre JDK 1.5 class not supported by CDS");
+
+ output = TestCommon.execCommon(
+ "-cp", jar,
+ "-verbose:class",
+ "Hello");
+ TestCommon.checkExecReturn(output, 0, true, "Hello Unicode world (Old)");
+
+ // CASE 2: if we exlcude old version of this class, we should not pick up
+ // the newer version of this class in a subsequent classpath element.
+ String classpath = jar + File.pathSeparator + jarSrcFile.getPath();
+ output = TestCommon.dump(classpath, appClasses);
+ TestCommon.checkExecReturn(output, 0, true, "Pre JDK 1.5 class not supported by CDS");
+
+ output = TestCommon.execCommon(
+ "-cp", classpath,
+ "-verbose:class",
+ "Hello");
+ TestCommon.checkExecReturn(output, 0, true, "Hello Unicode world (Old)");
+ }
+
+ static void createTestJarFile(File jarSrcFile, File jarFile) throws Exception {
+ jarFile.delete();
+ Files.copy(jarSrcFile.toPath(), jarFile.toPath());
+
+ File dir = new File(System.getProperty("test.classes", "."));
+ File outdir = new File(dir, "old_class_test_classes");
+ outdir.delete();
+ outdir.mkdir();
+
+ writeClassFile(new File(outdir, "Hello.class"), makeOldHello());
+
+ JarBuilder.update(jarFile.getPath(), outdir.getPath());
+ }
+
+ static void writeClassFile(File file, byte bytecodes[]) throws Exception {
+ try (FileOutputStream fos = new FileOutputStream(file)) {
+ fos.write(bytecodes);
+ }
+ }
+
+/* makeOldHello() was obtained using JDK8. We use a method name > 128 that would
+ trigger a call to java.lang.Character.isJavaIdentifierStart() during class
+ file parsing.
+
+cat > Hello.java <<EOF
+public class Hello {
+ public static void main(String args[]) {
+ System.out.println(\u1234());
+ }
+ static String \u1234() {
+ return "Hello Unicode world (Old)";
+ }
+}
+EOF
+javac Hello.java
+java jdk.internal.org.objectweb.asm.util.ASMifier Hello.class
+
+ */
+
+ static byte[] makeOldHello() throws Exception {
+ ClassWriter cw = new ClassWriter(0);
+ FieldVisitor fv;
+ MethodVisitor mv;
+ AnnotationVisitor av0;
+
+//WAS cw.visit(V1_6, ACC_PUBLIC + ACC_SUPER, "Hello", null, "java/lang/Object", null);
+ cw.visit(V1_4, ACC_PUBLIC + ACC_SUPER, "Hello", null, "java/lang/Object", null);
+
+ {
+ mv = cw.visitMethod(ACC_PUBLIC, "<init>", "()V", null, null);
+ mv.visitCode();
+ mv.visitVarInsn(ALOAD, 0);
+ mv.visitMethodInsn(INVOKESPECIAL, "java/lang/Object", "<init>", "()V", false);
+ mv.visitInsn(RETURN);
+ mv.visitMaxs(1, 1);
+ mv.visitEnd();
+ }
+ {
+ mv = cw.visitMethod(ACC_PUBLIC + ACC_STATIC, "main", "([Ljava/lang/String;)V", null, null);
+ mv.visitCode();
+ mv.visitFieldInsn(GETSTATIC, "java/lang/System", "out", "Ljava/io/PrintStream;");
+ mv.visitMethodInsn(INVOKESTATIC, "Hello", "\u1234", "()Ljava/lang/String;", false);
+ mv.visitMethodInsn(INVOKEVIRTUAL, "java/io/PrintStream", "println", "(Ljava/lang/String;)V", false);
+ mv.visitInsn(RETURN);
+ mv.visitMaxs(2, 1);
+ mv.visitEnd();
+ }
+ {
+ mv = cw.visitMethod(ACC_STATIC, "\u1234", "()Ljava/lang/String;", null, null);
+ mv.visitCode();
+ mv.visitLdcInsn("Hello Unicode world (Old)");
+ mv.visitInsn(ARETURN);
+ mv.visitMaxs(1, 0);
+ mv.visitEnd();
+ }
+ cw.visitEnd();
+
+ return cw.toByteArray();
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/PackageSealing.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,60 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary AppCDS handling of package.
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * @compile test-classes/C1.java
+ * @compile test-classes/C2.java
+ * @compile test-classes/PackageSealingTest.java
+ * @run main PackageSealing
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class PackageSealing {
+ public static void main(String args[]) throws Exception {
+ String[] classList = {"sealed/pkg/C1", "pkg/C2", "PackageSealingTest"};
+ String appJar = ClassFileInstaller.writeJar("pkg_seal.jar",
+ ClassFileInstaller.Manifest.fromSourceFile("test-classes/package_seal.mf"),
+ "PackageSealingTest", "sealed/pkg/C1", "pkg/C2");
+
+ // test shared package from -cp path
+ TestCommon.testDump(appJar, TestCommon.list(classList));
+ OutputAnalyzer output;
+ output = TestCommon.exec(appJar, "PackageSealingTest");
+ TestCommon.checkExec(output, "OK");
+
+ // test shared package from -Xbootclasspath/a
+ TestCommon.dump(appJar, TestCommon.list(classList),
+ "-Xbootclasspath/a:" + appJar);
+ output = TestCommon.exec(appJar, "-Xbootclasspath/a:" + appJar, "PackageSealingTest");
+ TestCommon.checkExec(output, "OK");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/ParallelLoad2.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,64 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Load app classes from CDS archive in parallel threads. Similar to ParallelLoad.java, but each class in its own JAR
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/ParallelLoad.java
+ * @compile test-classes/ParallelClasses.java
+ * @run main ParallelLoad2
+ */
+
+import java.io.File;
+
+public class ParallelLoad2 {
+ public static int MAX_CLASSES = 40;
+ public static void main(String[] args) throws Exception {
+ JarBuilder.build("parallel_load2", "ParallelLoad", "ParallelLoadThread", "ParallelLoadWatchdog");
+ for (int i=0; i<MAX_CLASSES; i++) {
+ JarBuilder.build("parallel_load2_" + i, "ParallelClass" + i);
+ }
+
+ String cp = TestCommon.getTestJar("parallel_load2.jar");
+ for (int i=0; i<MAX_CLASSES; i++) {
+ cp += File.pathSeparator + TestCommon.getTestJar("parallel_load2_" + i + ".jar");
+ }
+
+ String[] class_list = new String[MAX_CLASSES + 2];
+ for (int i=0; i<MAX_CLASSES; i++) {
+ class_list[i] = "ParallelClass" + i;
+ }
+ class_list[class_list.length - 1] = "ParallelLoad";
+ class_list[class_list.length - 2] = "ParallelLoadThread";
+
+ TestCommon.test(cp, class_list,
+ "ParallelLoad");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/ParallelLoadTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,64 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Load app classes from CDS archive in parallel threads
+ * AppCDS does not support uncompressed oops
+ * @library /test/lib
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/ParallelLoad.java
+ * @compile test-classes/ParallelClasses.java
+ * @run main ParallelLoadTest
+ */
+
+public class ParallelLoadTest {
+ public static final int MAX_CLASSES = 40;
+
+ public static void main(String[] args) throws Exception {
+ JarBuilder.build("parallel_load", getClassList(true));
+ String appJar = TestCommon.getTestJar("parallel_load.jar");
+ TestCommon.test(appJar, getClassList(false), "ParallelLoad");
+ }
+
+ private static String[] getClassList(boolean includeWatchdog) {
+ int extra = includeWatchdog ? 3 : 2;
+ String[] classList = new String[MAX_CLASSES + extra];
+
+ int i;
+ for (i=0; i<MAX_CLASSES; i++) {
+ classList[i] = "ParallelClass" + i;
+ }
+
+ classList[i++] = "ParallelLoad";
+ classList[i++] = "ParallelLoadThread";
+ if (includeWatchdog)
+ classList[i++] = "ParallelLoadWatchdog";
+
+ return classList;
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/PrintSharedArchiveAndExit.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,148 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary test the -XX:+PrintSharedArchiveAndExit flag
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java
+ * @compile test-classes/HelloMore.java
+ * @run main/othervm/timeout=3600 PrintSharedArchiveAndExit
+ */
+
+import java.io.File;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class PrintSharedArchiveAndExit {
+ private static void check(OutputAnalyzer output, int ret, boolean checkContain, String... matches) throws Exception {
+ // Tests specific to this test
+ TestCommon.checkExecReturn(output, ret, checkContain, matches);
+
+ // In all test case, we should never print out the following due to
+ // PrintSharedArchiveAndExit. JVM should have been terminated
+ // before reaching these outputs.
+ TestCommon.checkExecReturn(output, ret, false,
+ "Usage:", // JVM help message
+ "java version", // JVM version
+ "Hello World"); // output from the Hello.class in hello.jar
+ }
+
+ private static void log(String msg) {
+ System.out.println(">---------------------------------------------------------------------");
+ System.out.println(msg);
+ System.out.println("<---------------------------------------------------------------------");
+ }
+
+ public static void main(String[] args) throws Exception {
+ String appJar = JarBuilder.getOrCreateHelloJar();
+ String appJar2 = JarBuilder.build("PrintSharedArchiveAndExit-more", "HelloMore");
+
+ String cp = appJar + File.pathSeparator + appJar2;
+ String lastCheckMsg = "checking shared classpath entry: " + appJar2; // the last JAR to check
+
+ TestCommon.testDump(cp, TestCommon.list("Hello"));
+
+ OutputAnalyzer output;
+
+ log("Normal execution -- all the JAR paths should be checked");
+ output = TestCommon.execCommon(
+ "-cp", cp,
+ "-XX:+PrintSharedArchiveAndExit");
+ check(output, 0, true, lastCheckMsg);
+
+ output = TestCommon.execCommon(
+ "-cp", cp,
+ "-XX:+PrintSharedArchiveAndExit",
+ "-XX:+PrintSharedDictionary"); // Test PrintSharedDictionary as well.
+ check(output, 0, true, lastCheckMsg, "java.lang.Object");
+
+ log("Normal execution -- Make sure -version, help message and app main()\n" +
+ "class are not invoked. These are checked inside check().");
+ output = TestCommon.execCommon("-cp", cp, "-XX:+PrintSharedArchiveAndExit", "-version");
+ check(output, 0, true, lastCheckMsg);
+
+ output = TestCommon.execCommon("-cp", cp, "-XX:+PrintSharedArchiveAndExit", "-help");
+ check(output, 0, true, lastCheckMsg);
+
+ output = TestCommon.execCommon("-cp", cp, "-XX:+PrintSharedArchiveAndExit", "Hello");
+ check(output, 0, true, lastCheckMsg);
+
+ log("Execution with simple errors -- with 'simple' errors like missing or modified\n" +
+ "JAR files, the VM should try to continue to print the remaining information.\n" +
+ "Use an invalid Boot CP -- all the JAR paths should be checked");
+ output = TestCommon.execCommon(
+ "-cp", cp,
+ "-Xbootclasspath/a:foo.jar",
+ "-XX:+PrintSharedArchiveAndExit");
+ check(output, 1, true, lastCheckMsg, "[BOOT classpath mismatch, ");
+
+ log("Use an App CP shorter than the one at dump time -- all the JAR paths should be checked");
+ output = TestCommon.execCommon(
+ "-cp", ".",
+ "-XX:+PrintSharedArchiveAndExit");
+ check(output, 1, true, lastCheckMsg, "Run time APP classpath is shorter than the one at dump time: .");
+
+ log("Use an invalid App CP -- all the JAR paths should be checked");
+ String invalidCP = "non-existing-dir" + File.pathSeparator + cp;
+ output = TestCommon.execCommon(
+ "-cp", invalidCP,
+ "-XX:+PrintSharedArchiveAndExit");
+ check(output, 1, true, lastCheckMsg, "APP classpath mismatch, actual: -Djava.class.path=" + invalidCP);
+
+ log("Changed modification time of hello.jar -- all the JAR paths should be checked");
+ (new File(appJar)).setLastModified(System.currentTimeMillis() + 2000);
+ output = TestCommon.execCommon(
+ "-cp", cp,
+ "-XX:+PrintSharedArchiveAndExit");
+ check(output, 1, true, lastCheckMsg, "[Timestamp mismatch]");
+
+ log("Even if hello.jar is out of date, we should still be able to print the dictionary.");
+ output = TestCommon.execCommon(
+ "-cp", cp,
+ "-XX:+PrintSharedArchiveAndExit",
+ "-XX:+PrintSharedDictionary"); // Test PrintSharedDictionary as well.
+ check(output, 1, true, lastCheckMsg, "java.lang.Object");
+
+
+ log("Remove hello.jar -- all the JAR paths should be checked");
+ (new File(appJar)).delete();
+ output = TestCommon.execCommon(
+ "-cp", cp,
+ "-XX:+PrintSharedArchiveAndExit");
+ check(output, 1, true, lastCheckMsg, "[Required classpath entry does not exist: " + appJar + "]");
+
+ log("Execution with major errors -- with 'major' errors like the JSA file\n" +
+ "is missing, we should stop immediately to avoid crashing the JVM.");
+ output = TestCommon.execCommon(
+ "-cp", cp,
+ "-XX:+PrintSharedArchiveAndExit",
+ "-XX:SharedArchiveFile=./no-such-fileappcds.jsa");
+ check(output, 1, false, lastCheckMsg);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/ProhibitedPackage.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,101 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary AppCDS handling of prohibited package.
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/ProhibitedHelper.java test-classes/Prohibited.jasm
+ * @run main ProhibitedPackage
+ */
+
+import jdk.test.lib.Platform;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class ProhibitedPackage {
+
+ public static void main(String[] args) throws Exception {
+ JarBuilder.build("prohibited_pkg", "java/lang/Prohibited", "ProhibitedHelper");
+
+ String appJar = TestCommon.getTestJar("prohibited_pkg.jar");
+
+ // AppCDS for custom loader is only supported on linux-x64 and
+ // Solaris 64-bit platforms.
+ if ((Platform.isLinux() || Platform.isSolaris()) &&
+ Platform.is64bit()) {
+ String classlist[] = new String[] {
+ "java/lang/Object id: 1",
+ "java/lang/Prohibited id: 2 super: 1 source: " + appJar
+ };
+
+ // Make sure a class in a prohibited package for a custom loader
+ // will be ignored during dumping.
+ TestCommon.dump(appJar,
+ classlist,
+ "-XX:+PrintSystemDictionaryAtExit")
+ .shouldContain("Dumping")
+ .shouldNotContain("java.lang.Prohibited")
+ .shouldHaveExitValue(0);
+ }
+
+
+ // Make sure a class in a prohibited package for a non-custom loader
+ // will be ignored during dumping.
+ TestCommon.dump(appJar,
+ TestCommon.list("java/lang/Prohibited", "ProhibitedHelper"),
+ "-XX:+PrintSystemDictionaryAtExit")
+ .shouldContain("Dumping")
+ .shouldNotContain("java.lang.Prohibited")
+ .shouldHaveExitValue(0);
+
+ // Try loading the class in a prohibited package with various -Xshare
+ // modes. The class shouldn't be loaded and appropriate exceptions
+ // are expected.
+
+ OutputAnalyzer output;
+
+ // -Xshare:on
+ output = TestCommon.execCommon(
+ "-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI",
+ "-cp", appJar, "-Xlog:class+load=info", "ProhibitedHelper");
+ TestCommon.checkExec(output, "Prohibited package name: java.lang");
+
+ // -Xshare:auto
+ output = TestCommon.execAuto(
+ "-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI",
+ "-cp", appJar, "-Xlog:class+load=info", "ProhibitedHelper");
+ TestCommon.checkExec(output, "Prohibited package name: java.lang");
+
+ // -Xshare:off
+ output = TestCommon.execOff(
+ "-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI",
+ "-cp", appJar, "-Xlog:class+load=info", "ProhibitedHelper");
+ output.shouldContain("Prohibited package name: java.lang");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/ProtectionDomain.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,73 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary AppCDS handling of protection domain.
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/ProtDomain.java
+ * @compile test-classes/ProtDomainB.java
+ * @compile test-classes/JimageClassProtDomain.java
+ * @run main ProtectionDomain
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class ProtectionDomain {
+ public static void main(String[] args) throws Exception {
+ JarBuilder.build("prot_domain", "ProtDomain", "ProtDomainB", "ProtDomainOther",
+ "ProtDomainBOther", "JimageClassProtDomain");
+
+ String appJar = TestCommon.getTestJar("prot_domain.jar");
+ TestCommon.testDump(appJar,
+ TestCommon.list("ProtDomain",
+ "ProtDomainBOther",
+ "java/util/Dictionary",
+ "sun/tools/javac/Main",
+ "jdk/nio/zipfs/ZipInfo",
+ "java/net/URL",
+ "sun/rmi/rmic/Main",
+ "com/sun/jndi/dns/DnsName"));
+
+ OutputAnalyzer output;
+
+ // First class is loaded from CDS, second class is loaded from JAR
+ output = TestCommon.exec(appJar, "-verbose:class", "ProtDomain");
+ TestCommon.checkExec(output, "Protection Domains match");
+
+ // First class is loaded from JAR, second class is loaded from CDS
+ output = TestCommon.exec(appJar, "-verbose:class", "ProtDomainB");
+ TestCommon.checkExec(output, "Protection Domains match");
+
+ // Test ProtectionDomain for application and extension module classes from the
+ // "modules" jimage
+ output = TestCommon.exec(appJar, "-verbose:class", "JimageClassProtDomain");
+ output.shouldNotContain("Failed: Protection Domains do not match");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/RewriteBytecodesTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,65 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Use ClassLoader.defineClass() to load a class with rewritten bytecode. Make sure
+ * the archived class with the same name is not loaded.
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/RewriteBytecodes.java test-classes/Util.java test-classes/Super.java test-classes/Child.java
+ * @build sun.hotspot.WhiteBox
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @run main RewriteBytecodesTest
+ */
+
+import java.io.File;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class RewriteBytecodesTest {
+ public static void main(String[] args) throws Exception {
+ String wbJar = JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox");
+ String use_whitebox_jar = "-Xbootclasspath/a:" + wbJar;
+
+ String appJar = JarBuilder.build("dynamic_define", "RewriteBytecodes", "Util", "Super", "Child");
+ String superClsFile = (new File(System.getProperty("test.classes", "."), "Super.class")).getPath();
+
+ TestCommon.dump(appJar, TestCommon.list("RewriteBytecodes", "Super", "Child"),
+ // command-line arguments ...
+ use_whitebox_jar);
+
+ OutputAnalyzer output = TestCommon.exec(appJar,
+ // command-line arguments ...
+ "--add-opens=java.base/java.lang=ALL-UNNAMED",
+ use_whitebox_jar,
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+WhiteBoxAPI",
+ "RewriteBytecodes", superClsFile);
+ TestCommon.checkExec(output);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/SharedArchiveConsistency.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,386 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary SharedArchiveConsistency
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.compiler
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * jdk.internal.jvmstat/sun.jvmstat.monitor
+ * @build sun.hotspot.WhiteBox
+ * @compile test-classes/Hello.java
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @run main/othervm -Xbootclasspath/a:. -XX:+UnlockDiagnosticVMOptions -XX:+WhiteBoxAPI SharedArchiveConsistency
+ */
+import jdk.test.lib.process.OutputAnalyzer;
+import jdk.test.lib.Utils;
+import java.io.File;
+import java.io.FileInputStream;
+import java.io.FileOutputStream;
+import java.io.IOException;
+import java.nio.ByteBuffer;
+import java.nio.ByteOrder;
+import java.nio.channels.FileChannel;
+import java.nio.file.Files;
+import java.nio.file.Path;
+import java.nio.file.Paths;
+import static java.nio.file.StandardCopyOption.REPLACE_EXISTING;
+import java.nio.file.StandardOpenOption;
+import static java.nio.file.StandardOpenOption.READ;
+import static java.nio.file.StandardOpenOption.WRITE;
+import java.util.ArrayList;
+import java.util.HashSet;
+import java.util.List;
+import java.util.Random;
+import sun.hotspot.WhiteBox;
+
+public class SharedArchiveConsistency {
+ public static WhiteBox wb;
+ public static int offset_magic; // FileMapHeader::_magic
+ public static int sp_offset_crc; // FileMapHeader::space_info::_crc
+ public static int file_header_size = -1;// total size of header, variant, need calculation
+ public static int space_info_size; // size of space_info
+ public static int sp_offset; // offset of FileMapHeader::space_info
+ public static int sp_used_offset; // offset of space_info::_used
+ public static int size_t_size; // size of size_t
+
+ public static File jsa; // will be updated during test
+ public static File orgJsaFile; // kept the original file not touched.
+ public static String[] shared_region_name = {"MiscCode", "ReadWrite", "ReadOnly", "MiscData"};
+ public static int num_regions = shared_region_name.length;
+ public static String[] matchMessages = {
+ "Unable to use shared archive",
+ "An error has occurred while processing the shared archive file.",
+ "Checksum verification failed.",
+ "The shared archive file has been truncated."
+ };
+
+ public static void getFileOffsetInfo() throws Exception {
+ wb = WhiteBox.getWhiteBox();
+ offset_magic = wb.getOffsetForName("FileMapHeader::_magic");
+ sp_offset_crc = wb.getOffsetForName("space_info::_crc");
+ try {
+ int nonExistOffset = wb.getOffsetForName("FileMapHeader::_non_exist_offset");
+ System.exit(-1); // should fail
+ } catch (Exception e) {
+ // success
+ }
+
+ sp_offset = wb.getOffsetForName("FileMapHeader::_space[0]") - offset_magic;
+ sp_used_offset = wb.getOffsetForName("space_info::_used") - sp_offset_crc;
+ size_t_size = wb.getOffsetForName("size_t_size");
+ space_info_size = wb.getOffsetForName("space_info_size");
+ }
+
+ public static int getFileHeaderSize(FileChannel fc) throws Exception {
+ if (file_header_size != -1) {
+ return file_header_size;
+ }
+ // this is not real header size, it is struct size
+ file_header_size = wb.getOffsetForName("file_header_size");
+ int offset_path_misc_info = wb.getOffsetForName("FileMapHeader::_paths_misc_info_size") -
+ offset_magic;
+ int path_misc_info_size = (int)readInt(fc, offset_path_misc_info, size_t_size);
+ file_header_size += path_misc_info_size; //readInt(fc, offset_path_misc_info, size_t_size);
+ System.out.println("offset_path_misc_info = " + offset_path_misc_info);
+ System.out.println("path_misc_info_size = " + path_misc_info_size);
+ System.out.println("file_header_size = " + file_header_size);
+ file_header_size = (int)align_up_page(file_header_size);
+ System.out.println("file_header_size (aligned to page) = " + file_header_size);
+ return file_header_size;
+ }
+
+ public static long align_up_page(long l) throws Exception {
+ // wb is obtained in getFileOffsetInfo() which is called first in main() else we should call
+ // WhiteBox.getWhiteBox() here first.
+ int pageSize = wb.getVMPageSize();
+ return (l + pageSize -1) & (~ (pageSize - 1));
+ }
+
+ private static long getRandomBetween(long start, long end) throws Exception {
+ if (start > end) {
+ throw new IllegalArgumentException("start must be less than end");
+ }
+ Random aRandom = Utils.getRandomInstance();
+ int d = aRandom.nextInt((int)(end - start));
+ if (d < 1) {
+ d = 1;
+ }
+ return start + d;
+ }
+
+ public static long readInt(FileChannel fc, long offset, int nbytes) throws Exception {
+ ByteBuffer bb = ByteBuffer.allocate(nbytes);
+ bb.order(ByteOrder.nativeOrder());
+ fc.position(offset);
+ fc.read(bb);
+ return (nbytes > 4 ? bb.getLong(0) : bb.getInt(0));
+ }
+
+ public static void writeData(FileChannel fc, long offset, ByteBuffer bb) throws Exception {
+ fc.position(offset);
+ fc.write(bb);
+ fc.force(true);
+ }
+
+ public static FileChannel getFileChannel() throws Exception {
+ List<StandardOpenOption> arry = new ArrayList<StandardOpenOption>();
+ arry.add(READ);
+ arry.add(WRITE);
+ return FileChannel.open(jsa.toPath(), new HashSet<StandardOpenOption>(arry));
+ }
+
+ public static void modifyJsaContentRandomly() throws Exception {
+ FileChannel fc = getFileChannel();
+ // corrupt random area in the data areas (MiscCode, ReadWrite, ReadOnly, MiscData)
+ long[] used = new long[num_regions]; // record used bytes
+ long start0, start, end, off;
+ int used_offset, path_info_size;
+
+ int bufSize;
+ System.out.printf("%-12s%-12s%-12s%-12s%-12s\n", "Space Name", "Offset", "Used bytes", "Reg Start", "Random Offset");
+ start0 = getFileHeaderSize(fc);
+ for (int i = 0; i < num_regions; i++) {
+ used_offset = sp_offset + space_info_size * i + sp_used_offset;
+ // read 'used'
+ used[i] = readInt(fc, used_offset, size_t_size);
+ start = start0;
+ for (int j = 0; j < i; j++) {
+ start += align_up_page(used[j]);
+ }
+ end = start + used[i];
+ off = getRandomBetween(start, end);
+ System.out.printf("%-12s%-12d%-12d%-12d%-12d\n", shared_region_name[i], used_offset, used[i], start, off);
+ if (end - off < 1024) {
+ bufSize = (int)(end - off + 1);
+ } else {
+ bufSize = 1024;
+ }
+ ByteBuffer bbuf = ByteBuffer.wrap(new byte[bufSize]);
+ writeData(fc, off, bbuf);
+ }
+ if (fc.isOpen()) {
+ fc.close();
+ }
+ }
+
+ public static void modifyJsaContent() throws Exception {
+ FileChannel fc = getFileChannel();
+ byte[] buf = new byte[4096];
+ ByteBuffer bbuf = ByteBuffer.wrap(buf);
+
+ long total = 0L;
+ long used_offset = 0L;
+ long[] used = new long[num_regions];
+ System.out.printf("%-12s%-12s\n", "Space name", "Used bytes");
+ for (int i = 0; i < num_regions; i++) {
+ used_offset = sp_offset + space_info_size* i + sp_used_offset;
+ // read 'used'
+ used[i] = readInt(fc, used_offset, size_t_size);
+ System.out.printf("%-12s%-12d\n", shared_region_name[i], used[i]);
+ total += used[i];
+ }
+ System.out.printf("%-12s%-12d\n", "Total: ", total);
+ long corrupt_used_offset = getFileHeaderSize(fc);
+ System.out.println("Corrupt RO section, offset = " + corrupt_used_offset);
+ while (used_offset < used[0]) {
+ writeData(fc, corrupt_used_offset, bbuf);
+ bbuf.clear();
+ used_offset += 4096;
+ }
+ fc.force(true);
+ if (fc.isOpen()) {
+ fc.close();
+ }
+ }
+
+ public static void modifyJsaHeader() throws Exception {
+ FileChannel fc = getFileChannel();
+ // screw up header info
+ byte[] buf = new byte[getFileHeaderSize(fc)];
+ ByteBuffer bbuf = ByteBuffer.wrap(buf);
+ writeData(fc, 0L, bbuf);
+ if (fc.isOpen()) {
+ fc.close();
+ }
+ }
+
+ public static void copyFile(File from, File to) throws Exception {
+ if (to.exists()) {
+ if(!to.delete()) {
+ throw new IOException("Could not delete file " + to);
+ }
+ }
+ to.createNewFile();
+ setReadWritePermission(to);
+ Files.copy(from.toPath(), to.toPath(), REPLACE_EXISTING);
+ }
+
+ // Copy file with bytes deleted or inserted
+ // del -- true, deleted, false, inserted
+ public static void copyFile(File from, File to, boolean del) throws Exception {
+ FileChannel inputChannel = null;
+ FileChannel outputChannel = null;
+ try {
+ inputChannel = new FileInputStream(from).getChannel();
+ outputChannel = new FileOutputStream(to).getChannel();
+ long size = inputChannel.size();
+ int init_size = getFileHeaderSize(inputChannel);
+ outputChannel.transferFrom(inputChannel, 0, init_size);
+ int n = (int)getRandomBetween(0, 1024);
+ if (del) {
+ System.out.println("Delete " + n + " bytes at data start section");
+ inputChannel.position(init_size + n);
+ outputChannel.transferFrom(inputChannel, init_size, size - init_size - n);
+ } else {
+ System.out.println("Insert " + n + " bytes at data start section");
+ outputChannel.position(init_size);
+ outputChannel.write(ByteBuffer.wrap(new byte[n]));
+ outputChannel.transferFrom(inputChannel, init_size + n , size - init_size);
+ }
+ } finally {
+ inputChannel.close();
+ outputChannel.close();
+ }
+ }
+
+ public static void restoreJsaFile() throws Exception {
+ Files.copy(orgJsaFile.toPath(), jsa.toPath(), REPLACE_EXISTING);
+ }
+
+ public static void setReadWritePermission(File file) throws Exception {
+ if (!file.canRead()) {
+ if (!file.setReadable(true)) {
+ throw new IOException("Cannot modify file " + file + " as readable");
+ }
+ }
+ if (!file.canWrite()) {
+ if (!file.setWritable(true)) {
+ throw new IOException("Cannot modify file " + file + " as writable");
+ }
+ }
+ }
+
+ public static void testAndCheck(String[] execArgs) throws Exception {
+ OutputAnalyzer output = TestCommon.execCommon(execArgs);
+ String stdtxt = output.getOutput();
+ System.out.println("Note: this test may fail in very rare occasions due to CRC32 checksum collision");
+ for (String message : matchMessages) {
+ if (stdtxt.contains(message)) {
+ // match any to return
+ return;
+ }
+ }
+ TestCommon.checkExec(output);
+ }
+
+ // dump with hello.jsa, then
+ // read the jsa file
+ // 1) run normal
+ // 2) modify header
+ // 3) keep header correct but modify content
+ // 4) update both header and content, test
+ // 5) delete bytes in data begining
+ // 6) insert bytes in data begining
+ // 7) randomly corrupt data in four areas: RO, RW. MISC DATA, MISC CODE
+ public static void main(String... args) throws Exception {
+ // must call to get offset info first!!!
+ getFileOffsetInfo();
+ Path currentRelativePath = Paths.get("");
+ String currentDir = currentRelativePath.toAbsolutePath().toString();
+ System.out.println("Current relative path is: " + currentDir);
+ // get jar file
+ String jarFile = JarBuilder.getOrCreateHelloJar();
+
+ // dump (appcds.jsa created)
+ TestCommon.testDump(jarFile, null);
+
+ // test, should pass
+ System.out.println("1. Normal, should pass but may fail\n");
+ String[] execArgs = {"-cp", jarFile, "Hello"};
+
+ OutputAnalyzer output = TestCommon.execCommon(execArgs);
+
+ try {
+ TestCommon.checkExecReturn(output, 0, true, "Hello World");
+ } catch (Exception e) {
+ TestCommon.checkExecReturn(output, 1, true, matchMessages[0]);
+ }
+
+ // get current archive name
+ jsa = new File(TestCommon.getCurrentArchiveName());
+ if (!jsa.exists()) {
+ throw new IOException(jsa + " does not exist!");
+ }
+
+ setReadWritePermission(jsa);
+
+ // save as original untouched
+ orgJsaFile = new File(new File(currentDir), "appcds.jsa.bak");
+ copyFile(jsa, orgJsaFile);
+
+
+ // modify jsa header, test should fail
+ System.out.println("\n2. Corrupt header, should fail\n");
+ modifyJsaHeader();
+ output = TestCommon.execCommon(execArgs);
+ output.shouldContain("The shared archive file has the wrong version");
+ output.shouldNotContain("Checksum verification failed");
+
+ // modify content
+ System.out.println("\n3. Corrupt Content, should fail\n");
+ copyFile(orgJsaFile, jsa);
+ modifyJsaContent();
+ testAndCheck(execArgs);
+
+ // modify both header and content, test should fail
+ System.out.println("\n4. Corrupt Header and Content, should fail\n");
+ copyFile(orgJsaFile, jsa);
+ modifyJsaHeader();
+ modifyJsaContent(); // this will not be reached since failed on header change first
+ output = TestCommon.execCommon(execArgs);
+ output.shouldContain("The shared archive file has the wrong version");
+ output.shouldNotContain("Checksum verification failed");
+
+ // delete bytes in data sectoin
+ System.out.println("\n5. Delete bytes at begining of data section, should fail\n");
+ copyFile(orgJsaFile, jsa, true);
+ testAndCheck(execArgs);
+
+ // insert bytes in data sectoin forward
+ System.out.println("\n6. Insert bytes at begining of data section, should fail\n");
+ copyFile(orgJsaFile, jsa, false);
+ testAndCheck(execArgs);
+
+ System.out.println("\n7. modify Content in random areas, should fail\n");
+ copyFile(orgJsaFile, jsa);
+ modifyJsaContentRandomly();
+ testAndCheck(execArgs);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/SharedArchiveFile.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,83 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+/*
+ * @test
+ * @summary The diagnostic option, -XX:SharedArchiveFile can be unlocked using -XX:+UseAppCDS
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java
+ * @run main SharedArchiveFile
+ */
+
+import jdk.test.lib.Platform;
+import jdk.test.lib.cds.CDSTestUtils;
+import jdk.test.lib.process.OutputAnalyzer;
+import jdk.test.lib.process.ProcessTools;
+import java.util.Properties;
+
+public class SharedArchiveFile {
+ public static void main(String[] args) throws Exception {
+ boolean isProduct = !Platform.isDebugBuild();
+ String appJar = JarBuilder.getOrCreateHelloJar();
+
+ // 1) Using -XX:SharedArchiveFile without -XX:+UseAppCDS should fail
+ // on product binary without -XX:+UnlockDiagnosticVMOptions.
+ if (isProduct) {
+ ProcessBuilder pb = ProcessTools.createJavaProcessBuilder(true,
+ "-XX:SharedArchiveFile=./SharedArchiveFile.jsa", "-Xshare:dump");
+ OutputAnalyzer out = CDSTestUtils.executeAndLog(pb, "dump");
+ out.shouldContain("Error: VM option 'SharedArchiveFile' is diagnostic and must be enabled via -XX:+UnlockDiagnosticVMOptions.");
+ }
+
+ // 2) Dumping with -XX:+UnlockDiagnosticVMOptions -XX:SharedArchiveFile
+ // should always succeed.
+ CDSTestUtils.createArchive("-XX:+UnlockDiagnosticVMOptions")
+ .shouldContain("Dumping");
+
+ // 3) Using -XX:SharedArchiveFile with -XX:+UseAppCDS should work
+ // on product binary by default.
+ OutputAnalyzer output3 = TestCommon.dump(appJar, TestCommon.list("Hello"));
+ output3.shouldContain("Dumping");
+ output3 = TestCommon.exec(appJar, "Hello");
+ TestCommon.checkExec(output3, "Hello World");
+
+ // 4) Using -XX:+UseAppCDS should not affect other diagnostic flags,
+ // such as LogEvents
+ OutputAnalyzer output4 = TestCommon.exec(appJar, "-XX:+LogEvents", "Hello");
+ if (isProduct) {
+ output4.shouldContain("Error: VM option 'LogEvents' is diagnostic and must be enabled via -XX:+UnlockDiagnosticVMOptions.");
+ } else {
+ TestCommon.checkExec(output4, "Hello World");
+ }
+
+ // 5) 8066921 - Extra -XX:+UseAppCDS
+ TestCommon.testDump(appJar, TestCommon.list("Hello"), "-XX:+UseAppCDS");
+ OutputAnalyzer output5 = TestCommon.exec(appJar, "-XX:+UseAppCDS", "Hello");
+ TestCommon.checkExec(output5);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/SharedBaseAddress.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,65 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test SharedBaseAddress
+ * @summary Test variety of values for SharedBaseAddress, in AppCDS mode,
+ * making sure VM handles normal values as well as edge values
+ * w/o a crash.
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java
+ * @run main/timeout=240 SharedBaseAddress
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class SharedBaseAddress {
+
+ // shared base address test table
+ private static final String[] testTable = {
+ "1g", "8g", "64g","512g", "4t",
+ "32t", "128t", "0",
+ "1", "64k", "64M"
+ };
+
+ public static void main(String[] args) throws Exception {
+ String appJar = JarBuilder.getOrCreateHelloJar();
+
+ for (String testEntry : testTable) {
+ System.out.println("sharedBaseAddress = " + testEntry);
+
+ OutputAnalyzer dumpOutput = TestCommon.dump(
+ appJar, new String[] {"Hello"}, "-XX:SharedBaseAddress=" + testEntry);
+ TestCommon.checkDump(dumpOutput, "Loading classes to share");
+
+ OutputAnalyzer execOutput = TestCommon.exec(appJar, "Hello");
+ TestCommon.checkExec(execOutput, "Hello World");
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/SharedPackages.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,79 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary AppCDS handling of package.
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/PackageTest.java
+ * @compile test-classes/JimageClassPackage.java
+ * @run main SharedPackages
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class SharedPackages {
+ public static void main(String[] args) throws Exception {
+ JarBuilder.build("pkg", "p/PackageTest", "JimageClassPackage");
+
+ String appJar = TestCommon.getTestJar("pkg.jar");
+ TestCommon.testDump(appJar, TestCommon.list("p/PackageTest",
+ "java/util/Dictionary",
+ "sun/tools/javac/Main",
+ "jdk/nio/zipfs/ZipInfo",
+ "java/net/URL",
+ "sun/rmi/rmic/Main",
+ "com/sun/jndi/dns/DnsName"));
+
+ OutputAnalyzer output;
+
+ // Test 1: shared class from Jar on the -cp
+ output = TestCommon.exec(appJar, "-verbose:class", "p.PackageTest");
+ TestCommon.checkExec(output, "Expected package");
+ if (!TestCommon.isUnableToMap(output))
+ output.shouldContain("Package is not sealed");
+
+ // Test 2: shared classes from "modules" jimage
+ output = TestCommon.exec(appJar, "-verbose:class",
+ "JimageClassPackage");
+ if (!TestCommon.isUnableToMap(output)) {
+ output.shouldNotContain("Unexpected package");
+ output.shouldNotContain("Package is not sealed");
+ }
+
+ // Test 3: shared class from Jar on the -Xbootclasspath/a
+ TestCommon.dump(
+ appJar, TestCommon.list("p/PackageTest"), "-Xbootclasspath/a:" + appJar);
+ output = TestCommon.exec(appJar, "-Xbootclasspath/a:" + appJar, "p.PackageTest");
+ if (!TestCommon.isUnableToMap(output)) {
+ output.shouldNotContain("Unexpected package");
+ output.shouldContain("Package is not sealed");
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/SignedJar.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,69 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary AppCDS handling of signed JAR.
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java
+ * @run main SignedJar
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+import java.io.File;
+
+public class SignedJar {
+ public static void main(String[] args) throws Exception {
+ String unsignedJar = JarBuilder.getOrCreateHelloJar();
+ JarBuilder.signJar();
+
+ // Test class exists in signed JAR
+ String signedJar = TestCommon.getTestJar("signed_hello.jar");
+ OutputAnalyzer output;
+ output = TestCommon.dump(signedJar, TestCommon.list("Hello"));
+ TestCommon.checkDump(output, "Preload Warning: Skipping Hello from signed JAR");
+
+ // At runtime, the Hello class should be loaded from the jar file
+ // instead of from the shared archive since a class from a signed
+ // jar shouldn't be dumped into the archive.
+ output = TestCommon.exec(signedJar, "-verbose:class", "Hello");
+ String expectedOutput = ".class,load. Hello source: file:.*signed_hello.jar";
+
+ try {
+ output.shouldMatch(expectedOutput);
+ } catch (Exception e) {
+ TestCommon.checkCommonExecExceptions(output, e);
+ }
+
+ // Test class exists in both signed JAR and unsigned JAR
+ String jars = signedJar + System.getProperty("path.separator") + unsignedJar;
+ output = TestCommon.dump(jars, TestCommon.list("Hello"));
+ TestCommon.checkDump(output, "Preload Warning: Skipping Hello from signed JAR");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/SpecifySysLoaderProp.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,107 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary If -Djava.system.class.loader=xxx is specified in command-line, disable UseAppCDS
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/TestClassLoader.java
+ * @compile test-classes/ReportMyLoader.java
+ * @compile test-classes/TrySwitchMyLoader.java
+ * @run main SpecifySysLoaderProp
+ */
+
+import java.io.*;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class SpecifySysLoaderProp {
+
+ public static void main(String[] args) throws Exception {
+ JarBuilder.build("sysloader", "TestClassLoader", "ReportMyLoader", "TrySwitchMyLoader");
+
+ String jarFileName = "sysloader.jar";
+ String appJar = TestCommon.getTestJar(jarFileName);
+ TestCommon.testDump(appJar, TestCommon.list("ReportMyLoader"));
+ String warning = "VM warning: UseAppCDS is disabled because the java.system.class.loader property is specified";
+
+
+ // (0) Baseline. Do not specify -Djava.system.class.loader
+ // The test class should be loaded from archive
+ OutputAnalyzer output = TestCommon.execCommon(
+ "-verbose:class",
+ "-cp", appJar,
+ "ReportMyLoader");
+ TestCommon.checkExec(output,
+ "[class,load] ReportMyLoader source: shared objects file",
+ "ReportMyLoader's loader = jdk.internal.loader.ClassLoaders$AppClassLoader@");
+
+ // (1) Try to execute the archive with -Djava.system.class.loader=no.such.Klass,
+ // it should fail
+ output = TestCommon.execCommon(
+ "-cp", appJar,
+ "-Djava.system.class.loader=no.such.Klass",
+ "ReportMyLoader");
+ try {
+ output.shouldContain(warning);
+ output.shouldContain("ClassNotFoundException: no.such.Klass");
+ } catch (Exception e) {
+ TestCommon.checkCommonExecExceptions(output, e);
+ }
+
+ // (2) Try to execute the archive with -Djava.system.class.loader=TestClassLoader,
+ // it should run, but AppCDS should be disabled
+ output = TestCommon.execCommon(
+ "-verbose:class",
+ "-cp", appJar,
+ "-Djava.system.class.loader=TestClassLoader",
+ "ReportMyLoader");
+ TestCommon.checkExec(output,
+ "ReportMyLoader's loader = jdk.internal.loader.ClassLoaders$AppClassLoader@", //<-this is still printed because TestClassLoader simply delegates to Launcher$AppLoader, but ...
+ "TestClassLoader.called = true", //<-but this proves that TestClassLoader was indeed called.
+ "TestClassLoader: loadClass(\"ReportMyLoader\","); //<- this also proves that TestClassLoader was indeed called.
+ try {
+ output.shouldMatch(".class,load. TestClassLoader source: file:");
+ output.shouldMatch(".class,load. ReportMyLoader source: file:.*" + jarFileName);
+ } catch (Exception e) {
+ TestCommon.checkCommonExecExceptions(output, e);
+ }
+
+ // (3) Try to change the java.system.class.loader programmatically after
+ // the app's main method is executed. This should have no effect in terms of
+ // changing or switching the actual system class loader that's already in use.
+ output = TestCommon.execCommon(
+ "-verbose:class",
+ "-cp", appJar,
+ "TrySwitchMyLoader");
+ TestCommon.checkExec(output,
+ "[class,load] ReportMyLoader source: shared objects file",
+ "TrySwitchMyLoader's loader = jdk.internal.loader.ClassLoaders$AppClassLoader@",
+ "ReportMyLoader's loader = jdk.internal.loader.ClassLoaders$AppClassLoader@",
+ "TestClassLoader.called = false");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/TestCommon.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,339 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import jdk.test.lib.Utils;
+import jdk.test.lib.JDKToolFinder;
+import jdk.test.lib.Platform;
+import jdk.test.lib.cds.CDSOptions;
+import jdk.test.lib.cds.CDSTestUtils;
+import jdk.test.lib.process.ProcessTools;
+import jdk.test.lib.process.OutputAnalyzer;
+import java.io.File;
+import java.text.SimpleDateFormat;
+import java.util.ArrayList;
+import java.util.Date;
+
+/**
+ * This is a test utility class for common AppCDS test functionality.
+ *
+ * Various methods use (String ...) for passing VM options. Note that the order
+ * of the VM options are important in certain cases. Many methods take arguments like
+ *
+ * (String prefix[], String suffix[], String... opts)
+ *
+ * Note that the order of the VM options is:
+ *
+ * prefix + opts + suffix
+ */
+public class TestCommon extends CDSTestUtils {
+ private static final String JSA_FILE_PREFIX = System.getProperty("user.dir") +
+ File.separator + "appcds-";
+
+ private static final SimpleDateFormat timeStampFormat =
+ new SimpleDateFormat("HH'h'mm'm'ss's'SSS");
+
+ private static final String timeoutFactor =
+ System.getProperty("test.timeout.factor", "1.0");
+
+ private static String currentArchiveName;
+
+ // Call this method to start new archive with new unique name
+ public static void startNewArchiveName() {
+ deletePriorArchives();
+ currentArchiveName = JSA_FILE_PREFIX +
+ timeStampFormat.format(new Date()) + ".jsa";
+ }
+
+ // Call this method to get current archive name
+ public static String getCurrentArchiveName() {
+ return currentArchiveName;
+ }
+
+ // Attempt to clean old archives to preserve space
+ // Archives are large artifacts (20Mb or more), and much larger than
+ // most other artifacts created in jtreg testing.
+ // Therefore it is a good idea to clean the old archives when they are not needed.
+ // In most cases the deletion attempt will succeed; on rare occasion the
+ // delete operation will fail since the system or VM process still holds a handle
+ // to the file; in such cases the File.delete() operation will silently fail, w/o
+ // throwing an exception, thus allowing testing to continue.
+ public static void deletePriorArchives() {
+ File dir = new File(System.getProperty("user.dir"));
+ String files[] = dir.list();
+ for (String name : files) {
+ if (name.startsWith("appcds-") && name.endsWith(".jsa")) {
+ if (!(new File(dir, name)).delete())
+ System.out.println("deletePriorArchives(): delete failed for file " + name);
+ }
+ }
+ }
+
+
+ // Create AppCDS archive using most common args - convenience method
+ // Legacy name preserved for compatibility
+ public static OutputAnalyzer dump(String appJar, String appClasses[],
+ String... suffix) throws Exception {
+ return createArchive(appJar, appClasses, suffix);
+ }
+
+
+ // Create AppCDS archive using most common args - convenience method
+ public static OutputAnalyzer createArchive(String appJar, String appClasses[],
+ String... suffix) throws Exception {
+ AppCDSOptions opts = (new AppCDSOptions()).setAppJar(appJar)
+ .setAppClasses(appClasses);
+ opts.addSuffix(suffix);
+ return createArchive(opts);
+ }
+
+
+ // Create AppCDS archive using appcds options
+ public static OutputAnalyzer createArchive(AppCDSOptions opts)
+ throws Exception {
+
+ ArrayList<String> cmd = new ArrayList<String>();
+ File classList = makeClassList(opts.appClasses);
+ startNewArchiveName();
+
+ for (String p : opts.prefix) cmd.add(p);
+
+ if (opts.appJar != null) {
+ cmd.add("-cp");
+ cmd.add(opts.appJar);
+ } else {
+ cmd.add("-cp");
+ cmd.add("\"\"");
+ }
+
+ cmd.add("-Xshare:dump");
+ cmd.add("-Xlog:cds,cds+hashtables");
+ cmd.add("-XX:+UseAppCDS");
+ cmd.add("-XX:ExtraSharedClassListFile=" + classList.getPath());
+
+ if (opts.archiveName == null)
+ opts.archiveName = getCurrentArchiveName();
+
+ cmd.add("-XX:SharedArchiveFile=" + opts.archiveName);
+
+ for (String s : opts.suffix) cmd.add(s);
+
+ String[] cmdLine = cmd.toArray(new String[cmd.size()]);
+ ProcessBuilder pb = ProcessTools.createJavaProcessBuilder(true, cmdLine);
+ return executeAndLog(pb, "dump");
+ }
+
+
+ // Execute JVM using AppCDS archive with specified AppCDSOptions
+ public static OutputAnalyzer runWithArchive(AppCDSOptions opts)
+ throws Exception {
+
+ ArrayList<String> cmd = new ArrayList<String>();
+
+ for (String p : opts.prefix) cmd.add(p);
+
+ cmd.add("-Xshare:" + opts.xShareMode);
+ cmd.add("-XX:+UseAppCDS");
+ cmd.add("-showversion");
+ cmd.add("-XX:SharedArchiveFile=" + getCurrentArchiveName());
+ cmd.add("-Dtest.timeout.factor=" + timeoutFactor);
+
+ if (opts.appJar != null) {
+ cmd.add("-cp");
+ cmd.add(opts.appJar);
+ }
+
+ for (String s : opts.suffix) cmd.add(s);
+
+ String[] cmdLine = cmd.toArray(new String[cmd.size()]);
+ ProcessBuilder pb = ProcessTools.createJavaProcessBuilder(true, cmdLine);
+ return executeAndLog(pb, "exec");
+ }
+
+
+ public static OutputAnalyzer execCommon(String... suffix) throws Exception {
+ AppCDSOptions opts = (new AppCDSOptions());
+ opts.addSuffix(suffix);
+ return runWithArchive(opts);
+ }
+
+
+ public static OutputAnalyzer exec(String appJar, String... suffix) throws Exception {
+ AppCDSOptions opts = (new AppCDSOptions()).setAppJar(appJar);
+ opts.addSuffix(suffix);
+ return runWithArchive(opts);
+ }
+
+
+ public static OutputAnalyzer execAuto(String... suffix) throws Exception {
+ AppCDSOptions opts = (new AppCDSOptions());
+ opts.addSuffix(suffix).setXShareMode("auto");
+ return runWithArchive(opts);
+ }
+
+ public static OutputAnalyzer execOff(String... suffix) throws Exception {
+ AppCDSOptions opts = (new AppCDSOptions());
+ opts.addSuffix(suffix).setXShareMode("off");
+ return runWithArchive(opts);
+ }
+
+ public static OutputAnalyzer execModule(String prefix[], String upgrademodulepath, String modulepath,
+ String mid, String... testClassArgs)
+ throws Exception {
+
+ AppCDSOptions opts = (new AppCDSOptions());
+
+ opts.addPrefix(prefix);
+ if (upgrademodulepath == null) {
+ opts.addSuffix("-p", modulepath, "-m", mid);
+ } else {
+ opts.addSuffix("--upgrade-module-path", upgrademodulepath,
+ "-p", modulepath, "-m", mid);
+ }
+ opts.addSuffix(testClassArgs);
+
+ return runWithArchive(opts);
+ }
+
+
+ // A common operation: dump, then check results
+ public static OutputAnalyzer testDump(String appJar, String appClasses[],
+ String... suffix) throws Exception {
+ OutputAnalyzer output = dump(appJar, appClasses, suffix);
+ output.shouldContain("Loading classes to share");
+ output.shouldHaveExitValue(0);
+ return output;
+ }
+
+
+ /**
+ * Simple test -- dump and execute appJar with the given appClasses in classlist.
+ */
+ public static OutputAnalyzer test(String appJar, String appClasses[], String... args)
+ throws Exception {
+ testDump(appJar, appClasses);
+
+ OutputAnalyzer output = exec(appJar, args);
+ return checkExec(output);
+ }
+
+
+ public static OutputAnalyzer checkExecReturn(OutputAnalyzer output, int ret,
+ boolean checkContain, String... matches) throws Exception {
+ try {
+ for (String s : matches) {
+ if (checkContain) {
+ output.shouldContain(s);
+ } else {
+ output.shouldNotContain(s);
+ }
+ }
+ output.shouldHaveExitValue(ret);
+ } catch (Exception e) {
+ checkCommonExecExceptions(output, e);
+ }
+
+ return output;
+ }
+
+
+ // Convenience concatenation utils
+ public static String[] list(String ...args) {
+ return args;
+ }
+
+
+ public static String[] list(String arg, int count) {
+ ArrayList<String> stringList = new ArrayList<String>();
+ for (int i = 0; i < count; i++) {
+ stringList.add(arg);
+ }
+
+ String outputArray[] = stringList.toArray(new String[stringList.size()]);
+ return outputArray;
+ }
+
+
+ public static String[] concat(String... args) {
+ return list(args);
+ }
+
+
+ public static String[] concat(String prefix[], String... extra) {
+ ArrayList<String> list = new ArrayList<String>();
+ for (String s : prefix) {
+ list.add(s);
+ }
+ for (String s : extra) {
+ list.add(s);
+ }
+
+ return list.toArray(new String[list.size()]);
+ }
+
+
+ // ===================== Concatenate paths
+ public static String concatPaths(String... paths) {
+ String prefix = "";
+ String s = "";
+ for (String p : paths) {
+ s += prefix;
+ s += p;
+ prefix = File.pathSeparator;
+ }
+ return s;
+ }
+
+
+ public static String getTestJar(String jar) {
+ File jarFile = CDSTestUtils.getTestArtifact(jar, true);
+ if (!jarFile.isFile()) {
+ throw new RuntimeException("Not a regular file: " + jarFile.getPath());
+ }
+ return jarFile.getPath();
+ }
+
+
+ public static String getTestDir(String d) {
+ File dirFile = CDSTestUtils.getTestArtifact(d, true);
+ if (!dirFile.isDirectory()) {
+ throw new RuntimeException("Not a directory: " + dirFile.getPath());
+ }
+ return dirFile.getPath();
+ }
+
+
+ // Returns true if custom loader is supported, based on a platform.
+ // Custom loader AppCDS is only supported for Linux-x64 and Solaris.
+ public static boolean isCustomLoaderSupported() {
+ boolean isLinux = Platform.isLinux();
+ boolean isX64 = Platform.isX64();
+ boolean isSolaris = Platform.isSolaris();
+
+ System.out.println("isCustomLoaderSupported: isX64 = " + isX64);
+ System.out.println("isCustomLoaderSupported: isLinux = " + isLinux);
+ System.out.println("isCustomLoaderSupported: isSolaris = " + isSolaris);
+
+ return ((isX64 && isLinux) || isSolaris);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/TraceLongClasspath.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,105 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary ensure -XX:+TraceClassPaths showing entire expecting app classpath
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java
+ * @run main TraceLongClasspath
+ */
+
+import java.io.File;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class TraceLongClasspath {
+
+ final static String ps = File.pathSeparator;
+
+ public static void main(String[] args) throws Exception {
+ String appJar = JarBuilder.getOrCreateHelloJar();
+
+ String longClassPath =
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/user-patch.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/abc-startup.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/foobar_common/modules/features/com.foobar.db.jdbc7-dms.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/jdk/lib/tools.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/aaserver/server/lib/someapps.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/aaserver/../foobar_common/modules/net.xy.batcontrib_1.1.0.0_1-0b3/lib/bat-contrib.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/aaserver/modules/features/foobar.aas.common.kkkkkkkkkkk.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/foobar.abc.common.adapters_11.1.1/foobar.abc.common.adapters.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/foobar.plane.adapter_12.1.3/foobar.plane.adapter.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/lib/ccccccccar-common.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/foobar_common/communications/modules/config.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/foobar_common/communications/modules/userprefs-config.jar" + ps +
+ "/scratch/xxxx/yyyy/XXXXXX/aaaaaaaa/xxxxxxx/xxxxxxxx.us.foobar.com/CommonDomain/config/abc-infra" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/qqqqqq-all-1.6.5.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/foobar.abc.thread_11.1.1/foobar.abc.thread.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/foobar.abc.thread_11.1.1/thread-rrrrrrr-ext-aas.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/foobar.abc.adapter_11.1.1/foobar.abc.adapter.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/foobar.abc.ccc_11.1.1/foobar.abc.ccc.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/bbb/lib/commons-configuration.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/bbb/lib/commons-lang.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/bbb/lib/commons-logging.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/foobar_common/modules/foobar.wccore/foobar-ppppppp-api.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/foobar_common/modules/foobar.ooo_12.1.3/ooo-manifest.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/foobar_common/modules/internal/features/rrr_aaxyxx_foobar.rrr.aas.classpath.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/foobar.abc.thread_11.1.1/rrrrrrrr-api.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/commons-xxx-1.1.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/abc/abc/modules/foobar.abc.mgmt_11.1.1/abc-infra-mgmt.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/foobar_common/eee/archives/eee-eee.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/aaserver/common/march/lib/marchnet.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/aaserver/common/march/lib/marchclient.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/aaserver/common/march/lib/march.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/wwcontent/cde/iii/jlib/iiiloader.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/wwcontent/cde/iii/components/xxxxxxyyzzzzz/classes-xxxxxxyyzzzzz.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/wwcontent/cde/iii/components/mmmmmmm/lib/abc_core.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/wwcontent/cde/iii/components/mmmmmmm/lib/abc_codec.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/wwcontent/cde/iii/components/mmmmmmm/lib/abc_imageio.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/jdk/lib/tools.jar" + ps +
+ "/scratch/xxxx/yyyy/ZZZZZZ/aaaaaaaaaa/xx/foobar_common/modules/foobar.ooo_12.1.3/ooo-manifest.jar";
+
+ longClassPath += ps + appJar;
+ // Dump an archive with a specified JAR file in -classpath
+ TestCommon.testDump(longClassPath, TestCommon.list("Hello"));
+
+ // Then try to execute the archive with a different classpath and with -XX:+TraceClassPaths.
+ // The diagnosis "expecting" app classpath trace should show the entire classpath.
+ OutputAnalyzer output = TestCommon.execCommon(
+ "-XX:+TraceClassPaths",
+ "-cp", appJar,
+ "Hello");
+ output.shouldContain("Unable to use shared archive");
+ output.shouldContain("shared class paths mismatch");
+ // the "expecting" app classpath from -XX:+TraceClassPaths should not
+ // be truncated
+ output.shouldContain(longClassPath);
+ output.shouldHaveExitValue(1);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/UseAppCDS.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,228 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Testing use of UseAppCDS flag
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @build UseAppCDS_Test
+ * @run main UseAppCDS
+ */
+
+import jdk.test.lib.JDKToolLauncher;
+import jdk.test.lib.cds.CDSTestUtils;
+import jdk.test.lib.process.OutputAnalyzer;
+import jdk.test.lib.process.ProcessTools;
+
+import java.util.ArrayList;
+import java.util.List;
+import java.io.*;
+
+public class UseAppCDS {
+
+ // Class UseAppCDS_Test is loaded by the App loader
+
+ static final String TEST_OUT = "UseAppCDS_Test.main--executed";
+
+ private static final String TESTJAR = "./test.jar";
+ private static final String TESTNAME = "UseAppCDS_Test";
+ private static final String TESTCLASS = TESTNAME + ".class";
+
+ private static final String CLASSES_DIR = System.getProperty("test.classes", ".");
+ private static final String CLASSLIST_FILE = "./UseAppCDS.classlist";
+ private static final String ARCHIVE_FILE = "./shared.jsa";
+ private static final String BOOTCLASS = "java.lang.Class";
+
+ public static void main(String[] args) throws Exception {
+
+ // First create a jar file for the application "test" class
+ JDKToolLauncher jar = JDKToolLauncher.create("jar")
+ .addToolArg("-cf")
+ .addToolArg(TESTJAR)
+ .addToolArg("-C")
+ .addToolArg(CLASSES_DIR)
+ .addToolArg(TESTCLASS);
+
+ ProcessBuilder pb = new ProcessBuilder(jar.getCommand());
+ TestCommon.executeAndLog(pb, "jar01").shouldHaveExitValue(0);
+
+ pb = new ProcessBuilder(jar.getCommand());
+ TestCommon.executeAndLog(pb, "jar02").shouldHaveExitValue(0);
+
+ // In all tests the BOOTCLASS should be loaded/dumped/used
+
+ // Test 1: No AppCDS - dumping loaded classes excludes the "test" classes
+ dumpLoadedClasses(false, new String[] { BOOTCLASS },
+ new String[] { TESTNAME });
+
+ // Test 2: AppCDS - dumping loaded classes includes "test" classes
+ dumpLoadedClasses(true, new String[] { BOOTCLASS, TESTNAME },
+ new String[0]);
+
+ // Next tests rely on the classlist we just dumped
+
+ // Test 3: No AppCDS - "test" classes in classlist ignored when dumping
+ dumpArchive(false, new String[] { BOOTCLASS },
+ new String[] { TESTNAME});
+
+ // Test 4: AppCDS - "test" classes in classlist are dumped
+ dumpArchive(true, new String[] { BOOTCLASS, TESTNAME },
+ new String[0]);
+
+ // Next tests rely on the archive we just dumped
+
+ // Test 5: No AppCDS - Using archive containing "test" classes ignores them
+ useArchive(false, new String[] { BOOTCLASS },
+ new String[] { TESTNAME });
+
+ // Test 6: AppCDS - Using archive containing "test" classes loads them
+ useArchive(true, new String[] { BOOTCLASS, TESTNAME },
+ new String[0]);
+ }
+
+ public static List<String> toClassNames(String filename) throws IOException {
+ ArrayList<String> classes = new ArrayList<>();
+ BufferedReader br = new BufferedReader(new InputStreamReader(new FileInputStream(filename)));
+ for (; ; ) {
+ String line = br.readLine();
+ if (line == null)
+ break;
+ classes.add(line.replaceAll("/", "."));
+ }
+ return classes;
+ }
+
+ static void dumpLoadedClasses(boolean useAppCDS, String[] expectedClasses,
+ String[] unexpectedClasses) throws Exception {
+ ProcessBuilder pb = ProcessTools.createJavaProcessBuilder(
+ true,
+ "-XX:DumpLoadedClassList=" + CLASSLIST_FILE,
+ "-cp",
+ TESTJAR,
+ useAppCDS ? "-XX:+UseAppCDS" : "-XX:-UseAppCDS",
+ TESTNAME,
+ TEST_OUT);
+
+ OutputAnalyzer output = TestCommon.executeAndLog(pb, "dump-loaded-classes")
+ .shouldHaveExitValue(0).shouldContain(TEST_OUT);
+
+ List<String> dumpedClasses = toClassNames(CLASSLIST_FILE);
+
+ for (String clazz : expectedClasses) {
+ if (!dumpedClasses.contains(clazz)) {
+ throw new RuntimeException(clazz + " missing in " +
+ CLASSLIST_FILE);
+ }
+ }
+ for (String clazz : unexpectedClasses) {
+ if (dumpedClasses.contains(clazz)) {
+ throw new RuntimeException("Unexpectedly found " + clazz +
+ " in " + CLASSLIST_FILE);
+ }
+ }
+ }
+
+ static void dumpArchive(boolean useAppCDS, String[] expectedClasses,
+ String[] unexpectedClasses) throws Exception {
+ ProcessBuilder pb = ProcessTools.createJavaProcessBuilder(
+ true,
+ useAppCDS ? "-XX:-UnlockDiagnosticVMOptions" :
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-cp",
+ TESTJAR,
+ useAppCDS ? "-XX:+UseAppCDS" : "-XX:-UseAppCDS",
+ "-XX:SharedClassListFile=" + CLASSLIST_FILE,
+ "-XX:SharedArchiveFile=" + ARCHIVE_FILE,
+ "-Xlog:cds",
+ "-Xshare:dump");
+
+ OutputAnalyzer output = TestCommon.executeAndLog(pb, "dump-archive")
+ .shouldHaveExitValue(0);
+
+ for (String clazz : expectedClasses) {
+ String failed = "Preload Warning: Cannot find " + clazz;
+ output.shouldNotContain(failed);
+ }
+ for (String clazz : unexpectedClasses) {
+ String failed = "Preload Warning: Cannot find " + clazz;
+ output.shouldContain(failed);
+ }
+ }
+
+ static void useArchive(boolean useAppCDS, String[] expectedClasses,
+ String[] unexpectedClasses) throws Exception {
+ ProcessBuilder pb = ProcessTools.createJavaProcessBuilder(
+ true,
+ useAppCDS ? "-XX:-UnlockDiagnosticVMOptions" :
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-cp",
+ TESTJAR,
+ useAppCDS ? "-XX:+UseAppCDS" : "-XX:-UseAppCDS",
+ "-XX:SharedArchiveFile=" + ARCHIVE_FILE,
+ "-verbose:class",
+ "-Xshare:on",
+ TESTNAME,
+ TEST_OUT );
+
+ OutputAnalyzer output = TestCommon.executeAndLog(pb, "use-archive");
+ if (CDSTestUtils.isUnableToMap(output))
+ System.out.println("Unable to map: test case skipped");
+ else
+ output.shouldHaveExitValue(0).shouldContain(TEST_OUT);
+
+ // Quote the class name in the regex as it may contain $
+ String prefix = ".class,load. ";
+ String archive_suffix = ".*source: shared objects file.*";
+ String jar_suffix = ".*source: .*\\.jar";
+
+ for (String clazz : expectedClasses) {
+ String pattern = prefix + clazz + archive_suffix;
+ try {
+ output.shouldMatch(pattern);
+ } catch (Exception e) {
+ TestCommon.checkCommonExecExceptions(output, e);
+ }
+ }
+
+ for (String clazz : unexpectedClasses) {
+ String pattern = prefix + clazz + archive_suffix;
+ try {
+ output.shouldNotMatch(pattern);
+ } catch (Exception e) {
+ TestCommon.checkCommonExecExceptions(output, e);
+ }
+ pattern = prefix + clazz + jar_suffix;
+ try {
+ output.shouldMatch(pattern);
+ } catch (Exception e) {
+ TestCommon.checkCommonExecExceptions(output, e);
+ }
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/UseAppCDS_Test.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,30 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+public class UseAppCDS_Test {
+ // args are from UseAppCDS:
+ // args[0] = TEST_OUT
+ public static void main(String[] args) {
+ System.out.println(args[0]);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/VerifierTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,343 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.io.File;
+import java.io.FileOutputStream;
+import jdk.test.lib.process.OutputAnalyzer;
+import java.nio.file.Files;
+
+import java.util.*;
+import jdk.internal.org.objectweb.asm.*;
+
+/**
+ * The testsets contained in this class are executed by ./VerifierTest_*.java, so that
+ * individual testsets can be executed in parallel to shorten the total time required.
+ */
+public class VerifierTest implements Opcodes {
+ // Test verification settings for dumping & runtime
+ static final String VFY_ALL = "-Xverify:all";
+ static final String VFY_REMOTE = "-Xverify:remote"; // default
+ static final String VFY_NONE = "-Xverify:none";
+
+ static final String ERR =
+ "ERROR: class VerifierTestC was loaded unexpectedly";
+ static final String MAP_FAIL =
+ "shared archive file was created with less restrictive verification setting";
+ static final String VFY_ERR = "java.lang.VerifyError";
+
+ enum Testset1Part {
+ A, B
+ }
+
+ public static void main(String[] args) throws Exception {
+ String subCaseId = args[0];
+ String jarName_verifier_test_tmp = "verifier_test_tmp" + "_" + subCaseId;
+ String jarName_verifier_test = "verifier_test" + "_" + subCaseId;
+ String jarName_greet = "greet" + "_" + subCaseId;
+ String jarName_hi = "hi" + "_" + subCaseId;
+
+
+ JarBuilder.build(jarName_verifier_test_tmp, "VerifierTest0", "VerifierTestA",
+ "VerifierTestB", "VerifierTestC", "VerifierTestD", "VerifierTestE",
+ "UnverifiableBase", "UnverifiableIntf", "UnverifiableIntfSub");
+ JarBuilder.build(jarName_greet, "Greet");
+ JarBuilder.build(jarName_hi, "Hi", "Hi$MyClass");
+
+ File dir = new File(System.getProperty("test.classes", "."));
+ File jarSrcFile = new File(dir, jarName_verifier_test_tmp + ".jar");
+ File jarFile = new File(dir, jarName_verifier_test + ".jar");
+ String jar = jarFile.getPath();
+
+ if (!jarFile.exists() || jarFile.lastModified() < jarSrcFile.lastModified()) {
+ createTestJarFile(jarSrcFile, jarFile);
+ } else {
+ System.out.println("Already up-to-date: " + jarFile);
+ }
+
+ String noAppClasses[] = TestCommon.list("");
+ String appClasses[] = TestCommon.list("UnverifiableBase",
+ "UnverifiableIntf",
+ "UnverifiableIntfSub",
+ "VerifierTestA",
+ "VerifierTestB",
+ "VerifierTestC",
+ "VerifierTestD",
+ "VerifierTestE",
+ "VerifierTest0");
+
+
+ switch (subCaseId) {
+ case "0": testset_0(jar, noAppClasses, appClasses); return;
+ case "1A": testset_1(jar, noAppClasses, appClasses, Testset1Part.A); return;
+ case "1B": testset_1(jar, noAppClasses, appClasses, Testset1Part.B); return;
+ case "2": testset_2(jarName_greet, jarName_hi); return;
+ default:
+ throw new RuntimeException("Unknown option: " + subCaseId);
+ }
+ }
+
+ static void testset_0(String jar, String[] noAppClasses, String[] appClasses) throws Exception {
+ // Dumping should fail if the IgnoreUnverifiableClassesDuringDump
+ // option is not enabled.
+ OutputAnalyzer output = TestCommon.dump(jar, appClasses,
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:-IgnoreUnverifiableClassesDuringDump");
+ output.shouldContain("Please remove the unverifiable classes");
+ output.shouldHaveExitValue(1);
+
+ // By default, bad classes should be ignored during dumping.
+ TestCommon.testDump(jar, appClasses);
+ }
+
+ static void testset_1(String jar, String[] noAppClasses, String[] appClasses, Testset1Part part)
+ throws Exception
+ {
+ String config[][] = {
+ // {dump_list, dumptime_verification_setting,
+ // runtime_verification_setting, runtime_output},
+
+ // Dump app/ext with -Xverify:remote
+ {"app", VFY_REMOTE, VFY_REMOTE, VFY_ERR},
+ {"app", VFY_REMOTE, VFY_ALL, MAP_FAIL},
+ {"app", VFY_REMOTE, VFY_NONE, ERR },
+ // Dump app/ext with -Xverify:all
+ {"app", VFY_ALL, VFY_REMOTE, VFY_ERR },
+ {"app", VFY_ALL, VFY_ALL, VFY_ERR },
+ {"app", VFY_ALL, VFY_NONE, ERR },
+ // Dump app/ext with -Xverify:none
+ {"app", VFY_NONE, VFY_REMOTE, MAP_FAIL},
+ {"app", VFY_NONE, VFY_ALL, MAP_FAIL},
+ {"app", VFY_NONE, VFY_NONE, ERR },
+ // Dump sys only with -Xverify:remote
+ {"noApp", VFY_REMOTE, VFY_REMOTE, VFY_ERR},
+ {"noApp", VFY_REMOTE, VFY_ALL, VFY_ERR},
+ {"noApp", VFY_REMOTE, VFY_NONE, ERR},
+ // Dump sys only with -Xverify:all
+ {"noApp", VFY_ALL, VFY_REMOTE, VFY_ERR},
+ {"noApp", VFY_ALL, VFY_ALL, VFY_ERR},
+ {"noApp", VFY_ALL, VFY_NONE, ERR},
+ // Dump sys only with -Xverify:none
+ {"noApp", VFY_NONE, VFY_REMOTE, VFY_ERR},
+ {"noApp", VFY_NONE, VFY_ALL, VFY_ERR},
+ {"noApp", VFY_NONE, VFY_NONE, ERR},
+ };
+
+ int loop_start, loop_stop;
+
+ // Further break down testset_1 into two parts (to be invoked from VerifierTest_1A.java
+ // and VerifierTest_1B.java) to improve parallel test execution time.
+ switch (part) {
+ case A:
+ loop_start = 0;
+ loop_stop = 9;
+ break;
+ case B:
+ default:
+ assert part == Testset1Part.B;
+ loop_start = 9;
+ loop_stop = config.length;
+ break;
+ }
+
+ String prev_dump_setting = "";
+ for (int i = loop_start; i < loop_stop; i ++) {
+ String dump_list[] = config[i][0].equals("app") ? appClasses :
+ noAppClasses;
+ String dump_setting = config[i][1];
+ String runtime_setting = config[i][2];
+ String runtime_output = config[i][3];
+ System.out.println("Test case [" + i + "]: dumping " + config[i][0] +
+ " with " + dump_setting +
+ ", run with " + runtime_setting);
+ if (!dump_setting.equals(prev_dump_setting)) {
+ OutputAnalyzer dumpOutput = TestCommon.dump(
+ jar, dump_list, dump_setting,
+ // FIXME: the following options are for working around a GC
+ // issue - assert failure when dumping archive with the -Xverify:all
+ "-Xms256m",
+ "-Xmx256m");
+ }
+ OutputAnalyzer runtimeOutput = TestCommon.execCommon(
+ "-cp", jar,
+ runtime_setting,
+ "VerifierTest0");
+ try {
+ runtimeOutput.shouldContain(runtime_output);
+ } catch (RuntimeException re) {
+ // Check if the failure is due to archive mapping failure.
+ // If not, a RuntimeException will be thrown.
+ runtimeOutput.shouldContain("Unable to use shared archive");
+ }
+ prev_dump_setting = dump_setting;
+ }
+ }
+
+ static void testset_2(String jarName_greet, String jarName_hi) throws Exception {
+ String appClasses[];
+ String jar;
+
+ // The following section is for testing the scenarios where
+ // the classes are verifiable during dump time.
+ appClasses = TestCommon.list("Hi",
+ "Greet",
+ "Hi$MyClass");
+ jar = TestCommon.getTestJar(jarName_hi + ".jar") + File.pathSeparator +
+ TestCommon.getTestJar(jarName_greet + ".jar");
+ final String PASS_RESULT = "Hi, how are you?";
+ String config2[][] = {
+ // {dump_list, dumptime_verification_setting,
+ // runtime_verification_setting, runtime_output},
+
+ // Dump app/ext with -Xverify:remote
+ {"app", VFY_REMOTE, VFY_REMOTE, PASS_RESULT},
+ {"app", VFY_REMOTE, VFY_ALL, MAP_FAIL},
+ {"app", VFY_REMOTE, VFY_NONE, PASS_RESULT },
+ // Dump app/ext with -Xverify:all
+ {"app", VFY_ALL, VFY_REMOTE, PASS_RESULT },
+ {"app", VFY_ALL, VFY_ALL, PASS_RESULT },
+ {"app", VFY_ALL, VFY_NONE, PASS_RESULT },
+ // Dump app/ext with -Xverify:none
+ {"app", VFY_NONE, VFY_REMOTE, MAP_FAIL},
+ {"app", VFY_NONE, VFY_ALL, MAP_FAIL},
+ {"app", VFY_NONE, VFY_NONE, PASS_RESULT },
+ };
+ for (int i = 0; i < config2.length; i ++) {
+ // config2[i][0] is always set to "app" in this test
+ String dump_setting = config2[i][1];
+ String runtime_setting = config2[i][2];
+ String runtime_output = config2[i][3];
+ System.out.println("Test case [" + i + "]: dumping " + config2[i][0] +
+ " with " + dump_setting +
+ ", run with " + runtime_setting);
+ OutputAnalyzer dumpOutput = TestCommon.dump(
+ jar, appClasses, dump_setting,
+ "-XX:+UnlockDiagnosticVMOptions",
+ // FIXME: the following options are for working around a GC
+ // issue - assert failure when dumping archive with the -Xverify:all
+ "-Xms256m",
+ "-Xmx256m");
+ OutputAnalyzer runtimeOutput = TestCommon.execCommon(
+ "-cp", jar,
+ runtime_setting,
+ "Hi");
+ try {
+ runtimeOutput.shouldContain(runtime_output);
+ } catch (RuntimeException re) {
+ // Check if the failure is due to archive mapping failure.
+ // If not, a RuntimeException will be thrown.
+ runtimeOutput.shouldContain("Unable to use shared archive");
+ }
+ }
+
+ }
+
+ static void createTestJarFile(File jarSrcFile, File jarFile) throws Exception {
+ jarFile.delete();
+ Files.copy(jarSrcFile.toPath(), jarFile.toPath());
+
+ File dir = new File(System.getProperty("test.classes", "."));
+ File outdir = new File(dir, "verifier_test_classes");
+ outdir.mkdir();
+
+ writeClassFile(new File(outdir, "UnverifiableBase.class"), makeUnverifiableBase());
+ writeClassFile(new File(outdir, "UnverifiableIntf.class"), makeUnverifiableIntf());
+
+ JarBuilder.update(jarFile.getPath(), outdir.getPath());
+ }
+
+ static void writeClassFile(File file, byte bytecodes[]) throws Exception {
+ try (FileOutputStream fos = new FileOutputStream(file)) {
+ fos.write(bytecodes);
+ }
+ }
+
+ // This was obtained using JDK8: java jdk.internal.org.objectweb.asm.util.ASMifier tmpclasses/UnverifiableBase.class
+ static byte[] makeUnverifiableBase() throws Exception {
+ ClassWriter cw = new ClassWriter(0);
+ FieldVisitor fv;
+ MethodVisitor mv;
+ AnnotationVisitor av0;
+
+ cw.visit(V1_6, ACC_SUPER, "UnverifiableBase", null, "java/lang/Object", null);
+ {
+ fv = cw.visitField(ACC_FINAL + ACC_STATIC, "x", "LVerifierTest;", null, null);
+ fv.visitEnd();
+ }
+ {
+ mv = cw.visitMethod(0, "<init>", "()V", null, null);
+ mv.visitCode();
+ mv.visitVarInsn(ALOAD, 0);
+ mv.visitMethodInsn(INVOKESPECIAL, "java/lang/Object", "<init>", "()V", false);
+ mv.visitInsn(RETURN);
+ mv.visitMaxs(1, 1);
+ mv.visitEnd();
+ }
+ {
+ mv = cw.visitMethod(ACC_STATIC, "<clinit>", "()V", null, null);
+ mv.visitCode();
+ //WAS mv.visitTypeInsn(NEW, "VerifierTest");
+ mv.visitTypeInsn(NEW, "java/lang/Object");
+ mv.visitInsn(DUP);
+ mv.visitMethodInsn(INVOKESPECIAL, "VerifierTest0", "<init>", "()V", false);
+ mv.visitFieldInsn(PUTSTATIC, "UnverifiableBase", "x", "LVerifierTest;");
+ mv.visitInsn(RETURN);
+ mv.visitMaxs(2, 0);
+ mv.visitEnd();
+ }
+ cw.visitEnd();
+
+ return cw.toByteArray();
+ }
+
+ // This was obtained using JDK8: java jdk.internal.org.objectweb.asm.util.ASMifier tmpclasses/UnverifiableIntf.class
+ static byte[] makeUnverifiableIntf() throws Exception {
+ ClassWriter cw = new ClassWriter(0);
+ FieldVisitor fv;
+ MethodVisitor mv;
+ AnnotationVisitor av0;
+
+ cw.visit(V1_6, ACC_ABSTRACT + ACC_INTERFACE, "UnverifiableIntf", null, "java/lang/Object", null);
+
+ {
+ fv = cw.visitField(ACC_PUBLIC + ACC_FINAL + ACC_STATIC, "x", "LVerifierTest0;", null, null);
+ fv.visitEnd();
+ }
+ {
+ mv = cw.visitMethod(ACC_STATIC, "<clinit>", "()V", null, null);
+ mv.visitCode();
+ //WAS mv.visitTypeInsn(NEW, "VerifierTest");
+ mv.visitTypeInsn(NEW, "java/lang/Object");
+ mv.visitInsn(DUP);
+ mv.visitMethodInsn(INVOKESPECIAL, "VerifierTest0", "<init>", "()V", false);
+ mv.visitFieldInsn(PUTSTATIC, "UnverifiableIntf", "x", "LVerifierTest0;");
+ mv.visitInsn(RETURN);
+ mv.visitMaxs(2, 0);
+ mv.visitEnd();
+ }
+ cw.visitEnd();
+
+ return cw.toByteArray();
+ }
+
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/VerifierTest_0.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,38 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Unverfiable app classes should not be archived.
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * @modules jdk.jartool/sun.tools.jar
+ * java.base/jdk.internal.org.objectweb.asm
+ * @compile test-classes/Greet.java
+ * @compile test-classes/Hi.java
+ * @compile test-classes/VerifierTest0.java
+ * @run main/othervm/timeout=3600 VerifierTest 0
+ */
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/VerifierTest_1A.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,38 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Unverfiable app classes should not be archived.
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * @modules jdk.jartool/sun.tools.jar
+ * java.base/jdk.internal.org.objectweb.asm
+ * @compile test-classes/Greet.java
+ * @compile test-classes/Hi.java
+ * @compile test-classes/VerifierTest0.java
+ * @run main/othervm/timeout=3600 VerifierTest 1A
+ */
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/VerifierTest_1B.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,38 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Unverfiable app classes should not be archived.
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * @modules jdk.jartool/sun.tools.jar
+ * java.base/jdk.internal.org.objectweb.asm
+ * @compile test-classes/Greet.java
+ * @compile test-classes/Hi.java
+ * @compile test-classes/VerifierTest0.java
+ * @run main/othervm/timeout=3600 VerifierTest 1B
+ */
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/VerifierTest_2.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,38 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Unverfiable app classes should not be archived.
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * @modules jdk.jartool/sun.tools.jar
+ * java.base/jdk.internal.org.objectweb.asm
+ * @compile test-classes/Greet.java
+ * @compile test-classes/Hi.java
+ * @compile test-classes/VerifierTest0.java
+ * @run main/othervm/timeout=3600 VerifierTest 2
+ */
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/WideIloadTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,50 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/**
+ * @test
+ * @summary Test 'iload_w' bytecode in shared class
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Iloadw.jasm
+ * @compile test-classes/IloadwMain.java
+ * @run main WideIloadTest
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class WideIloadTest {
+ public static void main(String args[]) throws Exception {
+ JarBuilder.build("iload_w", "Iloadw", "IloadwMain");
+ String appJar = TestCommon.getTestJar("iload_w.jar");
+ OutputAnalyzer dumpOutput = TestCommon.dump(appJar, TestCommon.list(
+ "Iloadw", "IloadwMain"));
+ TestCommon.checkDump(dumpOutput);
+ OutputAnalyzer execOutput = TestCommon.exec(appJar, "IloadwMain");
+ TestCommon.checkExec(execOutput, "Passed");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/WrongClasspath.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,56 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary classpath mismatch between dump time and execution time
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java
+ * @run main WrongClasspath
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class WrongClasspath {
+
+ public static void main(String[] args) throws Exception {
+ String appJar = JarBuilder.getOrCreateHelloJar();
+
+ // Dump an archive with a specified JAR file in -classpath
+ TestCommon.testDump(appJar, TestCommon.list("Hello"));
+
+ // Then try to execute the archive without -classpath -- it should fail
+ OutputAnalyzer output = TestCommon.execCommon(
+ /* "-cp", appJar, */ // <- uncomment this and the execution should succeed
+ "Hello");
+ output.shouldContain("Unable to use shared archive");
+ output.shouldContain("shared class paths mismatch");
+ output.shouldHaveExitValue(1);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/XShareAutoWithChangedJar.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,55 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Test -Xshare:auto for AppCDS
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java
+ * @run main XShareAutoWithChangedJar
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class XShareAutoWithChangedJar {
+ public static void main(String[] args) throws Exception {
+ String appJar = JarBuilder.build("XShareAutoWithChangedJar", "Hello");
+
+ // 1. dump
+ OutputAnalyzer output = TestCommon.dump(appJar, TestCommon.list("Hello"));
+ TestCommon.checkDump(output);
+
+ // 2. change the jar
+ JarBuilder.build("XShareAutoWithChangedJar", "Hello");
+
+ // 3. exec
+ output = TestCommon.execAuto("-cp", appJar, "Hello");
+ output.shouldContain("Hello World");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/CheckCachedResolvedReferences.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,69 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Test resolved_references
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (sun.arch.data.model == "64")
+ * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris")
+ * @requires (vm.gc=="null")
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * @modules java.management
+ * jdk.jartool/sun.tools.jar
+ * @build sun.hotspot.WhiteBox
+ * @compile CheckCachedResolvedReferencesApp.java
+ * @compile ../test-classes/Hello.java
+ * @run main ClassFileInstaller -jar app.jar CheckCachedResolvedReferencesApp
+ * @run main ClassFileInstaller -jar hello.jar Hello
+ * @run main ClassFileInstaller -jar WhiteBox.jar sun.hotspot.WhiteBox
+ * @run main CheckCachedResolvedReferences
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+import sun.hotspot.WhiteBox;
+
+public class CheckCachedResolvedReferences {
+ public static void main(String[] args) throws Exception {
+ String wbJar = ClassFileInstaller.getJarPath("WhiteBox.jar");
+ String use_whitebox_jar = "-Xbootclasspath/a:" + wbJar;
+ String appJar = ClassFileInstaller.getJarPath("app.jar");
+ String helloJarPath = ClassFileInstaller.getJarPath("hello.jar");
+
+ String classlist[] = new String[] {
+ "CheckCachedResolvedReferencesApp",
+ "java/lang/Object id: 1",
+ "Hello id: 2 super: 1 source: " + helloJarPath
+ };
+
+ TestCommon.testDump(appJar, classlist, use_whitebox_jar);
+ OutputAnalyzer output = TestCommon.exec(appJar, use_whitebox_jar,
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+WhiteBoxAPI",
+ "CheckCachedResolvedReferencesApp",
+ helloJarPath);
+ TestCommon.checkExec(output);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/CheckCachedResolvedReferencesApp.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,77 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.io.File;
+import java.net.URL;
+import java.net.URLClassLoader;
+import sun.hotspot.WhiteBox;
+
+public class CheckCachedResolvedReferencesApp {
+ public static void main(String args[]) throws Exception {
+ String path = args[0];
+ URL url = new File(path).toURI().toURL();
+ URL[] urls = new URL[] {url};
+
+ URLClassLoader loader = new URLClassLoader(urls);
+ Class hello = loader.loadClass("Hello");
+ System.out.println("Loaded " + hello + " from " + url + " using loader " + loader);
+
+ WhiteBox wb = WhiteBox.getWhiteBox();
+
+ if (!wb.areOpenArchiveHeapObjectsMapped()) {
+ System.out.println("Archived open_archive_heap objects are not mapped.");
+ System.out.println("This may happen during normal operation. Test Skipped.");
+ return;
+ }
+
+ // CheckCachedResolvedReferencesApp is shared class and loaded by the
+ // AppClassLoader. It should have cached resolved_references.
+ if (wb.isSharedClass(CheckCachedResolvedReferencesApp.class)) {
+ Object refs1 = wb.getResolvedReferences(CheckCachedResolvedReferencesApp.class);
+ if (refs1 != null && wb.isShared(refs1)) {
+ System.out.println(
+ "resolved references from CheckCachedResolvedReferencesApp is cached");
+ } else {
+ throw new RuntimeException(
+ "FAILED. CheckCachedResolvedReferencesApp has no cached resolved references");
+ }
+ }
+
+ // Hello is shared class and loaded by the 'loader' defined in current app.
+ // It should not have cached resolved_references.
+ if (wb.isSharedClass(hello)) {
+ Object refs2 = wb.getResolvedReferences(hello);
+ if (refs2 != null) {
+ if (!wb.isShared(refs2)) {
+ System.out.println("resolved references from hello is not cached");
+ } else {
+ throw new RuntimeException(
+ "FAILED. Hello has unexpected cached resolved references");
+ }
+ } else {
+ throw new RuntimeException("FAILED. Hello has no resolved references");
+ }
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/DumpTimeVerifyFailure.config.txt Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,3 @@
+VERSION: 1.0
+@SECTION: String
+26: shared_string_from_MyInner
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/DumpTimeVerifyFailure.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,63 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Dump time should not crash if any class with shared strings fails verification due to missing dependencies.
+ * @bug 8186789
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (sun.arch.data.model != "32") & (os.family != "windows")
+ * @requires (vm.gc=="null")
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * @modules java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile MyOuter.java MyException.java
+ * @run main DumpTimeVerifyFailure
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class DumpTimeVerifyFailure {
+ public static void main(String[] args) throws Exception {
+ // App classes (see MyOuter.java):
+ // MyOuter
+ // MyInnder$MyOuter extends MyOuter
+ // MyException
+ //
+ // MyOuter$MyInner.test() throws MyException.
+ // The missingMyException.jar file only includes MyOuter and
+ // MyOuter$MyInner classes, but not the MyException class.
+ // At dump time, MyOuter and MyOuter$MyInner classes fail
+ // verification due to missing MyException class.
+ String[] ARCHIVE_CLASSES = {"MyOuter", "MyOuter$MyInner"};
+ String appJar = JarBuilder.build("missingMyException", ARCHIVE_CLASSES);
+
+ OutputAnalyzer dumpOutput = TestCommon.dump(
+ appJar, ARCHIVE_CLASSES,
+ "-Xlog:verification",
+ "-XX:SharedArchiveConfigFile=" + TestCommon.getSourceFile("DumpTimeVerifyFailure.config.txt"));
+ TestCommon.checkDump(dumpOutput, "Loading classes to share");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/GCStress.config.txt Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,3 @@
+VERSION: 1.0
+@SECTION: String
+25: GCStressApp_shared_string
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/GCStressApp.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,93 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.io.*;
+import java.util.*;
+import sun.hotspot.WhiteBox;
+
+// All strings in archived classes are shared
+public class GCStressApp {
+ static WhiteBox wb = WhiteBox.getWhiteBox();
+ static int[] arr;
+
+ static String get_shared_string() {
+ String shared_str = "GCStressApp_shared_string";
+ return shared_str;
+ }
+
+ static String get_shared_string1() {
+ String shared_str1 = "GCStressApp_shared_string1";
+ return shared_str1;
+ }
+
+ static void allocAlot() {
+ try {
+ Random random = new Random();
+ for (int i = 0; i < 1024 * 1024; i++) {
+ int len = random.nextInt(10000);
+ arr = new int[len];
+ }
+ } catch (java.lang.OutOfMemoryError e) { }
+ }
+
+ static void runGC() {
+ wb.fullGC();
+ }
+
+ public static void main(String args[]) throws Exception {
+ if (!wb.isSharedClass(GCStressApp.class)) {
+ System.out.println("GCStressApp is not shared. Possibly there was a mapping failure.");
+ return;
+ }
+
+ if (wb.areSharedStringsIgnored()) {
+ System.out.println("Shared strings are ignored.");
+ return;
+ }
+
+ Object refs = wb.getResolvedReferences(GCStressApp.class);
+ if (wb.isShared(refs)) {
+ String shared_str = get_shared_string();
+ String shared_str1 = get_shared_string1();
+
+ if (!wb.isShared(shared_str)) {
+ throw new RuntimeException("FAILED. GCStressApp_shared_string is not shared");
+ }
+
+ if (!wb.isShared(shared_str1)) {
+ throw new RuntimeException("FAILED. GCStressApp_shared_string1 is not shared");
+ }
+
+ allocAlot();
+ runGC();
+ runGC();
+ runGC();
+
+ System.out.println("Passed");
+ } else {
+ System.out.println(
+ "No cached resolved references. Open archive heap data is not used.");
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/GCStressTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,61 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (sun.arch.data.model != "32") & (os.family != "windows")
+ * @requires (vm.gc=="null")
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * @modules java.management
+ * jdk.jartool/sun.tools.jar
+ * @build sun.hotspot.WhiteBox
+ * @compile GCStressApp.java
+ * @run main ClassFileInstaller -jar gcstress.jar GCStressApp
+ * @run main ClassFileInstaller -jar WhiteBox.jar sun.hotspot.WhiteBox
+ * @run main GCStressTest
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class GCStressTest {
+ public static void main(String[] args) throws Exception {
+ String wbJar = ClassFileInstaller.getJarPath("WhiteBox.jar");
+ String use_whitebox_jar = "-Xbootclasspath/a:" + wbJar;
+ String appJar = ClassFileInstaller.getJarPath("gcstress.jar");
+ String appClasses[] = TestCommon.list("GCStressApp");
+
+ OutputAnalyzer output = TestCommon.dump(appJar, appClasses,
+ use_whitebox_jar,
+ "-Xms20M", "-Xmx20M");
+ output = TestCommon.exec(appJar, use_whitebox_jar,
+ "-Xlog:cds=info",
+ "-Xms20M", "-Xmx20M",
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+WhiteBoxAPI","GCStressApp");
+ TestCommon.checkExec(output);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/InstrumentationAgent.mf Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,5 @@
+Manifest-Version: 1.0
+Premain-Class: InstrumentationRegisterClassFileTransformer
+Agent-Class: InstrumentationRegisterClassFileTransformer
+Can-Retransform-Classes: true
+Can-Redefine-Classes: true
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/MyException.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,28 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+public class MyException extends Exception {
+ public MyException(String msg) {
+ super(msg);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/MyOuter.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,43 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+public class MyOuter {
+ public void exp() throws MyException {
+ throw new MyException("MyOuter exception");
+ }
+
+ public void test() throws Exception {
+ System.out.println("MyOuter");
+ try {
+ exp();
+ } catch (MyException e) {
+ }
+ }
+
+ public static final class MyInner extends MyOuter {
+ static String myString = "shared_string_from_MyInner";
+ public void test() {
+ System.out.println("MyInner");
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/OpenArchiveRegion.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,63 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Test open archive heap regions
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (sun.arch.data.model != "32") & (os.family != "windows")
+ * @requires (vm.gc=="null")
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * @modules java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile ../test-classes/Hello.java
+ * @run main OpenArchiveRegion
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class OpenArchiveRegion {
+ public static void main(String[] args) throws Exception {
+ JarBuilder.getOrCreateHelloJar();
+ String appJar = TestCommon.getTestJar("hello.jar");
+ String appClasses[] = TestCommon.list("Hello");
+
+ // Dump with open archive heap region, requires G1 GC
+ OutputAnalyzer output = TestCommon.dump(appJar, appClasses);
+ TestCommon.checkDump(output, "oa0 space:");
+ output.shouldNotContain("oa0 space: 0 [");
+ output = TestCommon.exec(appJar, "Hello");
+ TestCommon.checkExec(output, "Hello World");
+ output = TestCommon.exec(appJar, "-XX:+UseSerialGC", "Hello");
+ TestCommon.checkExec(output, "Hello World");
+
+ // Dump with open archive heap region disabled when G1 GC is not in use
+ output = TestCommon.dump(appJar, appClasses, "-XX:+UseParallelGC");
+ TestCommon.checkDump(output);
+ output.shouldNotContain("oa0 space:");
+ output = TestCommon.exec(appJar, "Hello");
+ TestCommon.checkExec(output, "Hello World");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/RangeNotWithinHeap.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,72 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Shared classes can still be used when archived heap regions cannot be
+ * mapped due to out of range, and -Xshare:on should not fail. Test on
+ * linux 64-bit only since the HeapBaseMinAddress value is platform specific.
+ * The value used in the test may cause different behavior on other platforms.
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (os.family == "linux") & (os.arch == "amd64") & (sun.arch.data.model == "64")
+ * @requires (vm.gc=="null")
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * @modules java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile ../test-classes/Hello.java
+ * @run main RangeNotWithinHeap
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class RangeNotWithinHeap {
+ public static void main(String[] args) throws Exception {
+ JarBuilder.getOrCreateHelloJar();
+ String appJar = TestCommon.getTestJar("hello.jar");
+ String appClasses[] = TestCommon.list("Hello");
+
+ OutputAnalyzer output = TestCommon.dump(appJar, appClasses,
+ "-XX:HeapBaseMinAddress=0x600000000", "-Xmx6G", "-Xlog:gc+heap=trace");
+ TestCommon.checkDump(output, "oa0 space:");
+
+ // Force archive region out of runtime java heap
+ output = TestCommon.exec(appJar, "Hello");
+ TestCommon.checkExec(output, "Hello World");
+ output = TestCommon.exec(appJar,
+ "-XX:HeapBaseMinAddress=0x600000000", "-Xmx2G", "-Xlog:gc+heap=trace,cds", "Hello");
+ TestCommon.checkExec(output, "Hello World");
+ try {
+ output.shouldContain(
+ "UseSharedSpaces: Unable to allocate region, range is not within java heap.");
+ } catch (Exception e) {
+ // In rare case the heap data is not used.
+ if (output.getOutput().contains("Cached heap data from the CDS archive is being ignored")) {
+ return;
+ }
+ // Check for common shared class data mapping failures.
+ TestCommon.checkCommonExecExceptions(output, e);
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/RedefineClassApp.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,149 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.lang.instrument.ClassDefinition;
+import java.lang.instrument.Instrumentation;
+import java.lang.instrument.UnmodifiableClassException;
+import java.net.URL;
+import java.net.URLClassLoader;
+import java.io.File;
+import java.security.CodeSigner;
+import java.security.CodeSource;
+import java.security.ProtectionDomain;
+import sun.hotspot.WhiteBox;
+
+public class RedefineClassApp {
+ static WhiteBox wb = WhiteBox.getWhiteBox();
+
+ public static interface Intf { // Loaded from Boot class loader (-Xbootclasspath/a).
+ public String get();
+ }
+ public static class Bar implements Intf { // Loaded from Boot class loader.
+ public String get() {
+ return "buzz";
+ }
+ }
+ public static class Foo implements Intf { // Loaded from AppClassLoader
+ public String get() {
+ return "buzz";
+ }
+ }
+
+ static int numTests = 0;
+ static int failed = 0;
+ static Instrumentation instrumentation;
+
+ public static void main(String args[]) throws Throwable {
+ if (wb.areSharedStringsIgnored()) {
+ System.out.println("Shared strings are ignored.");
+ return;
+ }
+
+ File bootJar = new File(args[0]);
+ File appJar = new File(args[1]);
+
+ instrumentation = InstrumentationRegisterClassFileTransformer.getInstrumentation();
+ System.out.println("INFO: instrumentation = " + instrumentation);
+
+ testBootstrapCDS("Bootstrap Loader", bootJar);
+ testAppCDSv1("Application Loader", appJar);
+
+ if (failed > 0) {
+ throw new RuntimeException("FINAL RESULT: " + failed + " out of " + numTests + " test case(s) have failed");
+ } else {
+ System.out.println("FINAL RESULT: All " + numTests + " test case(s) have passed!");
+ }
+
+ // Full GC. The cached objects in adjustable archive heap regions are
+ // scanned. The archive regions are verified. No error should be
+ // reported.
+ wb.fullGC();
+ }
+
+ static void testBootstrapCDS(String group, File jar) throws Throwable {
+ doTest(group, new Bar(), jar);
+ }
+
+ static void testAppCDSv1(String group, File jar) throws Throwable {
+ doTest(group, new Foo(), jar);
+ }
+
+ static void doTest(String group, Intf object, File jar) throws Throwable {
+ numTests ++;
+
+ Class klass = object.getClass();
+ System.out.println();
+ System.out.println("++++++++++++++++++++++++++");
+ System.out.println("Test group: " + group);
+ System.out.println("Testing with classloader = " + klass.getClassLoader());
+ System.out.println("Testing with class = " + klass);
+ System.out.println("Test is shared = " + wb.isSharedClass(klass));
+ System.out.println("++++++++++++++++++++++++++");
+
+ // Call get() before redefine. All strings in archived classes are shared.
+ String res = object.get();
+ System.out.println("get() returns " + res);
+ if (res.equals("buzz") && wb.isShared(res)) {
+ System.out.println("get() returns " + res + ", string is shared");
+ } else {
+ if (!res.equals("buzz")) {
+ System.out.println("FAILED. buzz is expected but got " + res);
+ } else {
+ System.out.println("FAILED. " + res + " is not shared");
+ }
+ failed ++;
+ return;
+ }
+ res = null; // release the local reference to the string
+
+ // Run GC
+ System.gc();
+ System.gc();
+ System.gc();
+
+ // Redefine the shared class
+ byte[] buff = Util.getClassFileFromJar(jar, klass.getName());
+ Util.replace(buff, "buzz", "huzz");
+ String f = "(failed)";
+ try {
+ instrumentation.redefineClasses(new ClassDefinition(klass, buff));
+ f = object.get();
+ } catch (UnmodifiableClassException|UnsupportedOperationException e) {
+ e.printStackTrace();
+ }
+ if (f.equals("huzz")) {
+ System.out.println("PASSED: object.get() after redefinition returns " + f);
+ } else {
+ System.out.println("FAILED: object.get() after redefinition returns " + f);
+ failed ++;
+ }
+
+ // Run GC. Should not crash.
+ System.gc();
+ System.gc();
+ System.gc();
+
+ System.out.println("++++++++++++++++++++++++++++++++++++++++++++++++ (done)\n\n");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/cacheObject/RedefineClassTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,105 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Redefine shared class. GC should not cause crash with cached resolved_references.
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds /test/hotspot/jtreg/runtime/appcds/test-classes /test/hotspot/jtreg/runtime/appcds/jvmti
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires vm.gc.G1
+ * @requires vm.flavor != "minimal"
+ * @requires (sun.arch.data.model != "32") & (os.family != "windows")
+ * @modules java.base/jdk.internal.misc
+ * jdk.jartool/sun.tools.jar
+ * java.management
+ * @build sun.hotspot.WhiteBox
+ * RedefineClassApp
+ * InstrumentationClassFileTransformer
+ * InstrumentationRegisterClassFileTransformer
+ * @run main/othervm RedefineClassTest
+ */
+
+import com.sun.tools.attach.VirtualMachine;
+import com.sun.tools.attach.VirtualMachineDescriptor;
+import java.io.File;
+import java.io.FileOutputStream;
+import java.util.List;
+import jdk.test.lib.Asserts;
+import jdk.test.lib.cds.CDSOptions;
+import jdk.test.lib.process.OutputAnalyzer;
+import jdk.test.lib.process.ProcessTools;
+
+public class RedefineClassTest {
+ public static String bootClasses[] = {
+ "RedefineClassApp$Intf",
+ "RedefineClassApp$Bar",
+ "sun.hotspot.WhiteBox",
+ };
+ public static String appClasses[] = {
+ "RedefineClassApp",
+ "RedefineClassApp$Foo",
+ };
+ public static String sharedClasses[] = TestCommon.concat(bootClasses, appClasses);
+
+ public static String agentClasses[] = {
+ "InstrumentationClassFileTransformer",
+ "InstrumentationRegisterClassFileTransformer",
+ "Util",
+ };
+
+ public static void main(String[] args) throws Throwable {
+ runTest();
+ }
+
+ public static void runTest() throws Throwable {
+ String bootJar =
+ ClassFileInstaller.writeJar("RedefineClassBoot.jar", bootClasses);
+ String appJar =
+ ClassFileInstaller.writeJar("RedefineClassApp.jar", appClasses);
+ String agentJar =
+ ClassFileInstaller.writeJar("InstrumentationAgent.jar",
+ ClassFileInstaller.Manifest.fromSourceFile("InstrumentationAgent.mf"),
+ agentClasses);
+
+ String bootCP = "-Xbootclasspath/a:" + bootJar;
+
+ String agentCmdArg;
+ agentCmdArg = "-javaagent:" + agentJar;
+
+ TestCommon.testDump(appJar, sharedClasses, bootCP, "-Xlog:gc+region=trace");
+
+ OutputAnalyzer out = TestCommon.execAuto("-cp", appJar,
+ bootCP,
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+WhiteBoxAPI",
+ "-Xlog:gc+region=trace,cds=info",
+ agentCmdArg,
+ "RedefineClassApp", bootJar, appJar);
+ out.reportDiagnosticSummary();
+
+ CDSOptions opts = (new CDSOptions()).setXShareMode("auto");
+ TestCommon.checkExec(out, opts);
+ }
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatA.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,138 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Tests the format checking of class list format.
+ *
+ * (NOTE: AppCDS does not support uncompressed oops)
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (sun.arch.data.model == "64")
+ * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris")
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java test-classes/CustomLoadee.java test-classes/CustomLoadee2.java
+ * test-classes/CustomInterface2_ia.java test-classes/CustomInterface2_ib.java
+ * @run main ClassListFormatA
+ */
+
+public class ClassListFormatA extends ClassListFormatBase {
+ static {
+ // Uncomment the following line to run only one of the test cases
+ // ClassListFormatBase.RUN_ONLY_TEST = "TESTCASE A1";
+ }
+
+ public static void main(String[] args) throws Throwable {
+ String appJar = JarBuilder.getOrCreateHelloJar();
+ String customJarPath = JarBuilder.build("ClassListFormatA", "CustomLoadee",
+ "CustomLoadee2", "CustomInterface2_ia", "CustomInterface2_ib");
+ //----------------------------------------------------------------------
+ // TESTGROUP A: general bad input
+ //----------------------------------------------------------------------
+ dumpShouldFail(
+ "TESTCASE A1: bad input - interface: instead of interfaces:",
+ appJar, classlist(
+ "Hello",
+ "java/lang/Object id: 1",
+ "CustomLoadee interface: 1"
+ ),
+ "Unknown input:");
+
+ dumpShouldFail(
+ "TESTCASE A2: bad input - negative IDs not allowed",
+ appJar, classlist(
+ "Hello",
+ "java/lang/Object id: -1"
+ ),
+ "Error: negative integers not allowed");
+
+ dumpShouldFail(
+ "TESTCASE A3: bad input - bad ID (not an integer)",
+ appJar, classlist(
+ "Hello",
+ "java/lang/Object id: xyz"
+ ),
+ "Error: expected integer");
+
+ if (false) {
+ // FIXME - classFileParser.cpp needs fixing.
+ dumpShouldFail(
+ "TESTCASE A4: bad input - bad ID (integer too big)",
+ appJar, classlist(
+ "Hello",
+ "java/lang/Object id: 2147483648" // <- this is 0x80000000
+ ),
+ "Error: expected integer");
+
+ // FIXME
+ dumpShouldFail(
+ "TESTCASE A5: bad input - bad ID (integer too big)",
+ appJar, classlist(
+ "Hello",
+ "java/lang/Object id: 21474836489" // bigger than 32-bit!
+ ),
+ "Error: expected integer");
+ }
+
+ // Good input:
+ dumpShouldPass(
+ "TESTCASE A6: extraneous spaces, tab characters and trailing new line characters",
+ appJar, classlist(
+ "Hello ", // trailing spaces
+ "java/lang/Object\tid:\t1", // \t instead of ' '
+ "CustomLoadee id: 2 super: 1 source: " + customJarPath,
+ "CustomInterface2_ia id: 3 super: 1 source: " + customJarPath + " ",
+ "CustomInterface2_ib id: 4 super: 1 source: " + customJarPath + "\t\t\r" ,
+ "CustomLoadee2 id: 5 super: 1 interfaces: 3 4 source: " + customJarPath // preceding spaces
+ ));
+
+ int _max_allowed_line = 4096; // Must match ClassListParser::_max_allowed_line in C code.
+ int _line_buf_extra = 10; // Must match ClassListParser::_line_buf_extra in C code.
+ StringBuffer sbuf = new StringBuffer();
+ for (int i=0; i<_max_allowed_line+1; i++) {
+ sbuf.append("x");
+ }
+
+ dumpShouldFail(
+ "TESTCASE A7: bad input - line too long",
+ appJar, classlist(
+ sbuf.toString()
+ ),
+ "input line too long (must be no longer than " + _max_allowed_line + " chars");
+
+ for (int i=0; i<_line_buf_extra + 1000; i++) {
+ sbuf.append("X");
+ }
+
+ dumpShouldFail(
+ "TESTCASE A8: bad input - line too long: try to overflow C buffer",
+ appJar, classlist(
+ sbuf.toString()
+ ),
+ "input line too long (must be no longer than " + _max_allowed_line + " chars");
+ }
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatB.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,74 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Tests the format checking of hotspot/src/closed/share/vm/classfile/classListParser.cpp.
+ *
+ * (NOTE: AppCDS does not support uncompressed oops)
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (sun.arch.data.model == "64")
+ * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris")
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java test-classes/CustomLoadee.java test-classes/CustomLoadee2.java
+ * test-classes/CustomInterface2_ia.java test-classes/CustomInterface2_ib.java
+ * @run main ClassListFormatB
+ */
+
+public class ClassListFormatB extends ClassListFormatBase {
+ static {
+ // Uncomment the following line to run only one of the test cases
+ // ClassListFormatBase.RUN_ONLY_TEST = "TESTCASE B1";
+ }
+
+ public static void main(String[] args) throws Throwable {
+ String appJar = JarBuilder.getOrCreateHelloJar();
+ String customJarPath = JarBuilder.build("ClassListFormatB", "CustomLoadee",
+ "CustomLoadee2", "CustomInterface2_ia", "CustomInterface2_ib");
+ //----------------------------------------------------------------------
+ // TESTGROUP B if source IS specified
+ //----------------------------------------------------------------------
+ dumpShouldFail(
+ "TESTCASE B1: if source: is specified, must specify super:",
+ appJar, classlist(
+ "Hello",
+ "java/lang/Object id: 1",
+ "CustomLoadee id: 2 source: " + customJarPath
+ ),
+ "If source location is specified, super class must be also specified");
+
+ dumpShouldFail(
+ "TESTCASE B2: if source: is specified, must specify id:",
+ appJar, classlist(
+ "Hello",
+ "java/lang/Object id: 1",
+ "CustomLoadee super: 1 source: " + customJarPath
+ ),
+ "If source location is specified, id must be also specified");
+ }
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatBase.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,82 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+
+/**
+ * Base class for ClassListFormat[A,B,C...].java
+ */
+public class ClassListFormatBase {
+ protected static String RUN_ONLY_TEST = null;
+
+ static void dumpShouldFail(String caseHelp, String appJar, String[] appClasses,
+ String... expected_errors) throws Throwable {
+ if (RUN_ONLY_TEST != null && !caseHelp.startsWith(RUN_ONLY_TEST)) {
+ System.out.println("Skipped via RUN_ONLY_TEST: " + caseHelp);
+ return;
+ }
+ System.out.println("------------------------------");
+ System.out.println(caseHelp);
+ System.out.println("------------------------------");
+
+ try {
+ OutputAnalyzer output = TestCommon.dump(appJar, appClasses);
+ output.shouldHaveExitValue(1);
+ for (String s : expected_errors) {
+ output.shouldContain(s);
+ }
+ } catch (Throwable t) {
+ System.out.println("FAILED CASE: " + caseHelp);
+ throw t;
+ }
+ }
+
+ static void dumpShouldPass(String caseHelp, String appJar, String[] appClasses,
+ String... expected_msgs) throws Throwable {
+ if (RUN_ONLY_TEST != null && !caseHelp.startsWith(RUN_ONLY_TEST)) {
+ System.out.println("Skipped via RUN_ONLY_TEST: " + caseHelp);
+ return;
+ }
+ System.out.println("------------------------------");
+ System.out.println(caseHelp);
+ System.out.println("------------------------------");
+
+ try {
+ OutputAnalyzer output = TestCommon.dump(appJar, appClasses);
+ output.shouldHaveExitValue(0);
+ output.shouldContain("Dumping");
+ for (String s : expected_msgs) {
+ output.shouldContain(s);
+ }
+ } catch (Throwable t) {
+ System.out.println("FAILED CASE: " + caseHelp);
+ throw t;
+ }
+ }
+
+ static String[] classlist(String... args) {
+ return TestCommon.list(args);
+ }
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatC.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,76 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Tests the format checking of hotspot/src/closed/share/vm/classfile/classListParser.cpp.
+ *
+ * (NOTE: AppCDS does not support uncompressed oops)
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (sun.arch.data.model == "64")
+ * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris")
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java test-classes/CustomLoadee.java test-classes/CustomLoadee2.java
+ * test-classes/CustomInterface2_ia.java test-classes/CustomInterface2_ib.java
+ * @run main ClassListFormatC
+ */
+
+public class ClassListFormatC extends ClassListFormatBase {
+ static {
+ // Uncomment the following line to run only one of the test cases
+ // ClassListFormatBase.RUN_ONLY_TEST = "TESTCASE C1";
+ }
+
+ public static void main(String[] args) throws Throwable {
+ String appJar = JarBuilder.getOrCreateHelloJar();
+ String customJarPath = JarBuilder.build("ClassListFormatC", "CustomLoadee",
+ "CustomLoadee2", "CustomInterface2_ia",
+ "CustomInterface2_ib");
+
+ //----------------------------------------------------------------------
+ // TESTGROUP C: if source IS NOT specified
+ //----------------------------------------------------------------------
+ dumpShouldFail(
+ "TESTCASE C1: if source: is NOT specified, must NOT specify super:",
+ appJar, classlist(
+ "Hello",
+ "java/lang/Object id: 1",
+ "CustomLoadee super: 1"
+ ),
+ "If source location is not specified, super class must not be specified");
+
+ dumpShouldFail(
+ "TESTCASE C2: if source: is NOT specified, must NOT specify interface:",
+ appJar, classlist(
+ "Hello",
+ "java/lang/Object id: 1",
+ "CustomLoadee interfaces: 1"
+ ),
+ "If source location is not specified, interface(s) must not be specified");
+ }
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatD.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,85 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Tests the format checking of hotspot/src/closed/share/vm/classfile/classListParser.cpp.
+ *
+ * (NOTE: AppCDS does not support uncompressed oops)
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (sun.arch.data.model == "64")
+ * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris")
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java test-classes/CustomLoadee.java test-classes/CustomLoadee2.java
+ * test-classes/CustomInterface2_ia.java test-classes/CustomInterface2_ib.java
+ * @run main ClassListFormatD
+ */
+
+public class ClassListFormatD extends ClassListFormatBase {
+ static {
+ // Uncomment the following line to run only one of the test cases
+ // ClassListFormatBase.RUN_ONLY_TEST = "TESTCASE D1";
+ }
+
+ public static void main(String[] args) throws Throwable {
+ String appJar = JarBuilder.getOrCreateHelloJar();
+ String customJarPath = JarBuilder.build("ClassListFormatD", "CustomLoadee",
+ "CustomLoadee2", "CustomInterface2_ia",
+ "CustomInterface2_ib");
+
+ //----------------------------------------------------------------------
+ // TESTGROUP D: bad use of IDs
+ //----------------------------------------------------------------------
+ dumpShouldFail(
+ "TESTCASE D1: duplicated id:",
+ appJar, classlist(
+ "Hello",
+ "java/lang/Object id: 1",
+ "CustomLoadee id: 1 super: 1 source: " + customJarPath
+ ),
+ "Duplicated ID 1 for class CustomLoadee");
+
+ dumpShouldFail(
+ "TESTCASE D2: bad ID for super:",
+ appJar, classlist(
+ "Hello",
+ "java/lang/Object id: 1",
+ "CustomLoadee id: 2 super: 2 source: " + customJarPath
+ ),
+ "Super class id 2 is not yet loaded");
+
+ dumpShouldFail(
+ "TESTCASE D3: bad ID in interfaces:",
+ appJar, classlist(
+ "Hello",
+ "java/lang/Object id: 1",
+ "CustomLoadee id: 2 super: 1 interfaces: 2 source: " + customJarPath
+ ),
+ "Interface id 2 is not yet loaded");
+ }
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/ClassListFormatE.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,111 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Tests the format checking of hotspot/src/closed/share/vm/classfile/classListParser.cpp.
+ *
+ * (NOTE: AppCDS does not support uncompressed oops)
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (sun.arch.data.model == "64")
+ * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris")
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/Hello.java test-classes/CustomLoadee.java test-classes/CustomLoadee2.java
+ * test-classes/CustomInterface2_ia.java test-classes/CustomInterface2_ib.java
+ * @run main ClassListFormatE
+ */
+
+public class ClassListFormatE extends ClassListFormatBase {
+ static {
+ // Uncomment the following line to run only one of the test cases
+ // ClassListFormatBase.RUN_ONLY_TEST = "TESTCASE E1";
+ }
+
+ public static void main(String[] args) throws Throwable {
+ String appJar = JarBuilder.getOrCreateHelloJar();
+ String customJarPath = JarBuilder.build("ClassListFormatE", "CustomLoadee",
+ "CustomLoadee2", "CustomInterface2_ia",
+ "CustomInterface2_ib");
+
+ //----------------------------------------------------------------------
+ // TESTGROUP E: super class and interfaces
+ //----------------------------------------------------------------------
+ dumpShouldFail(
+ "TESTCASE E1: missing interfaces: keyword",
+ appJar, classlist(
+ "Hello",
+ "java/lang/Object id: 1",
+ "CustomLoadee2 id: 1 super: 1 source: " + customJarPath
+ ),
+ "Class CustomLoadee2 implements the interface CustomInterface2_ia, but no interface has been specified in the input line");
+
+ dumpShouldFail(
+ "TESTCASE E2: missing one interface",
+ appJar, classlist(
+ "Hello",
+ "java/lang/Object id: 1",
+ "CustomInterface2_ia id: 2 super: 1 source: " + customJarPath,
+ "CustomInterface2_ib id: 3 super: 1 source: " + customJarPath,
+ "CustomLoadee2 id: 4 super: 1 interfaces: 2 source: " + customJarPath
+ ),
+ "The interface CustomInterface2_ib implemented by class CustomLoadee2 does not match any of the specified interface IDs");
+
+ dumpShouldFail(
+ "TESTCASE E3: specifying an interface that's not implemented by the class",
+ appJar, classlist(
+ "Hello",
+ "java/lang/Object id: 1",
+ "CustomInterface2_ia id: 2 super: 1 source: " + customJarPath,
+ "CustomLoadee id: 2 super: 1 interfaces: 2 source: " + customJarPath
+ ),
+ "The number of interfaces (1) specified in class list does not match the class file (0)");
+
+ dumpShouldFail(
+ "TESTCASE E4: repeating an ID in the interfaces: keyword",
+ appJar, classlist(
+ "Hello",
+ "java/lang/Object id: 1",
+ "CustomInterface2_ia id: 2 super: 1 source: " + customJarPath,
+ "CustomInterface2_ib id: 3 super: 1 source: " + customJarPath,
+ "CustomLoadee2 id: 4 super: 1 interfaces: 2 2 3 source: " + customJarPath
+ ),
+ "The number of interfaces (3) specified in class list does not match the class file (2)");
+
+ dumpShouldFail(
+ "TESTCASE E5: wrong super class",
+ appJar, classlist(
+ "Hello",
+ "java/lang/Object id: 1",
+ "CustomInterface2_ia id: 2 super: 1 source: " + customJarPath,
+ "CustomInterface2_ib id: 3 super: 1 source: " + customJarPath,
+ "CustomLoadee id: 4 super: 1 source: " + customJarPath,
+ "CustomLoadee2 id: 5 super: 4 interfaces: 2 3 source: " + customJarPath
+ ),
+ "The specified super class CustomLoadee (id 4) does not match actual super class java.lang.Object");
+ }
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/CustomLoaderApp.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,110 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+// This is a utlitity test class for loading classes-under-test
+// by means of custom class loader.
+// See AppCDS/jvmti/transformRelatedClasses/TransformRelatedClasses.java
+// for an example.
+// Use this test app in conjunction with other tests
+// to load and exercise classes using custom class loader(s).
+// This class is intended to be called by the "main test driver"
+// inside a child process, normally with sharing enabled.
+//
+// Arguments: customJarPath, loaderType, testClass
+// customJarPath - a path to jar file containing classes for
+// loading via this custom class loader, including the
+// testClass
+// loaderType - Currently only "unregistered"
+// (Fingerprint verification method) is allowed
+// testClass - the class to be loader; the test method with
+// signature 'public static void test()' will be called
+// on this class, so class must contain such method
+
+
+import java.io.File;
+import java.lang.reflect.Method;
+import java.net.URL;
+import java.net.URLClassLoader;
+import java.util.logging.Logger;
+
+public class CustomLoaderApp {
+ public static void ping() {};
+
+ private static void log(String msg) {
+ System.out.println("CustomLoaderApp: " + msg);
+ }
+
+ public static void main(String[] args) throws Exception {
+ String path = args[0];
+ URL url = new File(path).toURI().toURL();
+ URL[] urls = new URL[] {url};
+
+ String loaderType = args[1];
+ log("loaderType = " + loaderType);
+
+ String testClass = args[2];
+ log("testClass = " + testClass);
+
+ switch(loaderType) {
+ case "unregistered":
+ loadAndUseWithUnregisteredLoader(urls, testClass);
+ break;
+ default:
+ throw new IllegalArgumentException("loader type is wrong: " + loaderType);
+ }
+ }
+
+
+ // Load the test classes using unregistered loader
+ // (i.e. loader that is not using AppCDS API)
+ private static void loadAndUseWithUnregisteredLoader(URL[] urls, String testClass)
+ throws Exception {
+ URLClassLoader urlClassLoader = new URLClassLoader(urls);
+ callTestMethod(loadAndCheck(urlClassLoader, testClass));
+ }
+
+ private static Class loadAndCheck(ClassLoader loader, String className)
+ throws ClassNotFoundException {
+ Class c = loader.loadClass(className);
+ log("class =" + c);
+ log("loader = " + c.getClassLoader());
+
+ // Check that c is defined by the correct loader
+ if (c.getClassLoader() != loader) {
+ String msg = String.format("c.getClassLoader() equals to <%s>, expected <%s>",
+ c.getClassLoader(), loader);
+ throw new RuntimeException(msg);
+ }
+ return c;
+ }
+
+ private static void callTestMethod(Class c) throws Exception {
+ Method[] methods = c.getDeclaredMethods();
+ for (Method m : methods) {
+ log("method = " + m.getName());
+ if (m.getName().equals("test"))
+ m.invoke(null);
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/HelloCustom.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,75 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Hello World test for AppCDS custom loader support
+ * (NOTE: AppCDS does not support uncompressed oops)
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (sun.arch.data.model == "64")
+ * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris")
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * @compile test-classes/Hello.java test-classes/CustomLoadee.java
+ * @build sun.hotspot.WhiteBox
+ * @run main ClassFileInstaller -jar hello.jar Hello
+ * @run main ClassFileInstaller -jar hello_custom.jar CustomLoadee
+ * @run main ClassFileInstaller -jar WhiteBox.jar sun.hotspot.WhiteBox
+ * @run main HelloCustom
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+import sun.hotspot.WhiteBox;
+
+public class HelloCustom {
+ public static void main(String[] args) throws Exception {
+ String wbJar = ClassFileInstaller.getJarPath("WhiteBox.jar");
+ String use_whitebox_jar = "-Xbootclasspath/a:" + wbJar;
+
+ String appJar = ClassFileInstaller.getJarPath("hello.jar");
+ String customJarPath = ClassFileInstaller.getJarPath("hello_custom.jar");
+
+ // Dump the archive
+ String classlist[] = new String[] {
+ "Hello",
+ "java/lang/Object id: 1",
+ "CustomLoadee id: 2 super: 1 source: " + customJarPath
+ };
+
+ OutputAnalyzer output;
+ TestCommon.testDump(appJar, classlist,
+ // command-line arguments ...
+ use_whitebox_jar);
+
+ output = TestCommon.exec(appJar,
+ // command-line arguments ...
+ use_whitebox_jar,
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+WhiteBoxAPI",
+ "Hello", customJarPath);
+ TestCommon.checkExec(output);
+ }
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/LoaderSegregationTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,125 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Check that during dumping, the classes for BOOT/EXT/APP loaders are segregated from the
+ * custom loader classes.
+ * (NOTE: AppCDS does not support uncompressed oops)
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (sun.arch.data.model == "64")
+ * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris")
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/LoaderSegregation.java
+ * test-classes/CustomLoadee.java test-classes/CustomLoadee2.java
+ * test-classes/CustomInterface2_ia.java test-classes/CustomInterface2_ib.java
+ * test-classes/CustomLoadee3.java test-classes/CustomLoadee3Child.java
+ * test-classes/OnlyBuiltin.java
+ * test-classes/OnlyUnregistered.java
+ * ../test-classes/Util.java
+ * @build sun.hotspot.WhiteBox
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @run main LoaderSegregationTest
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+import sun.hotspot.WhiteBox;
+
+/**
+ * See "Handling of the classes in the AppCDS archive" at the top of
+ * systemDicrionatyShared.hpp.
+ *
+ * This test ensure that the 2 types of archived classes (BUILTIN and UNREGISTERED)
+ * are segregated at both dump-time and run time:
+ *
+ * [A] An archived BUILTIN class cannot be a subclass of a non-BUILTIN class.
+ * [B] An archived BUILTIN class cannot implement a non-BUILTIN interface.
+ * [C] BUILTIN and UNREGISTERED classes can be loaded only by their corresponding
+ * type of loaders.
+ *
+ */
+public class LoaderSegregationTest {
+ public static void main(String[] args) throws Exception {
+ String wbJar = JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox");
+ String use_whitebox_jar = "-Xbootclasspath/a:" + wbJar;
+
+ String appJar = JarBuilder.build("LoaderSegregation_app", "LoaderSegregation",
+ "CustomLoadee", "CustomLoadee2", "CustomLoadee3Child", "CustomInterface2_ia",
+ "OnlyBuiltin", "Util");
+
+ String app2Jar = JarBuilder.build("LoaderSegregation_app2", "CustomLoadee3", "CustomInterface2_ib");
+
+ String customJarPath = JarBuilder.build("LoaderSegregation_custom", "CustomLoadee",
+ "CustomLoadee2", "CustomInterface2_ia", "CustomInterface2_ib",
+ "CustomLoadee3", "CustomLoadee3Child",
+ "OnlyBuiltin", "OnlyUnregistered");
+
+ // Dump the archive
+ String classlist[] = new String[] {
+ "LoaderSegregation",
+ "java/lang/Object id: 1",
+
+ // These are the UNREGISTERED classes: they have "source:"
+ // but they don't have "loader:".
+ "CustomLoadee id: 2 super: 1 source: " + customJarPath,
+
+ "CustomInterface2_ia id: 3 super: 1 source: " + customJarPath,
+ "CustomInterface2_ib id: 4 super: 1 source: " + customJarPath,
+ "CustomLoadee2 id: 5 super: 1 interfaces: 3 4 source: " + customJarPath,
+
+ "CustomLoadee3 id: 6 super: 1 source: " + customJarPath,
+ "CustomLoadee3Child id: 7 super: 6 source: " + customJarPath,
+
+ // At dump time, the following BUILTIN classes are loaded after the UNREGISTERED
+ // classes from above. However, at dump time, they cannot use the UNREGISTERED classes are their
+ // super or interface.
+ "CustomLoadee", // can be loaded at dump time
+ "CustomLoadee2", // cannot be loaded at dump time (interface missing)
+ "CustomLoadee3Child", // cannot be loaded at dump time (super missing)
+
+ // Check that BUILTIN and UNREGISTERED classes can be loaded only by their
+ // corresponding type of loaders.
+ "OnlyBuiltin",
+ "OnlyUnregistered id: 9 super: 1 source: " + customJarPath,
+ };
+
+ OutputAnalyzer output;
+ TestCommon.testDump(appJar, classlist,
+ // command-line arguments ...
+ use_whitebox_jar);
+
+ output = TestCommon.exec(TestCommon.concatPaths(appJar, app2Jar),
+ // command-line arguments ...
+ "--add-opens=java.base/java.lang=ALL-UNNAMED",
+ "--add-opens=java.base/java.security=ALL-UNNAMED",
+ use_whitebox_jar,
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+WhiteBoxAPI",
+ "LoaderSegregation", customJarPath);
+ TestCommon.checkExec(output);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/ParallelTestBase.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,99 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+
+/*
+ * This is a base class for the following test cases:
+ * ParallelTestMultiFP.java
+ * ParallelTestSingleFP.java
+ */
+public class ParallelTestBase {
+ public static final int MAX_CLASSES = 40; // must match ../test-classes/ParallelLoad.java
+ public static int NUM_THREADS = 4; // must match ../test-classes/ParallelLoad.java
+
+ public static final int SINGLE_CUSTOM_LOADER = 1;
+ public static final int MULTI_CUSTOM_LOADER = 2;
+
+ public static final int FINGERPRINT_MODE = 1;
+
+ public static void run(String[] args, int loaderType, int mode) throws Exception {
+ String[] cust_classes = new String[MAX_CLASSES];
+ String[] cust_list;
+
+ if (mode == FINGERPRINT_MODE) {
+ cust_list = new String[MAX_CLASSES];
+ } else {
+ cust_list = new String[MAX_CLASSES * NUM_THREADS];
+ }
+
+ for (int i = 0; i<MAX_CLASSES; i++) {
+ cust_classes[i] = "ParallelClass" + i;
+ }
+ String customJarPath = JarBuilder.build("ParallelTestBase", cust_classes);
+
+ for (int i = 0, n=0; i<MAX_CLASSES; i++) {
+ int super_id = 1;
+ if (mode == FINGERPRINT_MODE) {
+ // fingerprint mode -- no need to use the "loader:" option.
+ int id = i + 2;
+ cust_list[i] = cust_classes[i] + " id: " + id + " super: " + super_id + " source: " + customJarPath;
+ } else {
+ throw new RuntimeException("Only FINGERPRINT_MODE is supported");
+ }
+ }
+
+ String app_list[];
+ String mainClass;
+ String appJar;
+
+ if (mode == FINGERPRINT_MODE) {
+ appJar = JarBuilder.build("parallel_fp",
+ "ParallelLoad",
+ "ParallelLoadThread",
+ "ParallelLoadWatchdog");
+ app_list = new String[] {
+ "java/lang/Object id: 1",
+ "ParallelLoad",
+ "ParallelLoadThread",
+ "ParallelLoadWatchdog"
+ };
+ mainClass = "ParallelLoad";
+ } else {
+ throw new RuntimeException("Currently only FINGERPRINT_MODE is supported");
+ }
+
+ OutputAnalyzer output;
+ TestCommon.testDump(appJar, TestCommon.concat(app_list, cust_list));
+
+ String loaderTypeArg = (loaderType == SINGLE_CUSTOM_LOADER) ? "SINGLE_CUSTOM_LOADER" : "MULTI_CUSTOM_LOADER";
+ String modeArg = "FINGERPRINT_MODE";
+
+ output = TestCommon.exec(appJar,
+ // command-line arguments ...
+ "--add-opens=java.base/java.security=ALL-UNNAMED",
+ mainClass, loaderTypeArg, modeArg, customJarPath);
+ TestCommon.checkExec(output);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/ParallelTestMultiFP.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,44 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Load classes from CDS archive into multiple custom loader using parallel threads
+ * (NOTE: AppCDS does not support uncompressed oops)
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (sun.arch.data.model == "64")
+ * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris")
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile ../test-classes/ParallelLoad.java ../test-classes/ParallelClasses.java
+ * @run main ParallelTestMultiFP
+ */
+
+public class ParallelTestMultiFP extends ParallelTestBase {
+ public static void main(String[] args) throws Exception {
+ ParallelTestBase.run(args, MULTI_CUSTOM_LOADER, FINGERPRINT_MODE);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/ParallelTestSingleFP.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,44 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Load classes from CDS archive into a single custom loader using parallel threads (finger print)
+ * (NOTE: AppCDS does not support uncompressed oops)
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (sun.arch.data.model == "64")
+ * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris")
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile ../test-classes/ParallelLoad.java ../test-classes/ParallelClasses.java
+ * @run main ParallelTestSingleFP
+ */
+
+public class ParallelTestSingleFP extends ParallelTestBase {
+ public static void main(String[] args) throws Exception {
+ ParallelTestBase.run(args, SINGLE_CUSTOM_LOADER, FINGERPRINT_MODE);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/ProhibitedPackageNamesTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,60 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Make sure prohibited packages cannot be stored into archive for custom loaders.
+ * (NOTE: AppCDS does not support uncompressed oops)
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (sun.arch.data.model == "64")
+ * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris")
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile ClassListFormatBase.java test-classes/Hello.java test-classes/InProhibitedPkg.java
+ * @run main ProhibitedPackageNamesTest
+ */
+
+public class ProhibitedPackageNamesTest extends ClassListFormatBase {
+ static {
+ // Uncomment the following line to run only one of the test cases
+ // ClassListFormatBase.RUN_ONLY_TEST = "TESTCASE PPN1";
+ }
+
+ public static void main(String[] args) throws Throwable {
+ String appJar = JarBuilder.getOrCreateHelloJar();
+ String customJarPath = JarBuilder.build("ProhibitedPackageNames_custom", "java/InProhibitedPkg");
+
+ dumpShouldPass(
+ "TESTCASE PPN1: prohibited package name without loader:",
+ appJar, classlist(
+ "Hello",
+ "java/lang/Object id: 1",
+ // Without "loader:" keyword.
+ "java/InProhibitedPkg id: 2 super: 1 source: " + customJarPath
+ ),
+ "Prohibited package for non-bootstrap classes: java/InProhibitedPkg.class");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/ProtectionDomain.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,61 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary AppCDS handling of protection domain in custom loaders.
+ *
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (sun.arch.data.model == "64")
+ * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris")
+ *
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/ProtDomain.java
+ * @run main ProtectionDomain
+ */
+
+public class ProtectionDomain {
+ public static void main(String[] args) throws Exception {
+ String appJar = JarBuilder.build("ProtectionDomain-app", "ProtDomain");
+
+ String customJar = JarBuilder.build("ProtectionDomain-custom",
+ "ProtDomainClassForArchive", "ProtDomainNotForArchive");
+ String[] classlist = new String[] {
+ "java/lang/Object id: 1",
+ "ProtDomain id: 2 super: 1 source: " + appJar,
+ "ProtDomainClassForArchive id: 3 super: 1 source: " + customJar
+ };
+
+ TestCommon.testDump(appJar, classlist);
+
+ // First class is loaded from CDS, second class is loaded from JAR
+ TestCommon.checkExec(TestCommon.exec(appJar, "-verbose:class", "ProtDomain", customJar),
+ "[class,load] ProtDomainClassForArchive source: shared objects file",
+ "[class,load] ProtDomainNotForArchive source: file");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/SameNameInTwoLoadersTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,94 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Testing the loading of a class with the same name in two different class loaders.
+ *
+ * (NOTE: AppCDS does not support uncompressed oops)
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (sun.arch.data.model == "64")
+ * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris")
+ *
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/CustomLoadee.java
+ * test-classes/CustomLoadee3.java
+ * test-classes/SameNameUnrelatedLoaders.java
+ * @build sun.hotspot.WhiteBox
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @run main SameNameInTwoLoadersTest
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+import sun.hotspot.WhiteBox;
+
+
+public class SameNameInTwoLoadersTest {
+ private static String appJar;
+ private static String customJar;
+ private static String useWbParam;
+
+ public static void main(String[] args) throws Exception {
+ appJar = JarBuilder.build("SameNameInTwoLoadersTest",
+ "SameNameUnrelatedLoaders");
+
+ customJar = JarBuilder.build("SameNameInTwoLoadersTest_custom", "CustomLoadee", "CustomLoadee3");
+
+ useWbParam = "-Xbootclasspath/a:" +
+ JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox");;
+
+ // ====== unrelated loaders
+ executeTestCase(getClassList_FP(),
+ "SameNameUnrelatedLoaders", "FpBoth");
+ }
+
+ private static void executeTestCase(String[] classlist,
+ String testClass, String testCaseId) throws Exception {
+ classlist[0] = testClass;
+
+ TestCommon.testDump(appJar, classlist, useWbParam);
+
+ OutputAnalyzer output = TestCommon.exec(appJar,
+ // command-line arguments ...
+ "--add-opens=java.base/java.security=ALL-UNNAMED",
+ useWbParam,
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+WhiteBoxAPI",
+ testClass,
+ customJar, testCaseId);
+ TestCommon.checkExec(output);
+ }
+
+ // Single entry, no loader specified (FP method)
+ private static String[] getClassList_FP() {
+ return new String[] {
+ "SameNameUnrelatedLoaders",
+ "java/lang/Object id: 1",
+ "CustomLoadee id: 10 super: 1 source: " + customJar,
+ };
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/UnintendedLoadersTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,76 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Make sure classes intended for custom loaders cannot be loaded by BOOT/EXT/APP loaders
+ * (NOTE: AppCDS does not support uncompressed oops)
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (sun.arch.data.model == "64")
+ * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris")
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/UnintendedLoaders.java test-classes/CustomLoadee.java
+ * @build sun.hotspot.WhiteBox
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @run main UnintendedLoadersTest
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+import sun.hotspot.WhiteBox;
+
+public class UnintendedLoadersTest {
+ public static void main(String[] args) throws Exception {
+ String wbJar = JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox");
+ String use_whitebox_jar = "-Xbootclasspath/a:" + wbJar;
+
+ String appJar = JarBuilder.build("UnintendedLoaders_app", "UnintendedLoaders");
+ String customJarPath = JarBuilder.build("UnintendedLoaders_custom", "CustomLoadee");
+
+ // Dump the archive
+ String classlist[] = new String[] {
+ "UnintendedLoadersTest",
+ "java/lang/Object id: 1",
+
+ // Without "loader:" keyword.
+ "CustomLoadee id: 2 super: 1 source: " + customJarPath,
+ };
+
+ OutputAnalyzer output;
+ TestCommon.testDump(appJar, classlist,
+ // command-line arguments ...
+ use_whitebox_jar);
+
+ output = TestCommon.exec(appJar,
+ // command-line arguments ...
+ use_whitebox_jar,
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+WhiteBoxAPI",
+ "UnintendedLoaders");
+ TestCommon.checkExec(output);
+ }
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/UnloadUnregisteredLoaderTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,82 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Test the behavior when shared classes loaded by custom loaders are
+ * unloaded.
+ * (NOTE: AppCDS does not support uncompressed oops)
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (sun.arch.data.model == "64")
+ * @requires ((os.family == "linux") & (os.arch=="amd64")) | (os.family == "solaris")
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds /test/hotspot/jtreg/runtime/testlibrary
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @build sun.hotspot.WhiteBox ClassUnloadCommon
+ * @compile test-classes/UnloadUnregisteredLoader.java test-classes/CustomLoadee.java
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @run main ClassFileInstaller ClassUnloadCommon
+ * @run main ClassFileInstaller ClassUnloadCommon$1
+ * @run main ClassFileInstaller ClassUnloadCommon$TestFailure
+ * @run main UnloadUnregisteredLoaderTest
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+import sun.hotspot.WhiteBox;
+
+public class UnloadUnregisteredLoaderTest {
+ public static void main(String[] args) throws Exception {
+ String appJar1 = JarBuilder.build("UnloadUnregisteredLoader_app1", "UnloadUnregisteredLoader");
+ String appJar2 = JarBuilder.build(true, "UnloadUnregisteredLoader_app2",
+ "ClassUnloadCommon", "ClassUnloadCommon$1", "ClassUnloadCommon$TestFailure");
+ String customJarPath = JarBuilder.build("UnloadUnregisteredLoader_custom", "CustomLoadee");
+ String wbJar = JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox");
+ String use_whitebox_jar = "-Xbootclasspath/a:" + wbJar;
+
+ String classpath = TestCommon.concatPaths(appJar1, appJar2);
+ String classlist[] = new String[] {
+ "UnloadUnregisteredLoader",
+ "ClassUnloadCommon",
+ "ClassUnloadCommon$1",
+ "ClassUnloadCommon$TestFailure",
+ "java/lang/Object id: 1",
+ "CustomLoadee id: 2 super: 1 source: " + customJarPath,
+ };
+
+ OutputAnalyzer output;
+ TestCommon.testDump(classpath, classlist,
+ // command-line arguments ...
+ use_whitebox_jar);
+
+ output = TestCommon.exec(classpath,
+ // command-line arguments ...
+ use_whitebox_jar,
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+WhiteBoxAPI",
+ "UnloadUnregisteredLoader",
+ customJarPath);
+ TestCommon.checkExec(output);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/UnsupportedPlatforms.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,67 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Ensure that support for AppCDS custom class loaders are not enabled on unsupported platforms.
+ * The only supported platforms are Linux/AMD64 and 64-bit Solaris.
+ * (NOTE: AppCDS does not support uncompressed oops)
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile test-classes/SimpleHello.java
+ * @run main UnsupportedPlatforms
+ */
+
+import jdk.test.lib.Platform;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class UnsupportedPlatforms {
+ public static String PLATFORM_NOT_SUPPORTED_WARNING =
+ "AppCDS custom class loaders not supported on this platform";
+
+ public static void main(String[] args) throws Exception {
+ String appJar = JarBuilder.build("UnsupportedPlatforms", "SimpleHello");
+
+ // Dump the archive
+ String classlist[] = new String[] {
+ "SimpleHello",
+ "java/lang/Object id: 1",
+ "CustomLoadee id: 2 super: 1 source: " + appJar
+ };
+
+ OutputAnalyzer out = TestCommon.dump(appJar, classlist);
+
+ if ((Platform.isSolaris() && Platform.is64bit()) ||
+ (Platform.isLinux() && Platform.isX64())) {
+ out.shouldNotContain(PLATFORM_NOT_SUPPORTED_WARNING);
+ out.shouldHaveExitValue(0);
+ } else {
+ out.shouldContain(PLATFORM_NOT_SUPPORTED_WARNING);
+ out.shouldHaveExitValue(1);
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/CustomInterface2_ia.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,25 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+interface CustomInterface2_ia {}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/CustomInterface2_ib.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,25 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+interface CustomInterface2_ib {}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/CustomLoadee.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,29 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class CustomLoadee {
+ public String toString() {
+ return "this is CustomLoadee";
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/CustomLoadee2.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,29 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class CustomLoadee2 implements CustomInterface2_ia, CustomInterface2_ib {
+ public String toString() {
+ return "this is CustomLoadee";
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/CustomLoadee3.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,29 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class CustomLoadee3 {
+ public String toString() {
+ return "this is CustomLoadee3";
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/CustomLoadee3Child.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,29 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class CustomLoadee3Child extends CustomLoadee3 {
+ public String toString() {
+ return "this is CustomLoadee3Child";
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/Hello.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,56 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.io.*;
+import java.net.*;
+import sun.hotspot.WhiteBox;
+
+public class Hello {
+ public static void main(String args[]) throws Exception {
+ String path = args[0];
+ URL url = new File(path).toURI().toURL();
+ URL[] urls = new URL[] {url};
+ System.out.println(path);
+ System.out.println(url);
+
+ URLClassLoader urlClassLoader = new URLClassLoader(urls);
+ Class c = urlClassLoader.loadClass("CustomLoadee");
+ System.out.println(c);
+ System.out.println(c.getClassLoader());
+
+ // [1] Check that CustomLoadee is defined by the correct loader
+ if (c.getClassLoader() != urlClassLoader) {
+ throw new RuntimeException("c.getClassLoader() == " + c.getClassLoader() +
+ ", expected == " + urlClassLoader);
+ }
+
+ // [2] Check that CustomLoadee is loaded from shared archive.
+ WhiteBox wb = WhiteBox.getWhiteBox();
+ if (wb.isSharedClass(Hello.class)) {
+ if (!wb.isSharedClass(c)) {
+ throw new RuntimeException("wb.isSharedClass(c) should be true");
+ }
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/InProhibitedPkg.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,33 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+package java;
+
+public class InProhibitedPkg {
+ static {
+ if (true) {
+ throw new RuntimeException("This class shouldn't be loaded by any loader other than BOOT");
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/LoaderAPI.mf Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,12 @@
+Manifest-Version: 1.0
+Created-By: 1.9.0-internal (Oracle Corporation)
+Specification-Title: My Specification Title
+Specification-Version: 1.0
+Specification-Vendor: My Specification Vendor
+Implementation-Title: My Implementation Title
+Implementation-Version: 1.0
+Implementation-Vendor: My Implementation Vendor
+
+Name: pkg1/
+Implementation-Version: 2.0
+Sealed: true
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/LoaderSegregation.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,99 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.io.*;
+import java.net.*;
+import sun.hotspot.WhiteBox;
+
+public class LoaderSegregation {
+ // Use these definitions instead of literal strings, to avoid typos.
+ static final String ONLY_BUILTIN = "OnlyBuiltin";
+ static final String ONLY_UNREGISTERED = "OnlyUnregistered";
+
+ public static void main(String args[]) throws Exception {
+ WhiteBox wb = WhiteBox.getWhiteBox();
+
+ // [A] An archived BUILTIN class cannot be a subclass of a non-BUILTIN class.
+ // [B] An archived BUILTIN class cannot implement a non-BUILTIN interface.
+ if (wb.isSharedClass(LoaderSegregation.class)) {
+ // [1] check that CustomLoadee is loadable from archive
+ if (!wb.isSharedClass(CustomLoadee.class)) {
+ throw new RuntimeException("wb.isSharedClass(CustomLoadee.class) should be true");
+ }
+
+ // [2] CustomInterface2_ia should be archived, even though it was not specified in the classlist.
+ // It was successfully dumped as a side effect of attempting to load CustomLoadee2
+ // during dump time. Note that CustomLoadee2 failed to dump because one of its interfaces,
+ // CustomInterface2_ib, was not loadable from the BOOT/EXT/APP classpath. during dump time.
+ if (!wb.isSharedClass(CustomInterface2_ia.class)) {
+ throw new RuntimeException("wb.isSharedClass(CustomInterface2_ia.class) should be true");
+ }
+
+ // [3] Check that the BUILTIN versions of CustomLoadee2 and CustomLoadee3Child are loadable
+ // at run time (since we have append LoaderSegregation_app2.jar the classpath),
+ // but these classes must be loaded from the JAR file.
+ if (wb.isSharedClass(CustomLoadee2.class)) {
+ throw new RuntimeException("wb.isSharedClass(CustomLoadee2.class) should be false");
+ }
+ if (wb.isSharedClass(CustomLoadee3.class)) {
+ throw new RuntimeException("wb.isSharedClass(CustomLoadee3.class) should be false");
+ }
+ if (wb.isSharedClass(CustomLoadee3Child.class)) {
+ throw new RuntimeException("wb.isSharedClass(CustomLoadee3Child.class) should be false");
+ }
+ }
+
+ // [C] BUILTIN and UNREGISTERED classes can be loaded only by their corresponding
+ // type of loaders.
+
+ String path = args[0];
+ File jarFile = new File(path);
+ URL url = new File(path).toURI().toURL();
+ URL[] urls = new URL[] {url};
+ ClassLoader appLoader = LoaderSegregation.class.getClassLoader();
+
+ { // BUILTIN LOADER
+ try {
+ appLoader.loadClass(ONLY_UNREGISTERED);
+ throw new RuntimeException("BUILTIN loader cannot load archived UNREGISTERED class");
+ } catch (ClassNotFoundException expected) {}
+ }
+
+ { // UNREGISTERED LOADER
+ URLClassLoader urlClassLoader = new URLClassLoader(urls);
+ Class c2 = Util.defineClassFromJAR(urlClassLoader, jarFile, ONLY_BUILTIN);
+
+ if (c2.getClassLoader() != urlClassLoader) {
+ throw new RuntimeException("Error in test");
+ }
+
+ if (wb.isSharedClass(LoaderSegregation.class)) {
+ if (wb.isSharedClass(c2)) {
+ throw new RuntimeException("wb.isSharedClass(c2) should be false - " +
+ "unregistered loader cannot load an archived BUILTIN class");
+ }
+ }
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/OnlyBuiltin.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,28 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+// See ../LoaderSegregationTest.java for details.
+//
+// This class is archived only as a BUILTIN class.
+public class OnlyBuiltin {}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/OnlyUnregistered.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,28 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+// See ../LoaderSegregationTest.java for details.
+//
+// This class is archived only as a UNREGISTERED class.
+public class OnlyUnregistered {}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/ProtDomain.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,55 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.security.ProtectionDomain;
+import java.net.URLClassLoader;
+import java.net.URL;
+import java.io.File;
+
+// Intended to be called from test ProtectionDomain.java
+//
+// ProtDomainClassForArchive is stored in CDS archive.
+// ProtDomainNotForArchive is NOT stored in CDS archive.
+//
+// However, they should have the same ProtectionDomain instance.
+public class ProtDomain {
+ public static void main(String args[]) throws Exception {
+ String customLdrPath = args[0];
+
+ URL[] urls = new URL[] {new File(customLdrPath).toURI().toURL()};
+ URLClassLoader ldr = new URLClassLoader(urls);
+ ProtectionDomain domain1 = ldr.loadClass("ProtDomainClassForArchive").getProtectionDomain();
+ ProtectionDomain domain2 = ldr.loadClass("ProtDomainNotForArchive").getProtectionDomain();
+
+ System.out.println("domain1 = " + domain1);
+ System.out.println("domain2 = " + domain2);
+
+ if (domain1 != domain2)
+ throw new RuntimeException("Protection Domains do not match!");
+ }
+}
+
+class ProtDomainClassForArchive {}
+
+class ProtDomainNotForArchive {}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/SameNameUnrelatedLoaders.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,101 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.io.File;
+import java.net.URL;
+import java.net.URLClassLoader;
+import sun.hotspot.WhiteBox;
+
+public class SameNameUnrelatedLoaders {
+ public static void main(String args[]) throws Exception {
+ String path = args[0];
+ String testCase = args[1];
+ URL url = new File(path).toURI().toURL();
+ URL[] urls = new URL[] {url};
+
+ ClassLoader appLoader = SameNameUnrelatedLoaders.class.getClassLoader();
+ URLClassLoader ldr01 = null;
+ URLClassLoader ldr02 = null;
+
+ switch (testCase) {
+ case "FpBoth":
+ ldr01 = new URLClassLoader(urls);
+ ldr02 = new URLClassLoader(urls);
+ break;
+
+ default:
+ throw new IllegalArgumentException("Invalid testCase ID");
+ }
+
+
+ Class class01 = ldr01.loadClass("CustomLoadee");
+ Class class02 = ldr02.loadClass("CustomLoadee");
+
+ System.out.println("class01 = " + class01);
+ System.out.println("class02 = " + class02);
+
+ if (class01.getClassLoader() != ldr01) {
+ throw new RuntimeException("class01 loaded by wrong loader");
+ }
+ if (class02.getClassLoader() != ldr02) {
+ throw new RuntimeException("class02 loaded by wrong loader");
+ }
+
+ if (true) {
+ if (class01.isAssignableFrom(class02)) {
+ throw new RuntimeException("assignable condition failed");
+ }
+
+ Object obj01 = class01.newInstance();
+ Object obj02 = class02.newInstance();
+
+ if (class01.isInstance(obj02)) {
+ throw new RuntimeException("instance relationship condition 01 failed");
+ }
+ if (class02.isInstance(obj01)) {
+ throw new RuntimeException("instance relationship condition 02 failed");
+ }
+ }
+
+ WhiteBox wb = WhiteBox.getWhiteBox();
+ if (wb.isSharedClass(SameNameUnrelatedLoaders.class)) {
+ boolean class1Shared = wb.isSharedClass(class01);
+ boolean class2Shared = wb.isSharedClass(class02);
+
+ if (testCase.equals("FpBoth")) {
+ if (!class1Shared) {
+ throw new RuntimeException("first class is not shared");
+ }
+
+ if (class2Shared) {
+ throw new RuntimeException("second class is shared, " +
+ "and it should not be - first come first serve violation");
+ }
+ } else {
+ if (! (class1Shared && class2Shared) )
+ throw new RuntimeException("both classes expected to be shared, but are not");
+ }
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/SimpleHello.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,29 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class SimpleHello {
+ public static void main(String[] args) {
+ System.out.println("Simple Hello");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/UnintendedLoaders.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,54 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import sun.hotspot.WhiteBox;
+
+public class UnintendedLoaders {
+ public static void main(String[] args) throws Exception {
+ ClassLoader loaders[] = new ClassLoader[2];
+ loaders[0] = UnintendedLoaders.class.getClassLoader(); // app loader
+ loaders[1] = loaders[0].getParent(); // platform loader
+
+ String[] names = {
+ "CustomLoadee",
+ };
+
+
+ for (int i=0; i<3; i++) {
+ for (String s : names) {
+ try {
+ if (i <= 1) {
+ System.out.println(loaders[i].loadClass(s));
+ } else {
+ System.out.println(Class.forName(s));
+ }
+ } catch (ClassNotFoundException e) {
+ System.out.println("Expected exception:" + e);
+ continue;
+ }
+ throw new RuntimeException("The class \"" + s + "\" should not be resolved by the application or platform class loader");
+ }
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/customLoader/test-classes/UnloadUnregisteredLoader.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,69 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.io.File;
+import java.net.URL;
+import java.net.URLClassLoader;
+import sun.hotspot.WhiteBox;
+
+public class UnloadUnregisteredLoader {
+ public static void main(String args[]) throws Exception {
+ String path = args[0];
+ URL url = new File(path).toURI().toURL();
+ URL[] urls = new URL[] {url};
+ WhiteBox wb = WhiteBox.getWhiteBox();
+ String className = "CustomLoadee";
+
+ for (int i=0; i<5; i++) {
+ doit(urls, className, (i == 0));
+
+ ClassUnloadCommon.triggerUnloading();
+ ClassUnloadCommon.failIf(wb.isClassAlive(className), "should have been unloaded");
+ }
+ }
+
+ public static void doit(URL urls[], String className, boolean isFirstTime) throws Exception {
+ ClassLoader appLoader = UnloadUnregisteredLoader.class.getClassLoader();
+ URLClassLoader custLoader = new URLClassLoader(urls, appLoader);
+
+ Class klass = custLoader.loadClass(className);
+ WhiteBox wb = WhiteBox.getWhiteBox();
+ if (wb.isSharedClass(UnloadUnregisteredLoader.class)) {
+ if (isFirstTime) {
+ // First time: we should be able to load the class from the CDS archive
+ if (!wb.isSharedClass(klass)) {
+ throw new RuntimeException("wb.isSharedClass(klass) should be true for first time");
+ }
+ } else {
+ // Second time: the class in the CDS archive is not available, because it has not been cleaned
+ // up (see bug 8140287), so we must load the class dynamically.
+ //
+ // FIXME: after 8140287 is fixed, class should be shard regardless of isFirstTime.
+ if (wb.isSharedClass(klass)) {
+ throw new RuntimeException("wb.isSharedClass(klass) should be false for second time");
+ }
+ }
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/javaldr/ArrayTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,78 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary test the ability to archive array classes and load them from the archive
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules jdk.jartool/sun.tools.jar
+ * @compile ArrayTestHelper.java
+ * @build sun.hotspot.WhiteBox
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @run main ArrayTest
+ */
+
+import java.util.List;
+import java.util.ArrayList;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class ArrayTest {
+
+ static String arrayClasses[] = {
+ "ArrayTestHelper",
+ "[Ljava/lang/Comparable;",
+ "[I"
+ };
+
+ public static void main(String[] args) throws Exception {
+ JarBuilder.build("arrayTestHelper", "ArrayTestHelper");
+
+ String appJar = TestCommon.getTestJar("arrayTestHelper.jar");
+ JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox");
+ String whiteBoxJar = TestCommon.getTestJar("WhiteBox.jar");
+ String bootClassPath = "-Xbootclasspath/a:" + whiteBoxJar;
+
+ // create an archive containing array classes
+ TestCommon.dump(appJar, TestCommon.list(arrayClasses), bootClassPath, "-verbose:class");
+
+ List<String> argsList = new ArrayList<String>();
+ argsList.add("-XX:+UnlockDiagnosticVMOptions");
+ argsList.add("-XX:+WhiteBoxAPI");
+ argsList.add("-cp");
+ argsList.add(appJar);
+ argsList.add(bootClassPath);
+ argsList.add("-verbose:class");
+ argsList.add("ArrayTestHelper");
+ // the following are input args to the ArrayTestHelper.
+ for (int i = 0; i < arrayClasses.length; i++) {
+ argsList.add(arrayClasses[i]);
+ }
+ String[] opts = new String[argsList.size()];
+ opts = argsList.toArray(opts);
+ OutputAnalyzer output = TestCommon.execCommon(opts);
+ TestCommon.checkExec(output);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/javaldr/ArrayTestHelper.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,46 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import sun.hotspot.WhiteBox;
+
+public class ArrayTestHelper {
+ public static void main(String[] args) throws Throwable {
+
+ // load the classes one by one and ensure each one is from
+ // the shared archive
+ for (int i = 0; i < args.length; i++) {
+
+ String cn = args[i].replace('/', '.');
+ Class cls = Class.forName(cn);
+
+ WhiteBox wb = WhiteBox.getWhiteBox();
+ if (wb.isSharedClass(cls)) {
+ System.out.println("As expected, " + args[i] + " is in shared space.");
+ } else {
+ throw new java.lang.RuntimeException(args[i] + " is not in shared space.");
+ }
+ }
+ }
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/javaldr/CheckAnonymousClass.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,75 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary ensure no anonymous class is being dumped into the CDS archive
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules jdk.jartool/sun.tools.jar
+ * @compile ../test-classes/Hello.java
+ * @run main CheckAnonymousClass
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class CheckAnonymousClass {
+
+ public static void main(String[] args) throws Exception {
+ JarBuilder.build("hello", "Hello");
+
+ String appJar = TestCommon.getTestJar("hello.jar");
+
+ TestCommon.dump(appJar, TestCommon.list("Hello", "org/omg/CORBA/ORB"),
+ "--add-modules", "java.corba", "-Xlog:class+load=info");
+
+ OutputAnalyzer output = TestCommon.execCommon("-XX:+UnlockDiagnosticVMOptions",
+ "-cp", appJar, "-Xlog:class+load=info", "--add-modules", "java.corba", "Hello");
+
+ String prefix = ".class.load. ";
+ // class name pattern like the following:
+ // jdk.internal.loader.BuiltinClassLoader$$Lambda$1/1816757085
+ // java.lang.invoke.LambdaForm$MH/1585787493
+ String class_pattern = ".*Lambda([a-z0-9$]+)/([0-9]+).*";
+ String suffix = ".*source: shared objects file.*";
+ String pattern = prefix + class_pattern + suffix;
+ // during run time, anonymous classes shouldn't be loaded from the archive
+ try {
+ output.shouldNotMatch(pattern);
+ } catch (Exception e) {
+ TestCommon.checkCommonExecExceptions(output, e);
+ }
+
+ // inspect the archive and make sure no anonymous class is in there
+ output = TestCommon.execCommon("-XX:+UnlockDiagnosticVMOptions",
+ "-cp", appJar, "-Xlog:class+load=info", "-XX:+PrintSharedArchiveAndExit",
+ "-XX:+PrintSharedDictionary", "--add-modules", "java.corba", "Hello");
+ try {
+ output.shouldNotMatch(class_pattern);
+ } catch (Exception e) {
+ TestCommon.checkCommonExecExceptions(output, e);
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/javaldr/GCDuringDump.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,80 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary When dumping the CDS archive, try to cause garbage collection while classes are being loaded.
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds /test/hotspot/jtreg/runtime/appcds/test-classes
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires vm.flavor != "minimal"
+ * @modules java.base/jdk.internal.misc
+ * jdk.jartool/sun.tools.jar
+ * java.management
+ * @build GCDuringDumpTransformer Hello
+ * @run main/othervm GCDuringDump
+ */
+
+import jdk.test.lib.cds.CDSOptions;
+import jdk.test.lib.process.OutputAnalyzer;
+import jdk.test.lib.process.ProcessTools;
+
+public class GCDuringDump {
+ public static String appClasses[] = {
+ "Hello",
+ };
+ public static String agentClasses[] = {
+ "GCDuringDumpTransformer",
+ };
+
+ public static void main(String[] args) throws Throwable {
+ String agentJar =
+ ClassFileInstaller.writeJar("GCDuringDumpTransformer.jar",
+ ClassFileInstaller.Manifest.fromSourceFile("GCDuringDumpTransformer.mf"),
+ agentClasses);
+
+ String appJar =
+ ClassFileInstaller.writeJar("GCDuringDumpApp.jar", appClasses);
+
+ String gcLog = "-Xlog:gc*=info,gc+region=trace,gc+alloc+region=debug";
+
+ for (int i=0; i<2; i++) {
+ // i = 0 -- run without agent = no extra GCs
+ // i = 1 -- run with agent = cause extra GCs
+
+ String extraArg = (i == 0) ? "-showversion" : "-javaagent:" + agentJar;
+
+ TestCommon.testDump(appJar, TestCommon.list("Hello"),
+ extraArg, "-Xmx32m", gcLog);
+
+ OutputAnalyzer output = TestCommon.execCommon(
+ "-cp", appJar,
+ "-Xmx32m",
+ "-XX:+PrintSharedSpaces",
+ gcLog,
+ "Hello");
+ TestCommon.checkExec(output);
+ }
+ }
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/javaldr/GCDuringDumpTransformer.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,72 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.lang.instrument.ClassFileTransformer;
+import java.lang.instrument.Instrumentation;
+import java.lang.instrument.IllegalClassFormatException;
+import java.security.ProtectionDomain;
+
+public class GCDuringDumpTransformer implements ClassFileTransformer {
+ static int n = 0;
+ public byte[] transform(ClassLoader loader, String name, Class<?> classBeingRedefined,
+ ProtectionDomain pd, byte[] buffer) throws IllegalClassFormatException {
+ n++;
+
+ System.out.println("dump time loading: " + name + " in loader: " + loader);
+ System.out.println("making garbage: " + n);
+ try {
+ makeGarbage();
+ } catch (Throwable t) {
+ t.printStackTrace();
+ try {
+ Thread.sleep(200); // let GC to have a chance to run
+ } catch (Throwable t2) {}
+ }
+ System.out.println("making garbage: done");
+
+ return null;
+ }
+
+ private static Instrumentation savedInstrumentation;
+
+ public static void premain(String agentArguments, Instrumentation instrumentation) {
+ System.out.println("ClassFileTransformer.premain() is called");
+ instrumentation.addTransformer(new GCDuringDumpTransformer(), /*canRetransform=*/true);
+ savedInstrumentation = instrumentation;
+ }
+
+ public static Instrumentation getInstrumentation() {
+ return savedInstrumentation;
+ }
+
+ public static void agentmain(String args, Instrumentation inst) throws Exception {
+ premain(args, inst);
+ }
+
+ public static void makeGarbage() {
+ for (int x=0; x<10; x++) {
+ Object[] a = new Object[10000];
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/javaldr/GCDuringDumpTransformer.mf Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,5 @@
+Manifest-Version: 1.0
+Premain-Class: GCDuringDumpTransformer
+Agent-Class: GCDuringDumpTransformer
+Can-Retransform-Classes: true
+Can-Redefine-Classes: true
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/javaldr/GCSharedStringsDuringDump.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,131 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Similar to GCDuringDumping.java, this test adds the -XX:SharedArchiveConfigFile
+ * option for testing the interaction with GC and shared strings.
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds /test/hotspot/jtreg/runtime/appcds/test-classes
+ * @requires (sun.arch.data.model != "32") & (os.family != "windows")
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires vm.flavor != "minimal"
+ * @requires vm.gc.G1
+ * @modules java.base/jdk.internal.misc
+ * jdk.jartool/sun.tools.jar
+ * java.management
+ * @build sun.hotspot.WhiteBox GCDuringDumpTransformer GCSharedStringsDuringDumpWb
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @run main/othervm/timeout=480 GCSharedStringsDuringDump
+ */
+
+import java.io.File;
+import java.io.FileOutputStream;
+import java.io.OutputStreamWriter;
+import java.io.PrintWriter;
+import jdk.test.lib.cds.CDSOptions;
+import jdk.test.lib.process.OutputAnalyzer;
+import jdk.test.lib.process.ProcessTools;
+import sun.hotspot.WhiteBox;
+
+public class GCSharedStringsDuringDump {
+ public static String appClasses[] = {
+ "GCSharedStringsDuringDumpWb",
+ };
+ public static String agentClasses[] = {
+ "GCDuringDumpTransformer",
+ };
+
+ public static void main(String[] args) throws Throwable {
+ String agentJar =
+ ClassFileInstaller.writeJar("GCDuringDumpTransformer.jar",
+ ClassFileInstaller.Manifest.fromSourceFile("GCDuringDumpTransformer.mf"),
+ agentClasses);
+
+ String appJar =
+ ClassFileInstaller.writeJar("GCSharedStringsDuringDumpApp.jar", appClasses);
+
+ String gcLog = "-Xlog:gc*=info,gc+region=trace,gc+alloc+region=debug";
+
+ String sharedArchiveCfgFile =
+ System.getProperty("user.dir") + File.separator + "GCSharedStringDuringDump_gen.txt";
+ try (FileOutputStream fos = new FileOutputStream(sharedArchiveCfgFile)) {
+ PrintWriter out = new PrintWriter(new OutputStreamWriter(fos));
+ out.println("VERSION: 1.0");
+ out.println("@SECTION: String");
+ out.println("31: shared_test_string_unique_14325");
+ for (int i=0; i<100000; i++) {
+ String s = "generated_string " + i;
+ out.println(s.length() + ": " + s);
+ }
+ out.close();
+ }
+
+ JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox");
+ String whiteBoxJar = TestCommon.getTestJar("WhiteBox.jar");
+ String bootClassPath = "-Xbootclasspath/a:" + whiteBoxJar;
+
+ for (int i=0; i<2; i++) {
+ // i = 0 -- run without agent = no extra GCs
+ // i = 1 -- run with agent = cause extra GCs
+
+ String extraArg = (i == 0) ? "-showversion" : "-javaagent:" + agentJar;
+
+ OutputAnalyzer output = TestCommon.dump(
+ appJar, TestCommon.list("GCSharedStringsDuringDumpWb"),
+ bootClassPath, extraArg, "-Xmx32m", gcLog,
+ "-XX:+UseCompressedOops", "-XX:+UseG1GC",
+ "-XX:SharedReadOnlySize=30m",
+ "-XX:SharedArchiveConfigFile=" + sharedArchiveCfgFile);
+
+ if (output.getStdout().contains("Too many string space regions") ||
+ output.getStderr().contains("Unable to write archive heap memory regions") ||
+ output.getStdout().contains("Try increasing NewSize") ||
+ output.getExitValue() != 0) {
+ // Try again with larger heap and NewSize, this should increase the
+ // G1 heap region size to 2M
+ TestCommon.testDump(
+ appJar, TestCommon.list("GCSharedStringsDuringDumpWb"),
+ bootClassPath, extraArg, "-Xmx8g", "-XX:NewSize=8m", gcLog,
+ "-XX:+UseCompressedOops", "-XX:+UseG1GC",
+ "-XX:SharedReadOnlySize=30m",
+ "-XX:SharedArchiveConfigFile=" + sharedArchiveCfgFile);
+ }
+
+ output = TestCommon.execCommon(
+ "-cp", appJar,
+ bootClassPath,
+ "-Xmx32m",
+ "-XX:+PrintSharedSpaces",
+ "-XX:+UseCompressedOops",
+ "-XX:+UseG1GC",
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+WhiteBoxAPI",
+ "-XX:SharedReadOnlySize=30m",
+ gcLog,
+ "GCSharedStringsDuringDumpWb");
+ TestCommon.checkExec(output);
+ }
+ }
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/javaldr/GCSharedStringsDuringDumpWb.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,45 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import sun.hotspot.WhiteBox;
+
+public class GCSharedStringsDuringDumpWb {
+ public static void main(String[] args) throws Exception {
+ WhiteBox wb = WhiteBox.getWhiteBox();
+ String s = "shared_test_string_unique_14325";
+ s = s.intern();
+ CheckString(wb, s);
+ for (int i=0; i<100000; i++) {
+ s = "generated_string " + i;
+ s = s.intern();
+ CheckString(wb, s);
+ }
+ }
+
+ public static void CheckString(WhiteBox wb, String s) {
+ if (!wb.areSharedStringsIgnored() && !wb.isShared(s)) {
+ throw new RuntimeException("String is not shared.");
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/CheckUnsupportedDumpingOptions.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,102 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Abort dumping if any of the new jigsaw vm options is specified.
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib ..
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * jdk.internal.jvmstat/sun.jvmstat.monitor
+ * @compile ../test-classes/Hello.java
+ * @run main CheckUnsupportedDumpingOptions
+ */
+
+import jdk.test.lib.compiler.InMemoryJavaCompiler;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class CheckUnsupportedDumpingOptions {
+ private static final String[] jigsawOptions = {
+ "-m",
+ "--limit-modules",
+ "--module-path",
+ "--upgrade-module-path",
+ "--patch-module"
+ };
+ private static final String[] optionValues = {
+ "mymod",
+ "mymod",
+ "mydir",
+ ".",
+ "java.naming=javax.naming.spi.NamingManger"
+ };
+ private static final int infoIdx = 1;
+
+ public static void main(String[] args) throws Exception {
+ String source = "package javax.naming.spi; " +
+ "public class NamingManager { " +
+ " static { " +
+ " System.out.println(\"I pass!\"); " +
+ " } " +
+ "}";
+ ClassFileInstaller.writeClassToDisk("javax/naming/spi/NamingManager",
+ InMemoryJavaCompiler.compile("javax.naming.spi.NamingManager", source, "--patch-module=java.naming"),
+ "mods/java.naming");
+
+ JarBuilder.build("hello", "Hello");
+ String appJar = TestCommon.getTestJar("hello.jar");
+ String appClasses[] = {"Hello"};
+ for (int i = 0; i < jigsawOptions.length; i++) {
+ OutputAnalyzer output;
+ if (i == 5) {
+ // --patch-module
+ output = TestCommon.dump(appJar, appClasses, "-Xlog:cds,cds+hashtables",
+ jigsawOptions[i] + optionValues[i] + appJar);
+ } else {
+ output = TestCommon.dump(appJar, appClasses, "-Xlog:cds,cds+hashtables",
+ jigsawOptions[i], optionValues[i]);
+ }
+ if (i < infoIdx) {
+ output.shouldContain("Cannot use the following option " +
+ "when dumping the shared archive: " + jigsawOptions[i])
+ .shouldHaveExitValue(1);
+ } else {
+ output.shouldContain("Info: the " + jigsawOptions[i] +
+ " option is ignored when dumping the shared archive");
+ if (optionValues[i].equals("mymod")) {
+ // java will throw FindException for a module
+ // which cannot be found during init_phase2() of vm init
+ output.shouldHaveExitValue(1)
+ .shouldContain("java.lang.module.FindException: Module mymod not found");
+ } else {
+ output.shouldHaveExitValue(0);
+ }
+ }
+ }
+ }
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/JigsawOptionsCombo.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,216 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Test combinations of jigsaw options that affect the use of AppCDS
+ *
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib ..
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * jdk.internal.jvmstat/sun.jvmstat.monitor
+ * @compile ../test-classes/Hello.java ../test-classes/HelloMore.java
+ * @run main JigsawOptionsCombo
+ */
+import jdk.test.lib.compiler.InMemoryJavaCompiler;
+import jdk.test.lib.process.OutputAnalyzer;
+import java.util.ArrayList;
+
+
+// Remaining WORK: TODO:
+// 1. test with -m initial-module; waiting for changes from Chris will provide
+// utils to build modules
+// 2. Loading classes from Jmod files - waiting on utils
+// 3. Loading classes from exploded module dir"
+
+public class JigsawOptionsCombo {
+
+ public static void main(String[] args) throws Exception {
+ String source = "package javax.naming.spi; " +
+ "public class NamingManager { " +
+ " static { " +
+ " System.out.println(\"I pass!\"); " +
+ " } " +
+ "}";
+ ClassFileInstaller.writeClassToDisk("javax/naming/spi/NamingManager",
+ InMemoryJavaCompiler.compile("javax.naming.spi.NamingManager", source, "--patch-module=java.naming"),
+ "mods/java.naming");
+
+ JarBuilder.build("hello", "Hello");
+ JarBuilder.build("hello_more", "HelloMore");
+
+ (new JigsawOptionsCombo()).runTests();
+ }
+
+
+ private ArrayList<TestCase> testCaseTable = new ArrayList<TestCase>();
+
+ public static String infoDuringDump(String option) {
+ return "Info: the " + option +
+ " option is ignored when dumping the shared archive";
+ }
+
+ public void runTests() throws Exception {
+
+ testCaseTable.add(new TestCase(
+ "basic: Basic dump and execute, to verify the test plumbing works",
+ "", "", 0,
+ "", "", 0) );
+
+ String bcpArg = "-Xbootclasspath/a:" +
+ TestCommon.getTestJar("hello_more.jar");
+
+ testCaseTable.add(new TestCase(
+ "Xbootclasspath/a: is OK for both dump and run time",
+ bcpArg, "", 0,
+ bcpArg, "", 0) );
+
+ testCaseTable.add(new TestCase(
+ "module-path-01: --module-path is ignored for dump time",
+ "--module-path mods",
+ infoDuringDump("--module-path"), 0,
+ null, null, 0) );
+
+ testCaseTable.add(new TestCase(
+ "module-path-02: --module-path is ok for run time",
+ "", "", 0,
+ "--module-path mods", "", 0) );
+
+ testCaseTable.add(new TestCase(
+ "add-modules-01: --add-modules is ok at dump time",
+ "--add-modules java.management",
+ "", 0,
+ null, null, 0) );
+
+ testCaseTable.add(new TestCase(
+ "add-modules-02: --add-modules is ok at run time",
+ "", "", 0,
+ "--add-modules java.management", "", 0) );
+
+ testCaseTable.add(new TestCase(
+ "limit-modules-01: --limit-modules is ignored at dump time",
+ "--limit-modules java.base",
+ infoDuringDump("--limit-modules"), 0,
+ null, null, 0) );
+
+ testCaseTable.add(new TestCase(
+ "limit-modules-02: --limit-modules is ok at run time",
+ "", "", 0,
+ "--limit-modules java.base", "", 0) );
+
+ testCaseTable.add(new TestCase(
+ "upgrade-module-path-01: --upgrade-module-path is ignored at dump time",
+ "--upgrade-module-path mods",
+ infoDuringDump("--upgrade-module-path"), 0,
+ null, null, 0) );
+
+ testCaseTable.add(new TestCase(
+ "-upgrade-module-path-module-path-02: --upgrade-module-path is ok at run time",
+ "", "", 0,
+ "--upgrade-module-path mods", "", 0) );
+
+ for (TestCase tc : testCaseTable) tc.execute();
+ }
+
+
+ // class representing a singe test case
+ public class TestCase {
+ String description;
+ String dumpTimeArgs;
+ String dumpTimeExpectedOutput;
+ int dumpTimeExpectedExitValue;
+ String runTimeArgs;
+ String runTimeExpectedOutput;
+ int runTimeExpectedExitValue;
+
+ private String appJar = TestCommon.getTestJar("hello.jar");
+ private String appClasses[] = {"Hello"};
+
+
+ public TestCase(String description,
+ String dumpTimeArgs, String dumpTimeExpectedOutput, int dumpTimeExpectedExitValue,
+ String runTimeArgs, String runTimeExpectedOutput, int runTimeExpectedExitValue) {
+
+ this.description = description;
+ this.dumpTimeArgs = dumpTimeArgs;
+ this.dumpTimeExpectedOutput = dumpTimeExpectedOutput;
+ this.dumpTimeExpectedExitValue = dumpTimeExpectedExitValue;
+ this.runTimeArgs = runTimeArgs;
+ this.runTimeExpectedOutput = runTimeExpectedOutput;
+ this.runTimeExpectedExitValue = runTimeExpectedExitValue;
+ }
+
+
+ public void execute() throws Exception {
+ System.out.println("Description: " + description);
+
+ // ===== dump step - create the archive
+ OutputAnalyzer dumpOutput = TestCommon.dump(
+ appJar, appClasses, getDumpOptions());
+
+ if (dumpTimeExpectedExitValue == 0) {
+ TestCommon.checkDump(dumpOutput, dumpTimeExpectedOutput);
+ } else {
+ dumpOutput.shouldMatch(dumpTimeExpectedOutput);
+ dumpOutput.shouldHaveExitValue(dumpTimeExpectedExitValue);
+ }
+
+ // ===== exec step - use the archive
+ if (runTimeArgs != null) {
+ OutputAnalyzer execOutput = TestCommon.exec(appJar, getRunOptions());
+
+ if (runTimeExpectedExitValue == 0) {
+ TestCommon.checkExec(execOutput, runTimeExpectedOutput, "Hello World");
+ } else {
+ execOutput.shouldMatch(dumpTimeExpectedOutput);
+ execOutput.shouldHaveExitValue(dumpTimeExpectedExitValue);
+ }
+ }
+ }
+
+
+ // dump command line options can be separated by a space
+ private String[] getDumpOptions() {
+ return dumpTimeArgs.split(" ");
+ }
+
+
+ // run command line options can be separated by a space
+ private String[] getRunOptions() {
+ ArrayList<String> result = new ArrayList<>();
+
+ if (runTimeArgs != "") {
+ String splitArgs[] = runTimeArgs.split(" ");
+ for (String arg : splitArgs)
+ result.add(arg);
+ }
+
+ result.add("Hello");
+ return result.toArray(new String[1]);
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/AppClassInCP.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,104 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @summary a test to demonstrate that an application class in the -cp
+ * will be archived although --patch-module is specified. The class in
+ * the -cp has no dependencies on the class in the --patch-module.
+ * @library ../..
+ * @library /test/hotspot/jtreg/testlibrary
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * jdk.jartool/sun.tools.jar
+ * @build PatchMain
+ * @run main AppClassInCP
+ */
+
+import java.io.File;
+import jdk.test.lib.compiler.InMemoryJavaCompiler;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class AppClassInCP {
+ private static String moduleJar;
+ private static String appJar;
+
+ public static void main(String args[]) throws Throwable {
+
+ // Create a class file in the module java.naming. This class file
+ // will be put in the javanaming.jar file.
+ String source = "package javax.naming.spi; " +
+ "public class NamingManager { " +
+ " static { " +
+ " System.out.println(\"I pass!\"); " +
+ " } " +
+ "}";
+
+ String classDir = System.getProperty("test.classes");
+
+ ClassFileInstaller.writeClassToDisk("javax/naming/spi/NamingManager",
+ InMemoryJavaCompiler.compile("javax.naming.spi.NamingManager", source, "--patch-module=java.naming"),
+ classDir);
+
+ // Build the jar file that will be used for the module "java.naming".
+ JarBuilder.build("javanaming", "javax/naming/spi/NamingManager");
+ moduleJar = TestCommon.getTestJar("javanaming.jar");
+
+ String source2 = "package mypackage; " +
+ "public class Hello { " +
+ " static { " +
+ " System.out.println(\"Hello!\"); " +
+ " } " +
+ "}";
+ ClassFileInstaller.writeClassToDisk("mypackage/Hello",
+ InMemoryJavaCompiler.compile("mypackage.Hello", source2),
+ classDir);
+
+ JarBuilder.build("hello", "mypackage/Hello");
+ appJar = TestCommon.getTestJar("hello.jar");
+
+ System.out.println("Test dumping with --patch-module");
+ OutputAnalyzer output =
+ TestCommon.dump(appJar,
+ TestCommon.list("javax/naming/spi/NamingManager", "mypackage/Hello"),
+ "--patch-module=java.naming=" + moduleJar,
+ "-Xlog:class+load",
+ "PatchMain", "javax.naming.spi.NamingManager", "mypackage.Hello");
+ TestCommon.checkDump(output, "Loading classes to share");
+
+ String classPath = appJar + File.pathSeparator + classDir;
+ System.out.println("classPath: " + classPath);
+ output = TestCommon.execCommon(
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-cp", classPath,
+ "--patch-module=java.naming=" + moduleJar,
+ "-Xlog:class+load",
+ "PatchMain", "javax.naming.spi.NamingManager", "mypackage.Hello");
+ TestCommon.checkExec(output,
+ "I pass!",
+ "Hello!",
+ "Hello source: shared objects file");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/CustomPackage.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,83 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @summary if a class is defined to a package which is not defined to any
+ * module in the jimage, the class will not be found during dump
+ * time but it will be used during run time.
+ * @library ../..
+ * @library /test/hotspot/jtreg/testlibrary
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * jdk.jartool/sun.tools.jar
+ * @build PatchMain
+ * @run main CustomPackage
+ */
+
+import jdk.test.lib.compiler.InMemoryJavaCompiler;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class CustomPackage {
+ private static String moduleJar;
+
+ public static void main(String args[]) throws Throwable {
+
+ // Create a class file in the module java.naming. This class file
+ // will be put in the javanaming.jar file.
+ String source = "package javax.naming.myspi; " +
+ "public class NamingManager { " +
+ " static { " +
+ " System.out.println(\"I pass!\"); " +
+ " } " +
+ "}";
+
+ ClassFileInstaller.writeClassToDisk("javax/naming/myspi/NamingManager",
+ InMemoryJavaCompiler.compile("javax.naming.myspi.NamingManager", source, "--patch-module=java.naming"),
+ System.getProperty("test.classes"));
+
+ // Build the jar file that will be used for the module "java.naming".
+ JarBuilder.build("javanaming", "javax/naming/myspi/NamingManager");
+ moduleJar = TestCommon.getTestJar("javanaming.jar");
+
+ System.out.println("Test dumping with --patch-module");
+ OutputAnalyzer output =
+ TestCommon.dump(null,
+ TestCommon.list("javax/naming/myspi/NamingManager"),
+ "--patch-module=java.naming=" + moduleJar,
+ "-Xlog:class+load",
+ "-Xlog:class+path=info",
+ "PatchMain", "javax.naming.myspi.NamingManager");
+ TestCommon.checkDump(output, "Preload Warning: Cannot find javax/naming/myspi/NamingManager");
+
+ output = TestCommon.execCommon(
+ "-XX:+UnlockDiagnosticVMOptions",
+ "--patch-module=java.naming=" + moduleJar,
+ "-Xlog:class+load",
+ "-Xlog:class+path=info",
+ "PatchMain", "javax.naming.myspi.NamingManager");
+ TestCommon.checkExec(output, "I pass!");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/MismatchedPatchModule.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,132 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @summary different settings of --patch-module at dump time and runtime are
+ * acceptable. The class found in runtime --patch-module entry should
+ * be used.
+ * @library ../..
+ * @library /test/hotspot/jtreg/testlibrary
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * jdk.jartool/sun.tools.jar
+ * @build PatchMain
+ * @run main MismatchedPatchModule
+ */
+
+import jdk.test.lib.compiler.InMemoryJavaCompiler;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class MismatchedPatchModule {
+ private static String moduleJar;
+
+ public static void main(String args[]) throws Throwable {
+
+ // Create a class file in the module java.naming. This class file
+ // will be put in the javanaming.jar file.
+ String source = "package javax.naming.spi; " +
+ "public class NamingManager { " +
+ " static { " +
+ " System.out.println(\"I pass!\"); " +
+ " } " +
+ "}";
+
+ ClassFileInstaller.writeClassToDisk("javax/naming/spi/NamingManager",
+ InMemoryJavaCompiler.compile("javax.naming.spi.NamingManager", source, "--patch-module=java.naming"),
+ System.getProperty("test.classes"));
+
+ // Build the jar file that will be used for the module "java.naming".
+ JarBuilder.build("javanaming", "javax/naming/spi/NamingManager");
+ moduleJar = TestCommon.getTestJar("javanaming.jar");
+
+ // Case 1: --patch-module specified for dump time and run time
+ System.out.println("Case 1: --patch-module specified for dump time and run time");
+ OutputAnalyzer output =
+ TestCommon.dump(null,
+ TestCommon.list("javax/naming/spi/NamingManager"),
+ "--patch-module=java.naming=" + moduleJar,
+ "PatchMain", "javax.naming.spi.NamingManager");
+ TestCommon.checkDump(output, "Loading classes to share");
+
+ // javax.naming.spi.NamingManager is not patched at runtime
+ output = TestCommon.execCommon(
+ "-XX:+UnlockDiagnosticVMOptions",
+ "--patch-module=java.naming2=" + moduleJar,
+ "-Xlog:class+path=info",
+ "PatchMain", "javax.naming.spi.NamingManager");
+ output.shouldNotContain("I pass!");
+
+ // Case 2: --patch-module specified for dump time but not for run time
+ System.out.println("Case 2: --patch-module specified for dump time but not for run time");
+ output =
+ TestCommon.dump(null,
+ TestCommon.list("javax/naming/spi/NamingManager"),
+ "--patch-module=java.naming=" + moduleJar,
+ "PatchMain", "javax.naming.spi.NamingManager");
+ TestCommon.checkDump(output, "Loading classes to share");
+
+ // javax.naming.spi.NamingManager is not patched at runtime
+ output = TestCommon.execCommon(
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-Xlog:class+path=info",
+ "PatchMain", "javax.naming.spi.NamingManager");
+ output.shouldNotContain("I pass!");
+
+ // Case 3: --patch-module specified for run time but not for dump time
+ System.out.println("Case 3: --patch-module specified for run time but not for dump time");
+ output =
+ TestCommon.dump(null,
+ TestCommon.list("javax/naming/spi/NamingManager"),
+ "PatchMain", "javax.naming.spi.NamingManager");
+ TestCommon.checkDump(output, "Loading classes to share");
+
+ // javax.naming.spi.NamingManager is patched at runtime
+ output = TestCommon.execCommon(
+ "-XX:+UnlockDiagnosticVMOptions",
+ "--patch-module=java.naming=" + moduleJar,
+ "-Xlog:class+path=info",
+ "PatchMain", "javax.naming.spi.NamingManager");
+ TestCommon.checkExec(output, "I pass!");
+
+ // Case 4: mismatched --patch-module entry counts between dump time and run time
+ System.out.println("Case 4: mismatched --patch-module entry counts between dump time and run time");
+ output =
+ TestCommon.dump(null,
+ TestCommon.list("javax/naming/spi/NamingManager"),
+ "--patch-module=java.naming=" + moduleJar,
+ "PatchMain", "javax.naming.spi.NamingManager");
+ TestCommon.checkDump(output, "Loading classes to share");
+
+ // javax.naming.spi.NamingManager is patched at runtime
+ output = TestCommon.execCommon(
+ "-XX:+UnlockDiagnosticVMOptions",
+ "--patch-module=java.naming=" + moduleJar,
+ "--patch-module=java.naming2=" + moduleJar,
+ "-Xlog:class+path=info",
+ "PatchMain", "javax.naming.spi.NamingManager");
+ TestCommon.checkExec(output, "I pass!");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/PatchDir.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,73 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @summary a simple test to ensure that a directory in the --patch-module
+ * option does not affect dump process
+ * @library ../..
+ * @library /test/hotspot/jtreg/testlibrary
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * jdk.jartool/sun.tools.jar
+ * @build PatchMain
+ * @run main PatchDir
+ */
+
+import java.io.File;
+import jdk.test.lib.compiler.InMemoryJavaCompiler;
+
+public class PatchDir {
+ private static String moduleJar;
+
+ public static void main(String args[]) throws Throwable {
+
+ // Create a class file in the module java.naming. This class file
+ // will be put in the javanaming.jar file.
+ String source = "package javax.naming.spi; " +
+ "public class NamingManager { " +
+ " static { " +
+ " System.out.println(\"I pass!\"); " +
+ " } " +
+ "}";
+
+ String classDir = System.getProperty("test.classes");
+ ClassFileInstaller.writeClassToDisk("javax/naming/spi/NamingManager",
+ InMemoryJavaCompiler.compile("javax.naming.spi.NamingManager", source, "--patch-module=java.naming"),
+ classDir);
+
+ JarBuilder.build("javanaming", "javax/naming/spi/NamingManager");
+ moduleJar = TestCommon.getTestJar("javanaming.jar");
+
+ System.out.println("Test dumping with --patch-module");
+ TestCommon.dump(null,
+ TestCommon.list("javax/naming/spi/NamingManager"),
+ "--patch-module=java.naming=" + moduleJar,
+ "-Xlog:class+load",
+ "PatchMain", "javax.naming.spi.NamingManager")
+ .shouldContain("Loading classes to share")
+ .shouldHaveExitValue(0);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/PatchJavaBase.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,73 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @summary sharing is disabled if java.base is patch at runtime
+ * @library ../..
+ * @library /test/hotspot/jtreg/testlibrary
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * jdk.jartool/sun.tools.jar
+ * @build PatchMain
+ * @run main PatchJavaBase
+ */
+
+import jdk.test.lib.compiler.InMemoryJavaCompiler;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class PatchJavaBase {
+ private static String moduleJar;
+
+ public static void main(String args[]) throws Throwable {
+
+ String source = "package java.lang; " +
+ "public class NewClass { " +
+ " static { " +
+ " System.out.println(\"I pass!\"); " +
+ " } " +
+ "}";
+
+ ClassFileInstaller.writeClassToDisk("java/lang/NewClass",
+ InMemoryJavaCompiler.compile("java.lang.NewClass", source, "--patch-module=java.base"),
+ System.getProperty("test.classes"));
+
+ JarBuilder.build("javabase", "java/lang/NewClass");
+ moduleJar = TestCommon.getTestJar("javabase.jar");
+
+ System.out.println("Test dumping with --patch-module");
+ OutputAnalyzer output =
+ TestCommon.dump(null, null,
+ "--patch-module=java.base=" + moduleJar,
+ "PatchMain", "java.lang.NewClass");
+ TestCommon.checkDump(output, "Loading classes to share");
+
+ output = TestCommon.execCommon(
+ "-XX:+UnlockDiagnosticVMOptions",
+ "--patch-module=java.base=" + moduleJar,
+ "PatchMain", "java.lang.NewClass");
+ output.shouldContain("CDS is disabled when java.base module is patched");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/PatchMain.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,33 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+// This loads the class affected by the --patch-module option. For the test to pass
+// it must load the class from the --patch-module directory, not the jimage file.
+public class PatchMain {
+ public static void main(String[] args) throws Exception {
+ for (int i = 0; i < args.length; i++) {
+ Class.forName(args[i]);
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/Simple.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,81 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @summary a simple test to ensure that class is loaded from jar file in --patch-module at runtime
+ * @library ../..
+ * @library /test/hotspot/jtreg/testlibrary
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * jdk.jartool/sun.tools.jar
+ * @build PatchMain
+ * @run main Simple
+ */
+
+import jdk.test.lib.compiler.InMemoryJavaCompiler;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class Simple {
+ private static String moduleJar;
+
+ public static void main(String args[]) throws Throwable {
+
+ // Create a class file in the module java.naming. This class file
+ // will be put in the javanaming.jar file.
+ String source = "package javax.naming.spi; " +
+ "public class NamingManager { " +
+ " static { " +
+ " System.out.println(\"I pass!\"); " +
+ " } " +
+ "}";
+
+ ClassFileInstaller.writeClassToDisk("javax/naming/spi/NamingManager",
+ InMemoryJavaCompiler.compile("javax.naming.spi.NamingManager", source, "--patch-module=java.naming"),
+ System.getProperty("test.classes"));
+
+ // Build the jar file that will be used for the module "java.naming".
+ JarBuilder.build("javanaming", "javax/naming/spi/NamingManager");
+ moduleJar = TestCommon.getTestJar("javanaming.jar");
+
+ System.out.println("Test dumping with --patch-module");
+ OutputAnalyzer output =
+ TestCommon.dump(null,
+ TestCommon.list("javax/naming/spi/NamingManager"),
+ "--patch-module=java.naming=" + moduleJar,
+ "-Xlog:class+load",
+ "-Xlog:class+path=info",
+ "PatchMain", "javax.naming.spi.NamingManager");
+ TestCommon.checkDump(output, "Loading classes to share");
+
+ output = TestCommon.execCommon(
+ "-XX:+UnlockDiagnosticVMOptions",
+ "--patch-module=java.naming=" + moduleJar,
+ "-Xlog:class+load",
+ "-Xlog:class+path=info",
+ "PatchMain", "javax.naming.spi.NamingManager");
+ TestCommon.checkExec(output, "I pass!");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/SubClassOfPatchedClass.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,105 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @summary the class in the -cp is a subclass of the class in --patch-module. The
+ * patched class should be used at runtime.
+ * @library ../..
+ * @library /test/hotspot/jtreg/testlibrary
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * jdk.jartool/sun.tools.jar
+ * @build PatchMain
+ * @run main SubClassOfPatchedClass
+ */
+
+import java.io.File;
+import jdk.test.lib.compiler.InMemoryJavaCompiler;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class SubClassOfPatchedClass {
+ private static String moduleJar;
+ private static String appJar;
+
+ public static void main(String args[]) throws Throwable {
+
+ // Create a class file in the module java.naming. This class file
+ // will be put in the javanaming.jar file.
+ String source = "package javax.naming; " +
+ "public class Reference { " +
+ " static { " +
+ " System.out.println(\"I pass!\"); " +
+ " } " +
+ "}";
+
+ String classDir = System.getProperty("test.classes");
+
+ ClassFileInstaller.writeClassToDisk("javax/naming/Reference",
+ InMemoryJavaCompiler.compile("javax.naming.Reference", source, "--patch-module=java.naming"),
+ classDir);
+
+ // Build the jar file that will be used for the module "java.naming".
+ JarBuilder.build("javanaming", "javax/naming/Reference");
+ moduleJar = TestCommon.getTestJar("javanaming.jar");
+
+ String source2 = "package mypackage; " +
+ "public class MyReference extends javax.naming.Reference { " +
+ " static { " +
+ " System.out.println(\"MyReference!\"); " +
+ " } " +
+ " public MyReference(String mystring) { " +
+ " super(mystring); " +
+ " } " +
+ "}";
+ ClassFileInstaller.writeClassToDisk("mypackage/MyReference",
+ InMemoryJavaCompiler.compile("mypackage.MyReference", source2),
+ classDir);
+
+ JarBuilder.build("myjavanaming", "mypackage/MyReference");
+ appJar = TestCommon.getTestJar("myjavanaming.jar");
+
+ System.out.println("Test dumping with --patch-module");
+ OutputAnalyzer output =
+ TestCommon.dump(appJar,
+ TestCommon.list("javax/naming/Reference", "mypackage/MyReference"),
+ "--patch-module=java.naming=" + moduleJar,
+ "-Xlog:class+load",
+ "PatchMain", "javax.naming.Reference", "mypackage.MyReference");
+ TestCommon.checkDump(output, "Loading classes to share");
+
+ String classPath = appJar + File.pathSeparator + classDir;
+ System.out.println("classPath: " + classPath);
+ output = TestCommon.execCommon(
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-cp", classPath,
+ "--patch-module=java.naming=" + moduleJar,
+ "-Xlog:class+load",
+ "PatchMain", "javax.naming.Reference", "mypackage.MyReference");
+ TestCommon.checkExec(output,
+ "I pass!",
+ "MyReference source: file:");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/PatchModule/TwoJars.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,100 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @summary a patched class found in --patch-module should be used at runtime
+ * @library ../..
+ * @library /test/hotspot/jtreg/testlibrary
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * jdk.jartool/sun.tools.jar
+ * @build PatchMain
+ * @run main TwoJars
+ */
+
+import java.io.File;
+import jdk.test.lib.compiler.InMemoryJavaCompiler;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class TwoJars {
+ private static String moduleJar;
+ private static String moduleJar2;
+
+ public static void main(String args[]) throws Throwable {
+
+ // Create a class file in the module java.naming. This class file
+ // will be put in the javanaming.jar file.
+ String source = "package javax.naming.spi; " +
+ "public class NamingManager { " +
+ " static { " +
+ " System.out.println(\"I pass!\"); " +
+ " } " +
+ "}";
+
+ // Create a class file in the module java.naming. This class file
+ // will be put in the javanaming2.jar file.
+ String source2 = "package javax.naming.spi; " +
+ "public class DirectoryManager { " +
+ " static { " +
+ " System.out.println(\"I fail!\"); " +
+ " } " +
+ "}";
+
+ ClassFileInstaller.writeClassToDisk("javax/naming/spi/NamingManager",
+ InMemoryJavaCompiler.compile("javax.naming.spi.NamingManager", source, "--patch-module=java.naming"),
+ System.getProperty("test.classes"));
+
+ // Build the jar file that will be used for the module "java.naming".
+ JarBuilder.build("javanaming", "javax/naming/spi/NamingManager");
+ moduleJar = TestCommon.getTestJar("javanaming.jar");
+
+ ClassFileInstaller.writeClassToDisk("javax/naming/spi/DirectoryManager",
+ InMemoryJavaCompiler.compile("javax.naming.spi.DirectoryManager", source2, "--patch-module=java.naming"),
+ System.getProperty("test.classes"));
+
+ // Build the jar file that will be used for the module "java.naming".
+ JarBuilder.build("javanaming2", "javax/naming/spi/DirectoryManager");
+ moduleJar2 = TestCommon.getTestJar("javanaming2.jar");
+
+ System.out.println("Test dumping with --patch-module");
+ OutputAnalyzer output =
+ TestCommon.dump(null,
+ TestCommon.list("javax/naming/spi/NamingManager"),
+ "--patch-module=java.naming=" + moduleJar2 + File.pathSeparator + moduleJar,
+ "-Xlog:class+load",
+ "-Xlog:class+path=info",
+ "PatchMain", "javax.naming.spi.NamingManager");
+ TestCommon.checkDump(output, "Loading classes to share");
+
+ output = TestCommon.execCommon(
+ "-XX:+UnlockDiagnosticVMOptions",
+ "--patch-module=java.naming=" + moduleJar2 + File.pathSeparator + moduleJar,
+ "-Xlog:class+load",
+ "-Xlog:class+path=info",
+ "PatchMain", "javax.naming.spi.NamingManager");
+ TestCommon.checkExec(output, "I pass");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/BootAppendTests.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,256 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/**
+ * @test
+ * @summary AppCDS tests for testing -Xbootclasspath/a
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * jdk.internal.jvmstat/sun.jvmstat.monitor
+ * @compile src/jdk/test/Main.java
+ * @compile src/com/sun/tools/javac/Main2.jasm
+ * @compile src/sun/nio/cs/ext/MyClass.java
+ * @compile src/sun/nio/cs/ext1/MyClass.java
+ * @run main BootAppendTests
+ */
+
+import java.io.File;
+import java.nio.file.Path;
+import java.nio.file.Paths;
+import jdk.test.lib.cds.CDSOptions;
+import jdk.test.lib.cds.CDSTestUtils;
+import jdk.test.lib.process.ProcessTools;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class BootAppendTests {
+ private static final String TEST_SRC = System.getProperty("test.src");
+ private static final Path SRC_DIR = Paths.get(TEST_SRC, "src");
+ private static final Path CLASSES_DIR = Paths.get("classes");
+
+ private static final String MAIN_CLASS = "jdk.test.Main";
+ private static final String APP_MODULE_CLASS = "com/sun/tools/javac/Main2";
+ private static final String BOOT_APPEND_MODULE_CLASS = "sun/nio/cs/ext/MyClass";
+ private static final String BOOT_APPEND_CLASS = "sun/nio/cs/ext1/MyClass";
+ private static final String[] ARCHIVE_CLASSES =
+ {APP_MODULE_CLASS, BOOT_APPEND_MODULE_CLASS, BOOT_APPEND_CLASS};
+
+ private static String appJar;
+ private static String bootAppendJar;
+ private static String testArchiveName;
+
+ public static void main(String... args) throws Exception {
+ dumpArchive();
+
+ System.out.println("TESTCASE: 1: testBootAppendModuleClassWithoutAppCDS");
+ testBootAppendModuleClassWithoutAppCDS();
+
+ System.out.println("TESTCASE: 2" );
+ testBootAppendModuleClassWithAppCDS();
+
+ System.out.println("TESTCASE: 3" );
+ testBootAppendExcludedModuleClassWithoutAppCDS();
+
+ System.out.println("TESTCASE: 4" );
+ testBootAppendExcludedModuleClassWithAppCDS();
+
+ System.out.println("TESTCASE: 5" );
+ testBootAppendClassWithoutAppCDS();
+
+ System.out.println("TESTCASE: 6" );
+ testBootAppendClassWithAppCDS();
+
+ System.out.println("TESTCASE: 7" );
+ testBootAppendAppModuleClassWithoutAppCDS();
+
+ System.out.println("TESTCASE: 9" );
+ testBootAppendAppModuleClassWithAppCDS();
+
+ System.out.println("TESTCASE: 9" );
+ testBootAppendAppExcludeModuleClassWithoutAppCDS();
+
+ System.out.println("TESTCASE: 10" );
+ testBootAppendAppExcludeModuleClassAppCDS();
+ }
+
+ static void dumpArchive() throws Exception {
+ JarBuilder.build("classpathtests", "jdk/test/Main");
+ appJar = TestCommon.getTestJar("classpathtests.jar");
+
+ JarBuilder.build("bootAppend",
+ APP_MODULE_CLASS, BOOT_APPEND_MODULE_CLASS, BOOT_APPEND_CLASS);
+ bootAppendJar = TestCommon.getTestJar("bootAppend.jar");
+
+ OutputAnalyzer output1 = TestCommon.dump(
+ appJar, TestCommon.list(ARCHIVE_CLASSES), "-Xbootclasspath/a:" + bootAppendJar);
+ TestCommon.checkDump(output1);
+
+ if (!TestCommon.isUnableToMap(output1)) {
+ // Make sure all the classes were successfully archived.
+ for (String archiveClass : ARCHIVE_CLASSES) {
+ output1.shouldNotContain("Preload Warning: Cannot find " + archiveClass);
+ }
+ }
+
+ testArchiveName = TestCommon.getCurrentArchiveName();
+ }
+
+ // Test #1: A class in package defined in boot module
+ // - should not be loaded from the -Xbootclasspath/a without AppCDS
+ public static void testBootAppendModuleClassWithoutAppCDS() throws Exception {
+ CDSOptions opts = (new CDSOptions())
+ .addPrefix("-Xbootclasspath/a:" + bootAppendJar, "-cp", appJar)
+ .setArchiveName(testArchiveName)
+ .addSuffix(MAIN_CLASS, "Test #1", BOOT_APPEND_MODULE_CLASS, "false");
+
+ CDSTestUtils.runWithArchiveAndCheck(opts);
+ }
+
+ // Test #2: A shared class in package defined in boot module that's archived
+ // from -Xbootclasspath/a
+ // - should not be loaded by AppCDS
+ public static void testBootAppendModuleClassWithAppCDS() throws Exception {
+ OutputAnalyzer output = TestCommon.exec(
+ appJar,
+ "-Xbootclasspath/a:" + bootAppendJar,
+ MAIN_CLASS,
+ "Test #2", BOOT_APPEND_MODULE_CLASS, "false");
+ TestCommon.checkExec(output);
+ }
+
+
+ // Test #3: A class in excluded package defined in boot module
+ // - should be loaded from the -Xbootclasspath/a by the boot classloader
+ public static void testBootAppendExcludedModuleClassWithoutAppCDS() throws Exception {
+ CDSOptions opts = (new CDSOptions())
+ .addPrefix("-Xbootclasspath/a:" + bootAppendJar, "-cp", appJar,
+ "--limit-modules", "java.base")
+ .setArchiveName(testArchiveName)
+ .addSuffix(MAIN_CLASS, "Test #3", BOOT_APPEND_MODULE_CLASS, "true", "BOOT");
+
+ CDSTestUtils.runWithArchiveAndCheck(opts);
+ }
+
+ // Test #4: A shared class in excluded package that's archived from
+ // -Xbootclasspath/a
+ // - should be loaded from the archive by the bootstrap classloader
+ public static void testBootAppendExcludedModuleClassWithAppCDS() throws Exception {
+ OutputAnalyzer output = TestCommon.exec(
+ appJar,
+ "-Xbootclasspath/a:" + bootAppendJar,
+ "--limit-modules", "java.base",
+ "-XX:+TraceClassLoading",
+ MAIN_CLASS,
+ "Test #4", BOOT_APPEND_MODULE_CLASS, "true", "BOOT");
+ TestCommon.checkExec(output);
+ if (!TestCommon.isUnableToMap(output))
+ output.shouldContain("[class,load] sun.nio.cs.ext.MyClass source: shared objects file");
+ }
+
+
+ // Test #5: A class not in package defined in boot module
+ // - should be loaded from the -Xbootclasspath/a without AppCDS
+ public static void testBootAppendClassWithoutAppCDS() throws Exception {
+ CDSOptions opts = (new CDSOptions())
+ .addPrefix("-Xbootclasspath/a:" + bootAppendJar, "-cp", appJar)
+ .setArchiveName(testArchiveName)
+ .addSuffix(MAIN_CLASS, "Test #5", BOOT_APPEND_CLASS, "true", "BOOT");
+
+ CDSTestUtils.runWithArchiveAndCheck(opts);
+ }
+
+
+ // Test #6: A shared class not in package defined in boot module that's
+ // archived from -Xbootclasspath/a
+ // - should be loaded from the archive by the bootstrap class loader
+ public static void testBootAppendClassWithAppCDS() throws Exception {
+ OutputAnalyzer output = TestCommon.exec(
+ appJar,
+ "-Xbootclasspath/a:" + bootAppendJar,
+ "-XX:+TraceClassLoading",
+ MAIN_CLASS,
+ "Test #6", BOOT_APPEND_CLASS, "true", "BOOT");
+ TestCommon.checkExec(output);
+ if (!TestCommon.isUnableToMap(output))
+ output.shouldContain("[class,load] sun.nio.cs.ext1.MyClass source: shared objects file");
+ }
+
+
+ // Test #7: A class in package defined in jimage app module
+ // - should not be loaded from the -Xbootclasspath/a without AppCDS
+ public static void testBootAppendAppModuleClassWithoutAppCDS() throws Exception {
+ CDSOptions opts = (new CDSOptions())
+ .addPrefix("-Xbootclasspath/a:" + bootAppendJar, "-cp", appJar)
+ .setArchiveName(testArchiveName)
+ .addSuffix(MAIN_CLASS, "Test #7", APP_MODULE_CLASS, "false");
+
+ CDSTestUtils.runWithArchiveAndCheck(opts);
+ }
+
+
+ // Test #8: A shared class in package defined in jimage app module that's
+ // archived from -Xbootclasspath/a
+ // - should not be loaded from the archive
+ public static void testBootAppendAppModuleClassWithAppCDS() throws Exception {
+ OutputAnalyzer output = TestCommon.exec(
+ appJar,
+ "-Xbootclasspath/a:" + bootAppendJar,
+ MAIN_CLASS,
+ "Test #8", APP_MODULE_CLASS, "false");
+ TestCommon.checkExec(output);
+ }
+
+
+ // Test #9: A class in excluded package defined in jimage app module
+ // - should be loaded from the -Xbootclasspath/a without AppCDS
+ public static void testBootAppendAppExcludeModuleClassWithoutAppCDS()
+ throws Exception {
+
+ CDSOptions opts = (new CDSOptions())
+ .addPrefix("-Xbootclasspath/a:" + bootAppendJar, "-cp", appJar,
+ "--limit-modules", "java.base")
+ .setArchiveName(testArchiveName)
+ .addSuffix(MAIN_CLASS, "Test #9", APP_MODULE_CLASS, "true", "BOOT");
+
+ CDSTestUtils.runWithArchiveAndCheck(opts);
+ }
+
+ // Test #10: A shared class in excluded package defined in jimage app module
+ // - should be loaded from the -Xbootclasspath/a with AppCDS
+ public static void testBootAppendAppExcludeModuleClassAppCDS() throws Exception {
+ OutputAnalyzer output = TestCommon.exec(
+ appJar,
+ "-Xbootclasspath/a:" + bootAppendJar,
+ "-XX:+TraceClassLoading",
+ "--limit-modules", "java.base",
+ MAIN_CLASS,
+ "Test #10", APP_MODULE_CLASS, "true", "BOOT");
+ TestCommon.checkExec(output);
+
+ if (!TestCommon.isUnableToMap(output))
+ output.shouldContain("[class,load] com.sun.tools.javac.Main2 source: shared objects file");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/ClassPathTests.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,240 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/**
+ * @test
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library ../..
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * @modules jdk.jartool/sun.tools.jar
+ * @compile src/jdk/test/Main.java
+ * @compile src/com/sun/tools/javac/Main.jasm
+ * @compile src/com/sun/tools/javac/Main2.jasm
+ * @compile src/javax/activation/UnsupportedDataTypeException2.jasm
+ * @run main ClassPathTests
+ * @summary AppCDS tests for testing classpath/package conflicts
+ */
+
+/*
+ * These tests will verify that AppCDS will correctly handle archived classes
+ * on the classpath that are in a package that is also exported by the jimage.
+ * These classes should fail to load unless --limit-modules is used to hide the
+ * package exported by the jimage. There are 8 variants of this test:
+ * - With a jimage app package and with a jimage ext package
+ * - With --limit-modules and without --limit-modules
+ * - With AppCDS and without AppCDS (to verify behaviour is the same for both).
+ *
+ * There is also a 9th test to verify that when --limit-modules is used, a jimage
+ * class in the archive can be replaced by a classpath class with the
+ * same name and package.
+ */
+
+import java.lang.reflect.Method;
+import java.nio.file.Path;
+import java.nio.file.Paths;
+
+import jdk.test.lib.Asserts;
+import jdk.test.lib.cds.CDSOptions;
+import jdk.test.lib.cds.CDSTestUtils;
+import jdk.test.lib.process.ProcessTools;
+import jdk.test.lib.process.OutputAnalyzer;
+
+
+public class ClassPathTests {
+ private static final String TEST_SRC = System.getProperty("test.src");
+ private static final Path SRC_DIR = Paths.get(TEST_SRC, "src");
+ private static final Path CLASSES_DIR = Paths.get("classes");
+
+ // the test module
+ private static final String MAIN_CLASS = "jdk.test.Main";
+ private static final String LIMITMODS_MAIN_CLASS = "jdk.test.LimitModsMain";
+
+ // test classes to archive. These are both in UPGRADED_MODULES
+ private static final String JIMAGE_CLASS = "com/sun/tools/javac/Main";
+ private static final String APP_ARCHIVE_CLASS = "com/sun/tools/javac/Main2";
+ private static final String PLATFORM_ARCHIVE_CLASS = "javax/activation/UnsupportedDataTypeException2";
+ private static final String[] ARCHIVE_CLASSES = {APP_ARCHIVE_CLASS, PLATFORM_ARCHIVE_CLASS, JIMAGE_CLASS};
+ private static final int NUMBER_OF_TEST_CASES = 10;
+
+ private static String appJar;
+ private static String testArchiveName;
+
+
+ public static void main(String[] args) throws Exception {
+ ClassPathTests tests = new ClassPathTests();
+ tests.dumpArchive();
+
+ Method[] methods = tests.getClass().getDeclaredMethods();
+ int numOfTestMethodsRun = 0;
+ for (Method m : methods) {
+ if (m.getName().startsWith("test")) {
+ System.out.println("About to run test method: " + m.getName());
+ m.invoke(tests);
+ numOfTestMethodsRun++;
+ }
+ }
+
+ Asserts.assertTrue((numOfTestMethodsRun == NUMBER_OF_TEST_CASES),
+ "Expected " + NUMBER_OF_TEST_CASES + " test methods to run, actual number is "
+ + numOfTestMethodsRun);
+ }
+
+ private void dumpArchive() throws Exception {
+ // Create a jar file with all the classes related to this test.
+ JarBuilder.build( "classpathtests",
+ APP_ARCHIVE_CLASS, PLATFORM_ARCHIVE_CLASS, JIMAGE_CLASS,
+ "jdk/test/Main");
+ appJar = TestCommon.getTestJar("classpathtests.jar");
+
+ // dump the archive with altnernate jdk.comiler and jdk.activation classes in the class list
+ OutputAnalyzer output1 = TestCommon.dump(appJar, TestCommon.list(ARCHIVE_CLASSES));
+ TestCommon.checkDump(output1);
+ // Only a class that belongs to a module which is not defined by default
+ // can be found. In this case the PLATFORM_ARCHIVE_CLASS belongs
+ // to the java.activation which is not defined by default; it is the only
+ // class can be found during dumping.
+ for (String archiveClass : ARCHIVE_CLASSES) {
+ if (archiveClass.equals(PLATFORM_ARCHIVE_CLASS)) {
+ output1.shouldNotContain("Preload Warning: Cannot find " + archiveClass);
+ } else {
+ output1.shouldContain("Preload Warning: Cannot find " + archiveClass);
+ }
+ }
+
+ testArchiveName = TestCommon.getCurrentArchiveName();
+ }
+
+ // #1: Archived classpath class in same package as jimage app class. With AppCDS.
+ // Should fail to load.
+ public void testAppClassWithAppCDS() throws Exception {
+ OutputAnalyzer output = TestCommon.exec(
+ appJar, MAIN_CLASS,
+ "Test #1", APP_ARCHIVE_CLASS, "false"); // last 3 args passed to test
+ TestCommon.checkExec(output);
+ }
+
+ // #2: Archived classpath class in same package as jimage app class. Without AppCDS.
+ // Should fail to load.
+ public void testAppClassWithoutAppCDS() throws Exception {
+ CDSOptions opts = (new CDSOptions())
+ .addPrefix("-cp", appJar)
+ .setArchiveName(testArchiveName)
+ .addSuffix(MAIN_CLASS, "Test #2", APP_ARCHIVE_CLASS, "false");
+
+ CDSTestUtils.runWithArchiveAndCheck(opts);
+ }
+
+ // For tests #3 and #4, we need to "--add-modules java.activation" since the
+ // java.activation module won't be defined by default.
+
+ // #3: Archived classpath class in same package as jimage ext class. With AppCDS.
+ // Should fail to load.
+ public void testExtClassWithAppCDS() throws Exception {
+ OutputAnalyzer output = TestCommon.exec(
+ appJar, "--add-modules", "java.activation", MAIN_CLASS,
+ "Test #3", PLATFORM_ARCHIVE_CLASS, "false"); // last 3 args passed to test
+ TestCommon.checkExec(output);
+ }
+
+ // #4: Archived classpath class in same package as jimage ext class. Without AppCDS.
+ // Should fail to load.
+ public void testExtClassWithoutAppCDS() throws Exception {
+ CDSOptions opts = (new CDSOptions())
+ .addPrefix("-cp", appJar, "--add-modules", "java.activation")
+ .setArchiveName(testArchiveName)
+ .addSuffix(MAIN_CLASS, "Test #4", PLATFORM_ARCHIVE_CLASS, "false");
+
+ CDSTestUtils.runWithArchiveAndCheck(opts);
+ }
+
+ // #5: Archived classpath class in same package as jimage app class. With AppCDS.
+ // Should load because --limit-modules is used.
+ public void testAppClassWithLimitModsWithAppCDS() throws Exception {
+ OutputAnalyzer output = TestCommon.exec(
+ appJar,
+ "--limit-modules", "java.base",
+ MAIN_CLASS,
+ "Test #5", APP_ARCHIVE_CLASS, "true"); // last 3 args passed to test
+ TestCommon.checkExec(output);
+ }
+
+ // #6: Archived classpath class in same package as jimage app class. Without AppCDS.
+ // Should load because --limit-modules is used.
+ public void testAppClassWithLimitModsWithoutAppCDS() throws Exception {
+ CDSOptions opts = (new CDSOptions())
+ .addPrefix("-cp", appJar, "--limit-modules", "java.base")
+ .setArchiveName(testArchiveName)
+ .addSuffix(MAIN_CLASS, "Test #6", APP_ARCHIVE_CLASS, "true");
+
+ CDSTestUtils.runWithArchiveAndCheck(opts);
+ }
+
+ // #7: Archived classpath class in same package as jimage ext class. With AppCDS.
+ // Should load because --limit-modules is used.
+ public void testExtClassWithLimitModsWithAppCDS() throws Exception {
+ OutputAnalyzer output = TestCommon.exec(
+ appJar,
+ "--limit-modules", "java.base",
+ MAIN_CLASS,
+ "Test #7", PLATFORM_ARCHIVE_CLASS, "true"); // last 3 args passed to test
+ TestCommon.checkExec(output);
+ }
+
+ // #8: Archived classpath class in same package as jimage ext class. Without AppCDS.
+ // Should load because --limit-modules is used.
+ public void testExtClassWithLimitModsWithoutAppCDS() throws Exception {
+ CDSOptions opts = (new CDSOptions())
+ .addPrefix("-cp", appJar, "--limit-modules", "java.base")
+ .setArchiveName(testArchiveName)
+ .addSuffix(MAIN_CLASS, "Test #8", PLATFORM_ARCHIVE_CLASS, "true");
+
+ CDSTestUtils.runWithArchiveAndCheck(opts);
+ }
+
+ // #9: Archived classpath class with same name as jimage app class. With AppCDS.
+ // Should load because --limit-modules is used.
+ public void testReplacingJImageClassWithAppCDS() throws Exception {
+ OutputAnalyzer output = TestCommon.exec(
+ appJar,
+ "--limit-modules", "java.base", "-XX:+TraceClassLoading",
+ MAIN_CLASS,
+ "Test #9", JIMAGE_CLASS, "true"); // last 3 args passed to test
+ TestCommon.checkExec(output);
+ }
+
+ // #10: Archived classpath class with same name as jimage app class. Without AppCDS.
+ // Should load because --limit-modules is used. Note the archive will actually contain
+ // the original jimage version of the class, but AppCDS should refuse to load it
+ // since --limit-modules is used. This should result in the -cp version being used.
+ public void testReplacingJImageClassWithoutAppCDS() throws Exception {
+ CDSOptions opts = (new CDSOptions())
+ .addPrefix("-cp", appJar, "--limit-modules", "java.base")
+ .setArchiveName(testArchiveName)
+ .addSuffix(MAIN_CLASS, "Test #10", JIMAGE_CLASS, "true");
+
+ CDSTestUtils.runWithArchiveAndCheck(opts);
+ }
+
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/DummyClassesInBootClassPath.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,88 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Ensure that classes found in jimage takes precedence over classes found in -Xbootclasspath/a.
+ * AppCDS does not support uncompressed oops
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.activation
+ * jdk.jartool/sun.tools.jar
+ * @compile ../../test-classes/DummyClassHelper.java
+ * @compile ../../test-classes/java/net/HttpCookie.jasm
+ * @compile ../../test-classes/javax/activation/MimeType.jasm
+ * @build sun.hotspot.WhiteBox
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @run main DummyClassesInBootClassPath
+ */
+
+import java.io.File;
+import java.util.List;
+import java.util.ArrayList;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class DummyClassesInBootClassPath {
+ private static final String METHOD_NAME = "thisClassIsDummy()";
+
+ public static void main(String[] args) throws Exception {
+ String classNames[] = { "java/net/HttpCookie",
+ "javax/activation/MimeType"};
+ JarBuilder.build("dummyClasses", classNames[0], classNames[1]);
+
+ String appJar = TestCommon.getTestJar("dummyClasses.jar");
+ OutputAnalyzer dumpOutput = TestCommon.dump(
+ appJar, classNames, "-Xbootclasspath/a:" + appJar);
+
+ List<String> argsList = new ArrayList<String>();
+ for (int i = 0; i < classNames.length; i++) {
+ argsList.add(classNames[i].replace('/', '.'));
+ }
+ String[] arguments = new String[argsList.size()];
+ arguments = argsList.toArray(arguments);
+ OutputAnalyzer execOutput = TestCommon.execCommon(
+ "-cp", TestCommon.getTestDir("."), "-verbose:class",
+ "--add-modules", "java.activation",
+ "-Xbootclasspath/a:" + appJar, "DummyClassHelper",
+ arguments[0], arguments[1]);
+ for (int i = 0; i < arguments.length; i++) {
+ TestCommon.checkExec(execOutput,
+ "java.lang.NoSuchMethodException: " + arguments[i] + "." +
+ METHOD_NAME);
+ }
+
+ JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox");
+ String whiteBoxJar = TestCommon.getTestJar("WhiteBox.jar");
+ String bootClassPath = "-Xbootclasspath/a:" + appJar +
+ File.pathSeparator + whiteBoxJar;
+ argsList.add("testWithWhiteBox");
+ arguments = new String[argsList.size()];
+ arguments = argsList.toArray(arguments);
+ String[] opts = {"-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI",
+ bootClassPath, "-XX:+TraceClassPaths", "DummyClassHelper",
+ arguments[0], arguments[1], arguments[2]};
+ OutputAnalyzer output = TestCommon.execCommon(opts);
+ }
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/EmptyClassInBootClassPath.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,106 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Test a few scenarios if an empty class, which has the same name as the one in the jimage, is specified in the -Xbootclasspath/a
+ * 1) boot loader will always load the class from the bootclasspath
+ * 2) app loader will load the class from the jimage by default;
+ * app loader will load the class from the bootclasspath if the
+ * "--limit-modules java.base" option is specified
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * jdk.internal.jvmstat/sun.jvmstat.monitor
+ * @compile ../../test-classes/EmptyClassHelper.java
+ * @compile ../../test-classes/com/sun/tools/javac/Main.jasm
+ * @run main EmptyClassInBootClassPath
+ */
+
+import java.io.File;
+import java.lang.*;
+import java.lang.reflect.*;
+import java.util.List;
+import java.util.ArrayList;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class EmptyClassInBootClassPath {
+ static final String EXPECTED_EXCEPTION =
+ "java.lang.NoSuchMethodException: com.sun.tools.javac.Main.main([Ljava.lang.String;)";
+ public static void main(String[] args) throws Exception {
+ String[] className = {"com/sun/tools/javac/Main"};
+ JarBuilder.build("emptyClass", className);
+ String appJar = TestCommon.getTestJar("emptyClass.jar");
+ JarBuilder.build("EmptyClassHelper", "EmptyClassHelper");
+ String helperJar = TestCommon.getTestJar("EmptyClassHelper.jar");
+ OutputAnalyzer dumpOutput = TestCommon.dump(
+ appJar, className, "-Xbootclasspath/a:" + appJar);
+ TestCommon.checkDump(dumpOutput);
+ dumpOutput.shouldNotContain("Preload Warning: skipping class from -Xbootclasspath/a " + className[0]);
+
+ String bootclasspath = "-Xbootclasspath/a:" + appJar;
+ String classPath = "-Djava.class.path=" + appJar + File.pathSeparator + helperJar;
+ List<String> argsList = new ArrayList<String>();
+ argsList.add(classPath);
+ argsList.add(bootclasspath);
+ argsList.add("--add-exports=java.base/jdk.internal.misc=ALL-UNNAMED");
+ argsList.add("EmptyClassHelper");
+
+ // case 1: load class in bootclasspath using app loader
+ argsList.add("useAppLoader");
+ String[] opts = new String[argsList.size()];
+ opts = argsList.toArray(opts);
+ OutputAnalyzer runOutput = TestCommon.execCommon(opts);
+ TestCommon.checkExec(runOutput, "appLoader found method main");
+
+ // case 2: load class in bootclasspath using boot loader
+ argsList.remove(argsList.size() - 1);
+ argsList.add("useBootLoader");
+ opts = new String[argsList.size()];
+ opts = argsList.toArray(opts);
+ runOutput = TestCommon.execCommon(opts);
+ TestCommon.checkExec(runOutput, EXPECTED_EXCEPTION);
+
+ // case 3: load class in bootclasspath using app loader with '--limit-modules java.base'
+ argsList.add(0, "--limit-modules");
+ argsList.add(1, "java.base");
+ argsList.remove(argsList.size() - 1);
+ argsList.add("useAppLoader");
+ opts = new String[argsList.size()];
+ opts = argsList.toArray(opts);
+ runOutput = TestCommon.execCommon(opts);
+ TestCommon.checkExec(runOutput, EXPECTED_EXCEPTION);
+
+ // case 4: load class in bootclasspath using boot loader with '--limit-modules java.base'
+ argsList.remove(argsList.size() - 1);
+ argsList.add("useBootLoader");
+ opts = new String[argsList.size()];
+ opts = argsList.toArray(opts);
+ runOutput = TestCommon.execCommon(opts);
+ TestCommon.checkExec(runOutput, EXPECTED_EXCEPTION);
+
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/com/sun/tools/javac/Main.jasm Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,46 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+package com/sun/tools/javac;
+
+public class Main
+ version 51:0
+{
+
+public Method "<init>":"()V"
+ stack 1 locals 1
+{
+ aload_0;
+ invokespecial Method java/lang/Object."<init>":"()V";
+ return;
+}
+
+public Method toString:"()Ljava/lang/String;"
+ stack 1 locals 1
+{
+ ldc String "hi";
+ areturn;
+}
+
+} // end class Main
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/com/sun/tools/javac/Main2.jasm Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,46 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+package com/sun/tools/javac;
+
+public class Main2
+ version 51:0
+{
+
+public Method "<init>":"()V"
+ stack 1 locals 1
+{
+ aload_0;
+ invokespecial Method java/lang/Object."<init>":"()V";
+ return;
+}
+
+public Method toString:"()Ljava/lang/String;"
+ stack 1 locals 1
+{
+ ldc String "hi";
+ areturn;
+}
+
+} // end class Main2
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/javax/activation/UnsupportedDataTypeException2.jasm Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,46 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+package javax/activation;
+
+public class UnsupportedDataTypeException2
+ version 51:0
+{
+
+public Method "<init>":"()V"
+ stack 1 locals 1
+{
+ aload_0;
+ invokespecial Method java/lang/Object."<init>":"()V";
+ return;
+}
+
+public Method toString:"()Ljava/lang/String;"
+ stack 1 locals 1
+{
+ ldc String "hi";
+ areturn;
+}
+
+} // end class UnsupportedDataTypeException2
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/jdk/test/Main.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,122 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/**
+ * Tests loading an archived class that has the same class name as one in the
+ * jimage. The class should normally fail to load since a classpath class is not
+ * allowed to have the same package name as a module in the jimage. However,
+ * if --limit-modules was used then archived class should be loaded.
+ */
+
+package jdk.test;
+
+public class Main {
+ static final ClassLoader BOOT_LOADER = null;
+ static final ClassLoader PLATFORM_LOADER = ClassLoader.getPlatformClassLoader();
+ static final ClassLoader SYS_LOADER = ClassLoader.getSystemClassLoader();
+
+ public static void main(String[] args) throws Exception {
+ boolean shouldLoad = false;
+ ClassLoader expectedLoader = SYS_LOADER;
+
+ /*
+ * 3 Arguments are passed to this test:
+ * 1. testName: Name of the test being run.
+ * 2. className: Name of the class to load and instantiate.
+ * 3. shouldLoad: Either "true" or "false" to indicate whether the class should
+ * successfully load ("true" indicates --limit-modules was used.)
+ * The 4th argument is optional. It specifies the classloader.
+ */
+
+ assertTrue(args.length <= 4);
+ String testName = args[0];
+ String className = args[1].replace('/', '.');
+ String shouldLoadName = args[2]; // "true" or "false"
+ String loaderName = "SYS";
+ if (args.length == 4) {
+ loaderName = args[3];
+ }
+
+ if (shouldLoadName.equals("true")) {
+ shouldLoad = true;
+ } else if (shouldLoadName.equals("false")) {
+ shouldLoad = false;
+ } else {
+ assertTrue(false);
+ }
+
+ if (loaderName.equals("SYS")) {
+ expectedLoader = SYS_LOADER;
+ } else if (loaderName.equals("EXT")) {
+ expectedLoader = PLATFORM_LOADER;
+ } else if (loaderName.equals("BOOT")) {
+ expectedLoader = BOOT_LOADER;
+ }
+
+ System.out.println(testName + ": class=" + className + " shouldLoad=" +
+ shouldLoadName + " by loader:" + expectedLoader);
+
+ // Try to load the specified class with the default ClassLoader.
+ Class<?> clazz = null;
+ try {
+ clazz = Class.forName(className);
+ } catch (ClassNotFoundException e) {
+ System.out.println(e);
+ }
+
+ if (clazz != null) {
+ // class loaded
+ if (shouldLoad) {
+ // Make sure we got the expected defining ClassLoader
+ ClassLoader actualLoader = clazz.getClassLoader();
+ if (actualLoader != expectedLoader) {
+ throw new RuntimeException(testName + " FAILED: " + clazz + " loaded by " + actualLoader +
+ ", expected " + expectedLoader);
+ }
+ // Make sure we got the right version of the class. toString() of an instance
+ // of the overridden version of the class should return "hi".
+ String s = clazz.newInstance().toString();
+ if (!s.equals("hi")) {
+ throw new RuntimeException(testName + " FAILED: toString() returned \"" + s
+ + "\" instead of \"hi\"" );
+ }
+ System.out.println(testName + " PASSED: class loaded as expected.");
+ } else {
+ throw new RuntimeException(testName + " FAILED: class loaded, but should have failed to load.");
+ }
+ } else {
+ // class did not load
+ if (shouldLoad) {
+ throw new RuntimeException(testName + " FAILED: class failed to load.");
+ } else {
+ System.out.println(testName + " PASSED: ClassNotFoundException thrown as expected");
+ }
+ }
+ }
+
+ static void assertTrue(boolean expr) {
+ if (!expr)
+ throw new RuntimeException("assertion failed");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/sun/nio/cs/ext/MyClass.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,31 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+package sun.nio.cs.ext;
+
+public class MyClass {
+ public String toString() {
+ return "hi";
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/classpathtests/src/sun/nio/cs/ext1/MyClass.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,31 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+package sun.nio.cs.ext1;
+
+public class MyClass {
+ public String toString() {
+ return "hi";
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/limitmods/LimitModsHelper.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,93 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/**
+ * Used with -p or --upgrade-module-path to exercise the replacement
+ * of classes in modules that are linked into the runtime image.
+ */
+
+import java.lang.*;
+import java.lang.reflect.*;
+import sun.hotspot.WhiteBox;
+
+
+public class LimitModsHelper {
+ static final ClassLoader PLATFORM_LOADER = ClassLoader.getPlatformClassLoader();
+ static final ClassLoader SYS_LOADER = ClassLoader.getSystemClassLoader();
+
+ public static void main(String[] args) throws Exception {
+ assertTrue(args.length == 4);
+ String[] classNames = new String[3];
+ for (int i = 0; i < 3; i++) {
+ classNames[i] = args[i].replace('/', '.');
+ }
+ int excludeModIdx = Integer.parseInt(args[3]);
+
+ ClassLoader expectedLoaders[] = {null, PLATFORM_LOADER, SYS_LOADER};
+
+ WhiteBox wb = WhiteBox.getWhiteBox();
+
+ Class<?> clazz = null;
+ for (int i = 0; i < 3; i++) {
+ try {
+ // Load the class with the default ClassLoader.
+ clazz = Class.forName(classNames[i]);
+ } catch (Exception e) {
+ if (i == excludeModIdx) {
+ System.out.println(classNames[i] + " not found as expected because the module isn't in the --limit-modules - PASSED");
+ } else {
+ throw(e);
+ }
+ }
+
+ if (clazz != null && i != excludeModIdx) {
+ // Make sure we got the expected defining ClassLoader
+ testLoader(clazz, expectedLoaders[i]);
+
+ // Make sure the class is in the shared space
+ if (!wb.isSharedClass(clazz)) {
+ throw new RuntimeException(clazz.getName() +
+ ".class should be in the shared space. " +
+ "loader=" + clazz.getClassLoader() + " module=" + clazz.getModule().getName());
+ }
+ }
+ clazz = null;
+ }
+ }
+
+ /**
+ * Asserts that given class has the expected defining loader.
+ */
+ static void testLoader(Class<?> clazz, ClassLoader expected) {
+ ClassLoader loader = clazz.getClassLoader();
+ if (loader != expected) {
+ throw new RuntimeException(clazz + " loaded by " + loader + ", expected " + expected);
+ }
+ }
+
+ static void assertTrue(boolean expr) {
+ if (!expr)
+ throw new RuntimeException("assertion failed");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/limitmods/LimitModsTests.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,164 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/**
+ * @test
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library ../..
+ * @library /test/lib
+ * @modules java.base/jdk.internal.misc
+ * @modules jdk.jartool/sun.tools.jar
+ * jdk.internal.jvmstat/sun.jvmstat.monitor
+ * @compile LimitModsHelper.java
+ * @compile ../../test-classes/java/net/HttpCookie.jasm
+ * @compile ../../test-classes/jdk/dynalink/DynamicLinker.jasm
+ * @compile ../../test-classes/com/sun/tools/javac/Main.jasm
+ * @build sun.hotspot.WhiteBox
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @run main LimitModsTests
+ * @summary AppCDS tests for excluding class in module by using --limit-modules.
+ */
+
+/**
+ * This is for testing the --limit-modules option with AppCDS.
+ * This test assumes the following defining class loader, module, class relations:
+ * class loader module class
+ * -----------------------------------------------------
+ * boot java.base java/net/HttpCookie
+ * platform jdk.dynalink jdk/dynalink/DynamicLinker
+ * app jdk.compiler com/sun/tools/javac/Main
+ *
+ * This test dumps the above 3 classes into a shared archive.
+ * Then it will run the following 4 -limit-modules scenarios:
+ * 1. without --limit-modules
+ * All 3 classes should be loaded successfully.
+ * All 3 classes should be loaded by the appropriate class loader.
+ * All 3 classes should be found in the shared archive.
+ * 2. --limit-modules java.base,jdk.dynalink
+ * The loading of the com/sun/tools/javac/Main class should fail.
+ * The other 2 classes should be loaded successfully and by the appropriate class loader.
+ * The other 2 classes should be found in the shared archive.
+ * 3. --limit-modules java.base,jdk.compiler
+ * The loading of the jdk/nio/dynalink/DynamicLinker class should fail.
+ * The other 2 classes should be loaded successfully and by the appropriate class loader.
+ * The other 2 classes should be found in the shared archive.
+ * 4. --limit-modules jdk.dynalink,jdk.compiler
+ * The java.base module can't be excluded.
+ * The results for this case is the same as for case #1.
+ */
+
+import java.io.File;
+import java.nio.file.Path;
+import java.nio.file.Paths;
+
+import jdk.test.lib.process.ProcessTools;
+import jdk.test.lib.process.OutputAnalyzer;
+
+
+public class LimitModsTests {
+
+ // the module that is limited
+ private static final String[] LIMIT_MODULES = {"java.base", "jdk.dynalink", "jdk.compiler"};
+
+ // test classes to archive.
+ private static final String BOOT_ARCHIVE_CLASS = "java/net/HttpCookie";
+ private static final String PLATFORM_ARCHIVE_CLASS = "jdk/dynalink/DynamicLinker";
+ private static final String APP_ARCHIVE_CLASS = "com/sun/tools/javac/Main";
+ private static final String[] ARCHIVE_CLASSES = {
+ BOOT_ARCHIVE_CLASS, PLATFORM_ARCHIVE_CLASS, APP_ARCHIVE_CLASS};
+ private String bootClassPath = null;
+ private String whiteBoxJar = null;
+ private String helperJar = null;
+ private String appJar = null;
+ private OutputAnalyzer output = null;
+
+ public static void main(String[] args) throws Exception {
+ LimitModsTests tests = new LimitModsTests();
+ tests.dumpArchive();
+ tests.runTestNoLimitMods();
+ tests.runTestLimitMods();
+ }
+
+ void dumpArchive() throws Exception {
+ JarBuilder.build("limitModsTest", BOOT_ARCHIVE_CLASS, PLATFORM_ARCHIVE_CLASS, APP_ARCHIVE_CLASS);
+ JarBuilder.build(true, "WhiteBox", "sun/hotspot/WhiteBox");
+ JarBuilder.build("limitModsHelper", "LimitModsHelper");
+
+ appJar = TestCommon.getTestJar("limitModsTest.jar");
+ whiteBoxJar = TestCommon.getTestJar("WhiteBox.jar");
+ helperJar = TestCommon.getTestJar("limitModsHelper.jar");
+ bootClassPath = "-Xbootclasspath/a:" + whiteBoxJar;
+ // Dump the test classes into the archive
+ OutputAnalyzer output1 = TestCommon.dump(appJar, TestCommon.list(ARCHIVE_CLASSES), bootClassPath);
+ TestCommon.checkDump(output1);
+ // Make sure all the classes where successfully archived.
+ for (String archiveClass : ARCHIVE_CLASSES) {
+ output1.shouldNotContain("Preload Warning: Cannot find " + archiveClass);
+ }
+ }
+
+ // run the test without --limit-modules
+ public void runTestNoLimitMods() throws Exception {
+ output = TestCommon.exec(
+ appJar + File.pathSeparator + helperJar,
+ "-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI", bootClassPath,
+ "LimitModsHelper",
+ BOOT_ARCHIVE_CLASS, PLATFORM_ARCHIVE_CLASS, APP_ARCHIVE_CLASS, "-1"); // last 4 args passed to test
+ TestCommon.checkExec(output);
+ }
+
+ // run the test with --limit-modules
+ //
+ // --limit-modules jdk.dynalink,jdk.compiler
+ // It seems we can't exclude the java.base module. For this case,
+ // although the java.base module isn't in --limit-modules, the class
+ // in the java.base module (java.net.HttpCookie) can also be found.
+ //
+ // --limit-modules java.base,jdk.dynalink
+ // --limit-modules java.base,jdk.compiler
+ public void runTestLimitMods() throws Exception {
+ String limitMods = null;
+ for (int excludeModIdx = 0; excludeModIdx < 3; excludeModIdx++) {
+ for (int includeModIdx = 0; includeModIdx < 3; includeModIdx++) {
+ if (includeModIdx != excludeModIdx) {
+ if (limitMods != null) {
+ limitMods += ",";
+ limitMods += LIMIT_MODULES[includeModIdx];
+ } else {
+ limitMods = LIMIT_MODULES[includeModIdx];
+ }
+ }
+ }
+ output = TestCommon.exec(
+ appJar + File.pathSeparator + helperJar,
+ "-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI", bootClassPath,
+ "--limit-modules", limitMods,
+ "LimitModsHelper",
+ BOOT_ARCHIVE_CLASS, PLATFORM_ARCHIVE_CLASS, APP_ARCHIVE_CLASS,
+ Integer.toString(excludeModIdx)); // last 4 args passed to test
+ TestCommon.checkExec(output);
+ limitMods = null;
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/OverrideTests.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,238 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/**
+ * @test
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @modules java.base/jdk.internal.misc
+ * @library ../..
+ * @library /test/lib
+ * @run main OverrideTests
+ * @summary AppCDS tests for overriding archived classes with -p and --upgrade-module-path
+ */
+
+/*
+ * This test consists of 4 tests:
+ * 1. Archive PLATFORM class and override with --upgrade-module-path.
+ * 2. Archive PLATFORM class and override with -p.
+ * 3. Archive APP class and override with --upgrade-module-path.
+ * 4. Archive App class and override with -p.
+ * For all 4 tests, the class is instantiatied and toString() is called
+ * to check whether the archived version or the override version was instantiatied.
+ * For tests 1 and 3, the overridden version should be instantiatied.
+ * For tests 2 and 4, the archived version should be instantiated.
+ *
+ * This test uses the same test helper class in all 4 cases. It is located in
+ * src/test/jdk/test/Main.java. It will be invoked once for each test cases,
+ * with parameters to the test determining how it is run and what the
+ * expected result is. See Main.java for a description of these 3 arguments.
+ */
+
+import java.io.File;
+import java.nio.file.Files;
+import java.nio.file.Path;
+import java.nio.file.Paths;
+
+import jdk.test.lib.Asserts;
+import jdk.test.lib.cds.CDSOptions;
+import jdk.test.lib.cds.CDSTestUtils;
+import jdk.test.lib.process.OutputAnalyzer;
+import jdk.test.lib.process.ProcessTools;
+
+
+public class OverrideTests {
+ private static final String TEST_SRC = System.getProperty("test.src");
+ private static final Path SRC_DIR = Paths.get(TEST_SRC, "src");
+ private static final Path MODS_DIR = Paths.get("mods");
+
+ // the module that is upgraded
+ private static final String[] UPGRADED_MODULES = {"jdk.compiler", "java.activation"};
+ private static final Path[] UPGRADEDMODS_DIR = {Paths.get("upgradedmod1"), Paths.get("upgradedmod2")};
+
+ // the test module
+ private static final String TEST_MODULE = "test";
+ private static final String MAIN_CLASS = "jdk.test.Main";
+
+ // test classes to archive. These are both in UPGRADED_MODULES
+ private static final String APP_ARCHIVE_CLASS = "com/sun/tools/javac/Main";
+ private static final String PLATFORM_ARCHIVE_CLASS = "javax/activation/UnsupportedDataTypeException";
+ private static final String[] ARCHIVE_CLASSES = {APP_ARCHIVE_CLASS, PLATFORM_ARCHIVE_CLASS};
+ private static String testArchiveName;
+
+
+ public static void main(String[] args) throws Exception {
+ OverrideTests tests = new OverrideTests();
+ tests.compileModulesAndDumpArchive();
+ tests.testAppClassOverriding();
+ tests.testPlatformClassOverriding();
+ }
+
+ void compileModulesAndDumpArchive() throws Exception {
+ boolean compiled;
+ // javac -d upgradedmods/$upgradedMod src/$upgradedMod/**
+ int i = 0;
+ for (String upgradedMod : UPGRADED_MODULES) {
+ compiled = CompilerUtils.compile(
+ SRC_DIR.resolve(upgradedMod),
+ UPGRADEDMODS_DIR[i].resolve(upgradedMod)
+ );
+ Asserts.assertTrue(compiled, upgradedMod + " did not compile");
+ i++;
+ }
+
+ // javac -d mods/test --upgrade-module-path upgradedmods ...
+ compiled = CompilerUtils.compile(
+ SRC_DIR.resolve(TEST_MODULE),
+ MODS_DIR.resolve(TEST_MODULE),
+ "--upgrade-module-path", UPGRADEDMODS_DIR[0].toString() +
+ System.getProperty("path.separator") + UPGRADEDMODS_DIR[1].toString()
+ );
+ Asserts.assertTrue(compiled, TEST_MODULE + " did not compile");
+
+ // the java.activation module is not defined by default; --add-modules is required.
+ // dumping without "--add-modules java.activation"
+ // the class in the javax.activation package cannot be found
+ OutputAnalyzer output1 = TestCommon.dump(null /* appJar*/, TestCommon.list(ARCHIVE_CLASSES));
+ TestCommon.checkDump(output1);
+ output1.shouldContain(
+ "Preload Warning: Cannot find javax/activation/UnsupportedDataTypeException");
+
+ // dump the archive with jdk.comiler and java.activation classes in the class list
+ // with "--add-modules java.activation"
+ output1 = TestCommon.dump(null /* appJar*/, TestCommon.list(ARCHIVE_CLASSES),
+ "--add-modules", "java.activation");
+ TestCommon.checkDump(output1);
+ // Make sure all the classes where successfully archived.
+ for (String archiveClass : ARCHIVE_CLASSES) {
+ output1.shouldNotContain("Preload Warning: Cannot find " + archiveClass);
+ }
+
+ testArchiveName = TestCommon.getCurrentArchiveName();
+ }
+
+ /**
+ * APP Class Overriding Tests
+ *
+ * Archive APP class com.sun.tools.javac.Main from module jdk.compiler.
+ * -At run time, upgrade module jdk.compiler using --upgrade-module-path.
+ * Class.forname(Main) MUST NOT load the archived Main.
+ * -At run time, module jdk.compiler also exists in --module-path.
+ * Class.forname(Main) MUST load the archived Main.
+ */
+ public void testAppClassOverriding() throws Exception {
+ testClassOverriding(APP_ARCHIVE_CLASS, "app");
+ }
+
+ /**
+ * PLATFORM Class Overriding Tests
+ *
+ * Archive PLATFORM class javax.activation.UnsupportedDataTypeException from module jdk.activation.
+ * -At run time, upgrade module jdk.activation using --upgrade-module-path.
+ * Class.forname(UnsupportedDataTypeException) MUST NOT load the archived UnsupportedDataTypeException.
+ * -At run time, module jdk.activation also exists in --module-path.
+ * Class.forname(UnsupportedDataTypeException) MUST load the archived UnsupportedDataTypeException.
+ */
+ public void testPlatformClassOverriding() throws Exception {
+ testClassOverriding(PLATFORM_ARCHIVE_CLASS, "platform");
+ }
+
+ /**
+ * Run the test twice. Once with upgrade module on --upgrade-module-path and once with it on -p.
+ * Only modules defined to the PlatformClassLoader are upgradeable.
+ * Modules defined to the AppClassLoader are not upgradeble; we expect the
+ * FindException to be thrown.
+ */
+ void testClassOverriding(String archiveClass, String loaderName) throws Exception {
+ String mid = TEST_MODULE + "/" + MAIN_CLASS;
+ OutputAnalyzer output;
+ boolean isAppLoader = loaderName.equals("app");
+ int upgradeModIdx = isAppLoader ? 0 : 1;
+ String expectedException = "java.lang.module.FindException: Unable to compute the hash";
+ String prefix[] = new String[4];
+ prefix[0] = "-cp";
+ prefix[1] = "\"\"";
+ prefix[2] = "--add-modules";
+ prefix[3] = "java.activation";
+
+ // Run the test with --upgrade-module-path set to alternate location of archiveClass
+ // The alternate version of archiveClass SHOULD be found.
+ output = TestCommon.execModule(
+ prefix,
+ UPGRADEDMODS_DIR[upgradeModIdx].toString(),
+ MODS_DIR.toString(),
+ mid,
+ archiveClass, loaderName, "true"); // last 3 args passed to test
+ if (isAppLoader) {
+ try {
+ output.shouldContain(expectedException);
+ } catch (Exception e) {
+ TestCommon.checkCommonExecExceptions(output, e);
+ }
+ } else {
+ TestCommon.checkExec(output);
+ }
+
+ // Now run this same test again, but this time without AppCDS. Behavior should be the same.
+ CDSOptions opts = (new CDSOptions())
+ .addPrefix(prefix)
+ .setArchiveName(testArchiveName).setUseVersion(false)
+ .addSuffix("--upgrade-module-path", UPGRADEDMODS_DIR[upgradeModIdx].toString(),
+ "-p", MODS_DIR.toString(), "-m", mid)
+ .addSuffix(archiveClass, loaderName, "true");
+
+ output = CDSTestUtils.runWithArchive(opts);
+
+ if (isAppLoader) {
+ try {
+ output.shouldContain(expectedException);
+ } catch (Exception e) {
+ TestCommon.checkCommonExecExceptions(output, e);
+ }
+ } else {
+ if (!CDSTestUtils.isUnableToMap(output))
+ output.shouldHaveExitValue(0);
+ }
+
+ // Run the test with -p set to alternate location of archiveClass.
+ // The alternate version of archiveClass SHOULD NOT be found.
+ output = TestCommon.execModule(
+ prefix,
+ null,
+ UPGRADEDMODS_DIR[upgradeModIdx].toString() + java.io.File.pathSeparator + MODS_DIR.toString(),
+ mid,
+ archiveClass, loaderName, "false"); // last 3 args passed to test
+ TestCommon.checkExec(output);
+
+ // Now run this same test again, but this time without AppCDS. Behavior should be the same.
+ opts = (new CDSOptions())
+ .addPrefix(prefix)
+ .setArchiveName(testArchiveName).setUseVersion(false)
+ .addSuffix("-p", MODS_DIR.toString(), "-m", mid)
+ .addSuffix(archiveClass, loaderName, "false"); // params to the test class
+
+ OutputAnalyzer out = CDSTestUtils.runWithArchive(opts);
+ if (!CDSTestUtils.isUnableToMap(out))
+ out.shouldHaveExitValue(0);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/java.activation/javax/activation/UnsupportedDataTypeException.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,36 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+package javax.activation;
+
+import java.io.IOException;
+
+public class UnsupportedDataTypeException extends IOException {
+ public UnsupportedDataTypeException() {
+ }
+
+ public String toString() {
+ return "hi";
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/java.activation/module-info.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,28 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+module java.activation {
+ exports javax.activation;
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/jdk.compiler/com/sun/tools/javac/Main.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,31 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+package com.sun.tools.javac;
+
+public class Main {
+ public String toString() {
+ return "hi";
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/jdk.compiler/module-info.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,28 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+module jdk.compiler {
+ exports com.sun.tools.javac;
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/test/jdk/test/Main.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,101 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/**
+ * Used with -p or --upgrade-module-path to exercise the replacement
+ * of classes in modules that are linked into the runtime image.
+ */
+
+package jdk.test;
+
+public class Main {
+ static final ClassLoader PLATFORM_LOADER = ClassLoader.getPlatformClassLoader();
+ static final ClassLoader SYS_LOADER = ClassLoader.getSystemClassLoader();
+
+ public static void main(String[] args) throws Exception {
+ ClassLoader loader = null;
+ boolean shouldOverride = false;
+
+ /*
+ * 3 Arguments are passed to this test:
+ * 1. className: Name of the class to load.
+ * 2. loaderName: Either "platform" or "app", which specifies which ClassLoader is expected
+ * to be the defining ClassLoader once the class is loaded. The initiating
+ * ClassLoader is always the default ClassLoader (which should be the
+ * app (system) ClassLoader.
+ * 3. shouldOverride: Either "true" or "false" to indicate whether the loaded class
+ * should be the one we are attempting to override with (not the archived version).
+ */
+
+ assertTrue(args.length == 3, "Unexpected number of arguments: expected 3, actual " + args.length);
+ String className = args[0].replace('/', '.');
+ String loaderName = args[1]; // "platform" or "app"
+ String shouldOverrideName = args[2]; // "true" or "false"
+
+ if (loaderName.equals("app")) {
+ loader = SYS_LOADER;
+ } else if (loaderName.equals("platform")) {
+ loader = PLATFORM_LOADER;
+ } else {
+ assertTrue(false);
+ }
+
+ if (shouldOverrideName.equals("true")) {
+ shouldOverride = true;
+ } else if (shouldOverrideName.equals("false")) {
+ shouldOverride = false;
+ } else {
+ assertTrue(false);
+ }
+
+ // Load the class with the default ClassLoader.
+ Class<?> clazz = Class.forName(className, true, loader);
+ // Make sure we got the expected defining ClassLoader
+ testLoader(clazz, loader);
+ // Create an instance and see what toString() returns
+ String s = clazz.newInstance().toString();
+ // The overridden version of the class should return "hi". Make sure
+ // it does only if we are expecting to have loaded the overridden version.
+ assertTrue(s.equals("hi") == shouldOverride);
+ }
+
+ /**
+ * Asserts that given class has the expected defining loader.
+ */
+ static void testLoader(Class<?> clazz, ClassLoader expected) {
+ ClassLoader loader = clazz.getClassLoader();
+ if (loader != expected) {
+ throw new RuntimeException(clazz + " loaded by " + loader + ", expected " + expected);
+ }
+ }
+
+ static void assertTrue(boolean expr) {
+ assertTrue(expr, "");
+ }
+
+ static void assertTrue(boolean expr, String msg) {
+ if (!expr)
+ throw new RuntimeException("assertion failed: " + msg);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jigsaw/overridetests/src/test/module-info.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,28 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+module test {
+ requires jdk.compiler;
+ requires java.activation;
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jvmti/ClassFileLoadHook.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,93 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import sun.hotspot.WhiteBox;
+
+class LoadMe {
+ static String getValue() {
+ return "beforeHook";
+ }
+ static String getOtherValue() {
+ return "abc-beforeHook-xyz";
+ }
+}
+
+public class ClassFileLoadHook {
+ public enum TestCaseId {
+ SHARING_OFF_CFLH_ON, // test case to establish a baseline
+ SHARING_ON_CFLH_OFF,
+ SHARING_AUTO_CFLH_ON,
+ SHARING_ON_CFLH_ON
+ }
+
+ public static void main(String args[]) {
+ TestCaseId testCase = TestCaseId.valueOf(args[0]);
+ WhiteBox wb = WhiteBox.getWhiteBox();
+
+ System.out.println("====== ClassFileLoadHook.main():testCase = " + testCase);
+ System.out.println("getValue():" + LoadMe.getValue());
+ System.out.println("getOtherValue():" + LoadMe.getOtherValue());
+
+ switch (testCase) {
+ case SHARING_OFF_CFLH_ON:
+ assertTrue("after_Hook".equals(LoadMe.getValue()) &&
+ "abc-after_Hook-xyz".equals(LoadMe.getOtherValue()),
+ "Not sharing, this test should replace beforeHook " +
+ "with after_Hook");
+ break;
+
+ case SHARING_ON_CFLH_OFF:
+ assertTrue(wb.isSharedClass(LoadMe.class),
+ "LoadMe should be shared, but is not");
+ assertTrue("beforeHook".equals(LoadMe.getValue()) &&
+ "abc-beforeHook-xyz".equals(LoadMe.getOtherValue()),
+ "CFLH off, bug values are redefined");
+ break;
+
+ case SHARING_AUTO_CFLH_ON:
+ case SHARING_ON_CFLH_ON:
+ // LoadMe is rewritten on CFLH
+ assertFalse(wb.isSharedClass(LoadMe.class),
+ "LoadMe should not be shared if CFLH has modified the class");
+ assertFalse("beforeHook".equals(LoadMe.getValue()) &&
+ "abc-beforeHook-xyz".equals(LoadMe.getOtherValue()),
+ "Class contents should be changed if CFLH is enabled");
+ break;
+
+ default:
+ throw new RuntimeException("Invalid testcase");
+
+ }
+ }
+
+ private static void assertTrue(boolean expr, String msg) {
+ if (!expr)
+ throw new RuntimeException(msg);
+ }
+
+ private static void assertFalse(boolean expr, String msg) {
+ if (expr)
+ throw new RuntimeException(msg);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jvmti/ClassFileLoadHookTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,100 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Test jvmti class file loader hook interaction with AppCDS
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @modules java.base/jdk.internal.misc
+ * jdk.jartool/sun.tools.jar
+ * java.management
+ * @build ClassFileLoadHook
+ * @run main/othervm/native ClassFileLoadHookTest
+ */
+
+
+import jdk.test.lib.Asserts;
+import jdk.test.lib.cds.CDSOptions;
+import jdk.test.lib.process.OutputAnalyzer;
+import jdk.test.lib.process.ProcessTools;
+
+
+public class ClassFileLoadHookTest {
+ public static String sharedClasses[] = {
+ "ClassFileLoadHook",
+ "ClassFileLoadHook$TestCaseId",
+ "ClassFileLoadHook$1",
+ "LoadMe"
+ };
+
+ public static void main(String[] args) throws Exception {
+ String wbJar =
+ ClassFileInstaller.writeJar("WhiteBox.jar", "sun.hotspot.WhiteBox");
+ String appJar =
+ ClassFileInstaller.writeJar("ClassFileLoadHook.jar", sharedClasses);
+ String useWb = "-Xbootclasspath/a:" + wbJar;
+
+ // First, run the test class directly, w/o sharing, as a baseline reference
+ ProcessBuilder pb = ProcessTools.createJavaProcessBuilder(
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+WhiteBoxAPI",
+ useWb,
+ "-agentlib:SimpleClassFileLoadHook=LoadMe,beforeHook,after_Hook",
+ "ClassFileLoadHook",
+ "" + ClassFileLoadHook.TestCaseId.SHARING_OFF_CFLH_ON);
+ TestCommon.executeAndLog(pb, "no-sharing").shouldHaveExitValue(0);
+
+ // Run with AppCDS, but w/o CFLH - second baseline
+ TestCommon.testDump(appJar, sharedClasses, useWb);
+ OutputAnalyzer out = TestCommon.exec(appJar,
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+WhiteBoxAPI", useWb,
+ "ClassFileLoadHook",
+ "" + ClassFileLoadHook.TestCaseId.SHARING_ON_CFLH_OFF);
+
+ TestCommon.checkExec(out);
+
+
+ // Now, run with AppCDS with -Xshare:auto and CFLH
+ out = TestCommon.execAuto("-cp", appJar,
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+WhiteBoxAPI", useWb,
+ "-agentlib:SimpleClassFileLoadHook=LoadMe,beforeHook,after_Hook",
+ "ClassFileLoadHook",
+ "" + ClassFileLoadHook.TestCaseId.SHARING_AUTO_CFLH_ON);
+
+ CDSOptions opts = (new CDSOptions()).setXShareMode("auto");
+ TestCommon.checkExec(out, opts);
+
+ // Now, run with AppCDS -Xshare:on and CFLH
+ out = TestCommon.exec(appJar,
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+WhiteBoxAPI", useWb,
+ "-agentlib:SimpleClassFileLoadHook=LoadMe,beforeHook,after_Hook",
+ "ClassFileLoadHook",
+ "" + ClassFileLoadHook.TestCaseId.SHARING_ON_CFLH_ON);
+ TestCommon.checkExec(out);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationAgent.mf Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,5 @@
+Manifest-Version: 1.0
+Premain-Class: InstrumentationRegisterClassFileTransformer
+Agent-Class: InstrumentationRegisterClassFileTransformer
+Can-Retransform-Classes: true
+Can-Redefine-Classes: true
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationApp.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,220 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.lang.instrument.ClassDefinition;
+import java.lang.instrument.Instrumentation;
+import java.lang.instrument.UnmodifiableClassException;
+import java.net.URL;
+import java.net.URLClassLoader;
+import java.io.File;
+import java.security.CodeSigner;
+import java.security.CodeSource;
+import java.security.ProtectionDomain;
+import sun.hotspot.WhiteBox;
+
+public class InstrumentationApp {
+ static WhiteBox wb = WhiteBox.getWhiteBox();
+
+ public static final String COO_CLASS_NAME = "InstrumentationApp$Coo";
+
+ public static interface Intf { // Loaded from Boot class loader (-Xbootclasspath/a).
+ public String get();
+ }
+ public static class Bar implements Intf { // Loaded from Boot class loader.
+ public String get() {
+ // The initial transform:
+ // change "buzz" -> "fuzz"
+ // The re-transform:
+ // change "buzz" -> "guzz"
+ return "buzz";
+ }
+ }
+ public static class Foo implements Intf { // Loaded from AppClassLoader, or from a custom loader
+ public String get() {
+ // The initial transform:
+ // change "buzz" -> "fuzz"
+ // The re-transform:
+ // change "buzz" -> "guzz"
+ return "buzz";
+ }
+ }
+ public static class Coo implements Intf { // Loaded from custom class loader.
+ public String get() {
+ // The initial transform:
+ // change "buzz" -> "fuzz"
+ // The re-transform:
+ // change "buzz" -> "guzz"
+ return "buzz";
+ }
+ }
+
+ // This class file should be archived if AppCDSv2 is enabled on this platform. See
+ // the comments around the call to TestCommon.dump in InstrumentationTest.java.
+ public static class ArchivedIfAppCDSv2Enabled {}
+
+ public static boolean isAppCDSV2Enabled() {
+ return wb.isSharedClass(ArchivedIfAppCDSv2Enabled.class);
+ }
+
+ public static class MyLoader extends URLClassLoader {
+ public MyLoader(URL[] urls, ClassLoader parent, File jar) {
+ super(urls, parent);
+ this.jar = jar;
+ }
+ File jar;
+
+ @Override
+ protected Class<?> loadClass(String name, boolean resolve) throws ClassNotFoundException {
+ synchronized (getClassLoadingLock(name)) {
+ // First, check if the class has already been loaded
+ Class<?> clz = findLoadedClass(name);
+ if (clz != null) {
+ return clz;
+ }
+
+ if (name.equals(COO_CLASS_NAME)) {
+ try {
+ byte[] buff = Util.getClassFileFromJar(jar, name);
+ return defineClass(name, buff, 0, buff.length);
+ } catch (Throwable t) {
+ t.printStackTrace();
+ throw new RuntimeException("Unexpected", t);
+ }
+ }
+ }
+ return super.loadClass(name, resolve);
+ }
+ }
+
+ static int numTests = 0;
+ static int failed = 0;
+ static boolean isAttachingAgent = false;
+ static Instrumentation instrumentation;
+
+ public static void main(String args[]) throws Throwable {
+ System.out.println("INFO: AppCDSv1 " + (wb.isSharedClass(InstrumentationApp.class) ? "enabled" :"disabled"));
+ System.out.println("INFO: AppCDSv2 " + (isAppCDSV2Enabled() ? "enabled" : "disabled"));
+
+ File bootJar = new File(args[0]);
+ File appJar = new File(args[1]);
+ File custJar = new File(args[2]);
+ String flagFile = args[3];
+ waitAttach(flagFile);
+
+ instrumentation = InstrumentationRegisterClassFileTransformer.getInstrumentation();
+ System.out.println("INFO: instrumentation = " + instrumentation);
+
+ testBootstrapCDS("Bootstrap Loader", bootJar);
+ testAppCDSv1("Application Loader", appJar);
+
+ if (isAppCDSV2Enabled()) {
+ testAppCDSv2("Custom Loader (unregistered)", custJar);
+ }
+
+ if (failed > 0) {
+ throw new RuntimeException("FINAL RESULT: " + failed + " out of " + numTests + " test case(s) have failed");
+ } else {
+ System.out.println("FINAL RESULT: All " + numTests + " test case(s) have passed!");
+ }
+ }
+
+ static void waitAttach(String flagFile) throws Throwable {
+ if (!flagFile.equals("noattach")) {
+ File f = new File(flagFile);
+ long start = System.currentTimeMillis();
+ while (f.exists()) {
+ long elapsed = System.currentTimeMillis() - start;
+ System.out.println(".... (" + elapsed + ") waiting for deletion of " + f);
+ Thread.sleep(1000);
+ }
+ System.out.println("Attach succeeded (child)");
+ isAttachingAgent = true;
+ }
+ }
+
+ static void testBootstrapCDS(String group, File jar) throws Throwable {
+ doTest(group, new Bar(), jar);
+ }
+
+ static void testAppCDSv1(String group, File jar) throws Throwable {
+ doTest(group, new Foo(), jar);
+ }
+
+ static void testAppCDSv2(String group, File jar) throws Throwable {
+ URL[] urls = new URL[] {jar.toURI().toURL()};
+ MyLoader loader = new MyLoader(urls, InstrumentationApp.class.getClassLoader(), jar);
+ Class klass = loader.loadClass(COO_CLASS_NAME);
+ doTest(group, (Intf)klass.newInstance(), jar);
+ }
+
+ static void doTest(String group, Intf object, File jar) throws Throwable {
+ Class klass = object.getClass();
+ System.out.println();
+ System.out.println("++++++++++++++++++++++++++");
+ System.out.println("Test group: " + group);
+ System.out.println("Testing with classloader = " + klass.getClassLoader());
+ System.out.println("Testing with class = " + klass);
+ System.out.println("++++++++++++++++++++++++++");
+
+ // Initial transform
+ String f = object.get();
+ assertTrue(f.equals("fuzz"), "object.get(): Initial transform should give 'fuzz'", f);
+
+ // Retransform
+ f = "(failed)";
+ try {
+ instrumentation.retransformClasses(klass);
+ f = object.get();
+ } catch (UnmodifiableClassException|UnsupportedOperationException e) {
+ e.printStackTrace();
+ }
+ assertTrue(f.equals("guzz"), "object.get(): retransformation should give 'guzz'", f);
+
+ // Redefine
+ byte[] buff = Util.getClassFileFromJar(jar, klass.getName());
+ Util.replace(buff, "buzz", "huzz");
+ f = "(failed)";
+ try {
+ instrumentation.redefineClasses(new ClassDefinition(klass, buff));
+ f = object.get();
+ } catch (UnmodifiableClassException|UnsupportedOperationException e) {
+ e.printStackTrace();
+ }
+ assertTrue(f.equals("quzz"), "object.get(): redefinition should give 'quzz'", f);
+
+ System.out.println("++++++++++++++++++++++++++++++++++++++++++++++++ (done)\n\n");
+ }
+
+ private static void assertTrue(boolean expr, String msg, String string) {
+ numTests ++;
+ System.out.printf("Test case %2d ", numTests);
+
+ if (expr) {
+ System.out.println("PASSED: " + msg + " and we got '" + string + "'");
+ } else {
+ failed ++;
+ System.out.println("FAILED: " + msg + " but we got '" + string + "'");
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationClassFileTransformer.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,57 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.lang.instrument.ClassFileTransformer;
+import java.lang.instrument.IllegalClassFormatException;
+import java.security.ProtectionDomain;
+
+// Note: Util is from /test/hotspot/jtreg/runtime/appcds/test-classes/TestCommon.java
+
+public class InstrumentationClassFileTransformer implements ClassFileTransformer {
+ public byte[] transform(ClassLoader loader, String name, Class<?> classBeingRedefined,
+ ProtectionDomain pd, byte[] buffer) throws IllegalClassFormatException {
+
+ if (name.startsWith("InstrumentationApp$") && !name.equals("InstrumentationApp$NotTransformed")) {
+ System.out.println("Transforming: " + name + " class = " + classBeingRedefined);
+ try {
+ if (classBeingRedefined == null) {
+ // Initial transform
+ replace(buffer, "buzz", "fuzz");
+ } else {
+ replace(buffer, "buzz", "guzz"); // Retransform
+ replace(buffer, "huzz", "quzz"); // Redefine
+ }
+ } catch (Throwable t) {
+ t.printStackTrace();
+ }
+ return buffer;
+ }
+ return null;
+ }
+
+ static void replace(byte[] buffer, String from, String to) {
+ int n = Util.replace(buffer, from, to);
+ System.out.println("..... replaced " + n + " occurrence(s) of '" + from + "' to '" + to + "'");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationRegisterClassFileTransformer.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,45 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.lang.instrument.ClassFileTransformer;
+import java.lang.instrument.Instrumentation;
+
+// This class is available on the classpath so it can be accessed by InstrumentationApp
+public class InstrumentationRegisterClassFileTransformer {
+ private static Instrumentation savedInstrumentation;
+
+ public static void premain(String agentArguments, Instrumentation instrumentation) {
+ System.out.println("InstrumentationRegisterClassFileTransformer.premain() is called");
+ instrumentation.addTransformer(new InstrumentationClassFileTransformer(), /*canRetransform=*/true);
+ savedInstrumentation = instrumentation;
+ }
+
+ public static Instrumentation getInstrumentation() {
+ return savedInstrumentation;
+ }
+
+ public static void agentmain(String args, Instrumentation inst) throws Exception {
+ premain(args, inst);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jvmti/InstrumentationTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,278 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Exercise the java.lang.instrument.Instrumentation APIs on classes archived
+ * using CDS/AppCDSv1/AppCDSv2.
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds /test/hotspot/jtreg/runtime/appcds/test-classes
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires vm.flavor != "minimal"
+ * @modules java.base/jdk.internal.misc
+ * jdk.jartool/sun.tools.jar
+ * java.management
+ * @build sun.hotspot.WhiteBox
+ * InstrumentationApp
+ * InstrumentationClassFileTransformer
+ * InstrumentationRegisterClassFileTransformer
+ * @run main/othervm InstrumentationTest
+ */
+
+// Note: TestCommon is from /test/hotspot/jtreg/runtime/appcds/TestCommon.java
+// Note: Util is from /test/hotspot/jtreg/runtime/appcds/test-classes/TestCommon.java
+
+import com.sun.tools.attach.VirtualMachine;
+import com.sun.tools.attach.VirtualMachineDescriptor;
+import java.io.File;
+import java.io.FileOutputStream;
+import java.util.List;
+import jdk.test.lib.Asserts;
+import jdk.test.lib.cds.CDSOptions;
+import jdk.test.lib.process.OutputAnalyzer;
+import jdk.test.lib.process.ProcessTools;
+
+public class InstrumentationTest {
+ public static String bootClasses[] = {
+ "InstrumentationApp$Intf",
+ "InstrumentationApp$Bar",
+ "sun.hotspot.WhiteBox",
+ };
+ public static String appClasses[] = {
+ "InstrumentationApp",
+ "InstrumentationApp$Foo",
+ "InstrumentationApp$MyLoader",
+ };
+ public static String custClasses[] = {
+ "InstrumentationApp$Coo",
+ };
+ public static String sharedClasses[] = TestCommon.concat(bootClasses, appClasses);
+
+ public static String agentClasses[] = {
+ "InstrumentationClassFileTransformer",
+ "InstrumentationRegisterClassFileTransformer",
+ "Util",
+ };
+
+ public static void main(String[] args) throws Throwable {
+ runTest(false);
+ runTest(true);
+ }
+
+ public static void runTest(boolean attachAgent) throws Throwable {
+ String bootJar =
+ ClassFileInstaller.writeJar("InstrumentationBoot.jar", bootClasses);
+ String appJar =
+ ClassFileInstaller.writeJar("InstrumentationApp.jar",
+ TestCommon.concat(appClasses,
+ "InstrumentationApp$ArchivedIfAppCDSv2Enabled"));
+ String custJar =
+ ClassFileInstaller.writeJar("InstrumentationCust.jar", custClasses);
+ String agentJar =
+ ClassFileInstaller.writeJar("InstrumentationAgent.jar",
+ ClassFileInstaller.Manifest.fromSourceFile("InstrumentationAgent.mf"),
+ agentClasses);
+
+ String bootCP = "-Xbootclasspath/a:" + bootJar;
+
+ System.out.println("");
+ System.out.println("============================================================");
+ System.out.println("CDS: NO, attachAgent: " + (attachAgent ? "YES" : "NO"));
+ System.out.println("============================================================");
+ System.out.println("");
+
+ String agentCmdArg, flagFile;
+ if (attachAgent) {
+ // we will attach the agent, so don't specify -javaagent in the command line. We'll use
+ // something harmless like -showversion to make it easier to construct the command line
+ agentCmdArg = "-showversion";
+ } else {
+ agentCmdArg = "-javaagent:" + agentJar;
+ }
+
+ // First, run the test class directly, w/o sharing, as a baseline reference
+ flagFile = getFlagFile(attachAgent);
+ AgentAttachThread t = doAttach(attachAgent, flagFile, agentJar);
+ ProcessBuilder pb = ProcessTools.createJavaProcessBuilder(
+ bootCP,
+ "-cp", appJar,
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+WhiteBoxAPI",
+ "-Xshare:off",
+ agentCmdArg,
+ "InstrumentationApp", bootJar, appJar, custJar, flagFile);
+ TestCommon.executeAndLog(pb, "no-sharing").shouldHaveExitValue(0);
+ checkAttach(t);
+
+ // Dump the AppCDS archive. On some platforms AppCDSv2 may not be enabled, so we
+ // first try the v2 classlist, and if that fails, revert to the v1 classlist.
+ // Note that the InstrumentationApp$ArchivedIfAppCDSv2Enabled class is archived
+ // only if V2 is enabled. This is tested by InstrumentationApp.isAppCDSV2Enabled().
+ String[] v2Classes = {
+ "InstrumentationApp$ArchivedIfAppCDSv2Enabled",
+ "java/lang/Object id: 0",
+ "InstrumentationApp$Intf id: 1",
+ "InstrumentationApp$Coo id: 2 super: 0 interfaces: 1 source: " + custJar,
+ };
+ String[] sharedClassesWithV2 = TestCommon.concat(v2Classes, sharedClasses);
+ OutputAnalyzer out = TestCommon.dump(appJar, sharedClassesWithV2, bootCP);
+ if (out.getExitValue() != 0) {
+ System.out.println("Redumping with AppCDSv2 disabled");
+ TestCommon.testDump(appJar, sharedClasses, bootCP);
+ }
+
+ // Run with AppCDS.
+ System.out.println("");
+ System.out.println("============================================================");
+ System.out.println("CDS: YES, attachAgent: " + (attachAgent ? "YES" : "NO"));
+ System.out.println("============================================================");
+ System.out.println("");
+
+ flagFile = getFlagFile(attachAgent);
+ t = doAttach(attachAgent, flagFile, agentJar);
+ out = TestCommon.execAuto("-cp", appJar,
+ bootCP,
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+WhiteBoxAPI",
+ agentCmdArg,
+ "InstrumentationApp", bootJar, appJar, custJar, flagFile);
+
+ CDSOptions opts = (new CDSOptions()).setXShareMode("auto");
+ TestCommon.checkExec(out, opts);
+ checkAttach(t);
+ }
+
+ static int flagFileSerial = 1;
+ static private String getFlagFile(boolean attachAgent) {
+ if (attachAgent) {
+ // Do not reuse the same file name as Windows may fail to
+ // delete the file.
+ return "attach.flag." + ProcessHandle.current().pid() +
+ "." + (flagFileSerial++) + "." + System.currentTimeMillis();
+ } else {
+ return "noattach";
+ }
+ }
+
+ static AgentAttachThread doAttach(boolean attachAgent, String flagFile, String agentJar) throws Throwable {
+ if (!attachAgent) {
+ return null;
+ }
+
+ // We use the flagFile to prevent the child process to make progress, until we have
+ // attached to it.
+ File f = new File(flagFile);
+ FileOutputStream o = new FileOutputStream(f);
+ o.write(1);
+ o.close();
+ if (!f.exists()) {
+ throw new RuntimeException("Failed to create " + f);
+ }
+
+ // At this point, the child process is not yet launched. Note that
+ // TestCommon.exec() and OutputAnalyzer.OutputAnalyzer() both block
+ // until the child process has finished.
+ //
+ // So, we will launch a AgentAttachThread which will poll the system
+ // until the child process is launched, and then do the attachment.
+ // The child process is uniquely identified by having flagFile in its
+ // command-line -- see AgentAttachThread.getPid().
+ AgentAttachThread t = new AgentAttachThread(flagFile, agentJar);
+ t.start();
+ return t;
+ }
+
+ static void checkAttach(AgentAttachThread thread) throws Throwable {
+ if (thread != null) {
+ thread.check();
+ }
+ }
+
+ static class AgentAttachThread extends Thread {
+ String flagFile;
+ String agentJar;
+ volatile boolean succeeded;
+
+ AgentAttachThread(String flagFile, String agentJar) {
+ this.flagFile = flagFile;
+ this.agentJar = agentJar;
+ this.succeeded = false;
+ }
+
+ static String getPid(String flagFile) throws Throwable {
+ while (true) {
+ // Keep polling until the child process has been launched. If for some
+ // reason the child process fails to launch, this test will be terminated
+ // by JTREG's time-out mechanism.
+ Thread.sleep(100);
+ List<VirtualMachineDescriptor> vmds = VirtualMachine.list();
+ for (VirtualMachineDescriptor vmd : vmds) {
+ if (vmd.displayName().contains(flagFile) && vmd.displayName().contains("InstrumentationApp")) {
+ // We use flagFile (which has the PID of this process) as a unique identifier
+ // to ident the child process, which we want to attach to.
+ System.out.println("Process found: " + vmd.id() + " " + vmd.displayName());
+ return vmd.id();
+ }
+ }
+ }
+ }
+
+ public void run() {
+ try {
+ String pid = getPid(flagFile);
+ VirtualMachine vm = VirtualMachine.attach(pid);
+ System.out.println(agentJar);
+ vm.loadAgent(agentJar);
+ } catch (Throwable t) {
+ t.printStackTrace();
+ throw new RuntimeException(t);
+ }
+
+ // Delete the flagFile to indicate to the child process that we
+ // have attached to it, so it should proceed.
+ File f = new File(flagFile);
+ for (int i=0; i<5; i++) {
+ // The detele may fail on Windows if the child JVM is checking
+ // f.exists() at exactly the same time?? Let's do a little
+ // dance.
+ f.delete();
+ try {
+ Thread.sleep(10);
+ } catch (Throwable t) {;}
+ }
+ if (f.exists()) {
+ throw new RuntimeException("Failed to delete " + f);
+ }
+ System.out.println("Attach succeeded (parent)");
+ succeeded = true;
+ }
+
+ void check() throws Throwable {
+ super.join();
+ if (!succeeded) {
+ throw new RuntimeException("Attaching agent to child VM failed");
+ }
+ }
+ }
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jvmti/parallelLoad/ParallelClassesTransform.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,70 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+class ParallelClassTr0 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr1 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr2 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr3 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr4 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr5 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr6 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr7 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr8 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr9 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr10 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr11 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr12 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr13 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr14 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr15 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr16 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr17 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr18 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr19 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr20 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr21 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr22 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr23 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr24 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr25 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr26 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr27 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr28 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr29 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr30 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr31 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr32 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr33 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr34 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr35 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr36 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr37 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr38 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+class ParallelClassTr39 { public static String testString = ParallelClassesTransform.BEFORE_PATTERN; }
+
+class ParallelClassesTransform {
+ public static final int NUMBER_OF_CLASSES = 40;
+ public static final String BEFORE_PATTERN = "class-transform-check: this-should-be-transformed";
+ public static final String AFTER_PATTERN = "class-transform-check: this-has-been--transformed";
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jvmti/parallelLoad/ParallelLoadAndTransformTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,88 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Load app classes from CDS archive in parallel threads,
+ * use initial transformation (CFLH)
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * /test/hotspot/jtreg/runtime/appcds/test-classes /test/hotspot/jtreg/runtime/appcds/jvmti
+ * /test/hotspot/jtreg/testlibrary/jvmti
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @modules java.base/jdk.internal.misc
+ * java.management
+ * jdk.jartool/sun.tools.jar
+ * java.instrument
+ * @build TransformUtil TransformerAgent ParallelLoad
+ * @run main ParallelLoadAndTransformTest
+ */
+import java.util.List;
+import java.util.stream.Collectors;
+import java.util.stream.IntStream;
+
+public class ParallelLoadAndTransformTest {
+
+ public static void main(String[] args) throws Exception {
+ String prop = "-Dappcds.parallel.transform.mode=cflh";
+ String appJar = ClassFileInstaller.writeJar("parallel_load.jar",
+ getClassList(true));
+ String agentJar = prepareAgent();
+
+ TestCommon.test(appJar, getClassList(false),
+ "-javaagent:" + agentJar + "=ParallelClassTr.*",
+ prop, "ParallelLoad");
+ }
+
+
+ private static String[] getClassList(boolean includeWatchdog) {
+ List<String> classList =
+ IntStream.range(0, ParallelClassesTransform.NUMBER_OF_CLASSES)
+ .mapToObj(i -> "ParallelClassTr" + i)
+ .collect(Collectors.toList());
+
+ classList.add("ParallelLoad");
+ classList.add("ParallelLoadThread");
+ if (includeWatchdog)
+ classList.add("ParallelLoadWatchdog");
+
+ return classList.toArray(new String[0]);
+ }
+
+
+ // Agent is the same for all test cases
+ private static String prepareAgent() throws Exception {
+ String agentClasses[] = {
+ "TransformerAgent",
+ "TransformerAgent$SimpleTransformer",
+ "TransformUtil"
+ };
+
+ String manifest = "../../../../testlibrary/jvmti/TransformerAgent.mf";
+
+ return ClassFileInstaller.writeJar("TransformerAgent.jar",
+ ClassFileInstaller.Manifest.fromSourceFile(manifest),
+ agentClasses);
+ }
+
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jvmti/transformRelatedClasses/TransformInterfaceImplementorAppCDS.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,43 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Exercise initial transformation (class file loader hook)
+ * with CDS/AppCDS with Interface/Implementor pair
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds /test/hotspot/jtreg/runtime/appcds/test-classes
+ * /test/hotspot/jtreg/runtime/appcds/jvmti /test/hotspot/jtreg/runtime/SharedArchiveFile/serviceability
+ * /test/hotspot/jtreg/runtime/SharedArchiveFile/serviceability/transformRelatedClasses
+ * /test/hotspot/jtreg/runtime/SharedArchiveFile /test/hotspot/jtreg/testlibrary/jvmti
+ * /test/hotspot/jtreg/runtime/appcds/customLoader
+ * /test/hotspot/jtreg/runtime/appcds/customLoader/test-classes
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires vm.flavor != "minimal"
+ * @modules java.base/jdk.internal.misc
+ * jdk.jartool/sun.tools.jar
+ * java.management
+ * java.instrument
+ * @build TransformUtil TransformerAgent Interface Implementor
+ * @run main/othervm TransformRelatedClassesAppCDS Interface Implementor
+ */
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jvmti/transformRelatedClasses/TransformRelatedClassesAppCDS.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,204 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+// Structure of the test:
+// TransformRelatedClassesAppCDS -- common main test driver
+// Invoked from test driver classes:
+// TransformInterfaceAndImplementor, TransformSuperAndSubClasses.java
+// prepares test artifacts, launches tests, checks results
+// SuperClazz, SubClass -- classes under test
+// Interface, Implementor -- classes under test
+// TransformerAgent -- an agent that is used when JVM-under-test is executed
+// to transform specific strings inside specified classes
+// TransformerAgent.mf - accompanies transformer agent
+// CustomLoaderApp -- a test "application" that is used to load
+// classes-under-test (Parent, Child) via custom class loader, using
+// AppCDS-v2 mechanism (unregistered custom loaders, aka FP)
+// This "app" is launched in a child process by this driver with sharing on.
+
+import java.io.File;
+import java.util.ArrayList;
+import jdk.test.lib.process.OutputAnalyzer;
+
+// This class is intended to test 2 parent-child relationships:
+// 1. Base Class (parent) and Derived Class (child)
+// 2. Interface (parent) and Implementor (child)
+// Parameters to main(): parent, child
+
+public class TransformRelatedClassesAppCDS extends TransformRelatedClasses {
+ private static void log(String msg, Object... args) {
+ String msg0 = String.format(msg, args);
+ System.out.println("TransformRelatedClassesAppCDS: " + msg0);
+ }
+
+ // Initial Test Matrix:
+ // (ParentTransformed = true/false, ChildTransformed = true/false) x
+ // (BootCDS - see open tests, AppCDS-v1, AppCDS-v2-unregistered)
+ // Total cases: 2 x 4 = 8
+ public static void main(String args[]) throws Exception {
+ TransformRelatedClassesAppCDS test =
+ new TransformRelatedClassesAppCDS(args[0], args[1]);
+
+ test.prepareAgent(agentClasses);
+
+ // Test Table
+ // testCaseId | transformParent | tranformChild | isParentExpectedShared | isChildExpectedShared
+ ArrayList<TestEntry> testTable = new ArrayList<>();
+
+ // base case - no tranformation - all expected to be shared
+ testTable.add(new TestEntry(0, false, false, true, true));
+
+ // transform parent only - both parent and child should not be shared
+ testTable.add(new TestEntry(1, true, false, false, false));
+
+ // transform parent and child - both parent and child should not be shared
+ testTable.add(new TestEntry(2, true, true, false, false));
+
+ // transform child only - parent should still be shared, but not child
+ testTable.add(new TestEntry(3, false, true, true, false));
+
+ // run the tests
+ test.runWithAppLoader(testTable);
+ test.runWithCustomLoader(testTable);
+ }
+
+
+ public TransformRelatedClassesAppCDS(String parent, String child) {
+ super(parent, child);
+
+ // a trick to get it compiled by jtreg
+ CustomLoaderApp.ping();
+ }
+
+
+ private void prepareAgent(String[] agentClasses) throws Exception {
+ String manifest = "../../../../testlibrary/jvmti/TransformerAgent.mf";
+ agentJar = ClassFileInstaller.writeJar("TransformerAgent.jar",
+ ClassFileInstaller.Manifest.fromSourceFile(manifest),
+ agentClasses);
+ }
+
+
+ private void runWithAppLoader(ArrayList<TestEntry> testTable) throws Exception {
+ String appJar = writeJar("app", testClasses);
+
+ // create an archive
+ OutputAnalyzer out = TestCommon.dump(appJar, testClasses);
+ TestCommon.checkDump(out);
+
+ // execute with archive
+ for (TestEntry entry : testTable) {
+ log("runTestWithAppLoader(): testCaseId = %d", entry.testCaseId);
+ String params = TransformTestCommon.getAgentParams(entry, parent, child);
+ String agentParam = String.format("-javaagent:%s=%s", agentJar, params);
+ out = TestCommon.execCommon("-Xlog:class+load=info", "-cp", appJar,
+ agentParam, child);
+
+ TransformTestCommon.checkResults(entry, out, parent, child);
+ }
+ }
+
+
+ private String[] getCustomClassList(String loaderType, String customJar) {
+ String type = child + "-" + loaderType;
+
+ switch (type) {
+
+ case "SubClass-unregistered":
+ return new String[] {
+ "CustomLoaderApp",
+ "java/lang/Object id: 0",
+ parent + " id: 1 super: 0 source: " + customJar,
+ child + " id: 2 super: 1 source: " + customJar,
+ };
+
+ case "Implementor-unregistered":
+ return new String[] {
+ "CustomLoaderApp",
+ "java/lang/Object id: 0",
+ parent + " id: 1 super: 0 source: " + customJar,
+ child + " id: 2 super: 0 interfaces: 1 source: " + customJar,
+ };
+
+ default:
+ throw new IllegalArgumentException("getCustomClassList - wrong type: " + type);
+ }
+ }
+
+
+ private void runWithCustomLoader(ArrayList<TestEntry> testTable) throws Exception {
+ if (!TestCommon.isCustomLoaderSupported()) {
+ log("custom loader not supported for this platform" +
+ " - skipping test case for custom loader");
+ return;
+ }
+
+ String appClasses[] = {
+ "CustomLoaderApp",
+ };
+
+ String customClasses[] = { parent, child };
+
+ // create jar files: appJar, customJar (for custom loaders to load classes from)
+ String appJar = writeJar("custldr-app", appClasses);
+ String customJar = writeJar("custldr-custom", customClasses);
+
+ for (TestEntry entry : testTable) {
+ log("runTestWithCustomLoader(): testCaseId = %d", entry.testCaseId);
+ // unregistered (aka FP) case
+ String[] classList = getCustomClassList("unregistered",customJar);
+ execAndCheckWithCustomLoader(entry, "unregistered", classList,
+ appJar, agentJar, customJar);
+ }
+ }
+
+
+ private void
+ execAndCheckWithCustomLoader(TestEntry entry, String loaderType,
+ String[] classList, String appJar,
+ String agentJar, String customJar)
+ throws Exception {
+
+ OutputAnalyzer out = TestCommon.dump(appJar, classList);
+ TestCommon.checkDump(out);
+
+ String agentParam = "-javaagent:" + agentJar + "=" +
+ TransformTestCommon.getAgentParams(entry, parent, child);
+
+ out = TestCommon.execCommon("-Xlog:class+load=info",
+ "-cp", appJar,
+ "--add-opens=java.base/java.security=ALL-UNNAMED",
+ agentParam,
+ "CustomLoaderApp",
+ customJar, loaderType, child);
+ TransformTestCommon.checkResults(entry, out, parent, child);
+ }
+
+
+ private String writeJar(String type, String[] classes)
+ throws Exception {
+ String jarName = String.format("%s-%s.jar", child, type);
+ return ClassFileInstaller.writeJar(jarName, classes);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/jvmti/transformRelatedClasses/TransformSuperSubAppCDS.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,43 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Exercise initial transformation (class file loader hook)
+ * with CDS/AppCDS with SubClass and SuperClass
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds /test/hotspot/jtreg/runtime/appcds/test-classes
+ * /test/hotspot/jtreg/runtime/appcds/jvmti /test/hotspot/jtreg/runtime/SharedArchiveFile/serviceability
+ * /test/hotspot/jtreg/runtime/SharedArchiveFile/serviceability/transformRelatedClasses
+ * /test/hotspot/jtreg/runtime/SharedArchiveFile /test/hotspot/jtreg/testlibrary/jvmti
+ * /test/hotspot/jtreg/runtime/appcds/customLoader
+ * /test/hotspot/jtreg/runtime/appcds/customLoader/test-classes
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires vm.flavor != "minimal"
+ * @modules java.base/jdk.internal.misc
+ * jdk.jartool/sun.tools.jar
+ * java.management
+ * java.instrument
+ * @build TransformUtil TransformerAgent SubClass SuperClazz
+ * @run main/othervm TransformRelatedClassesAppCDS SuperClazz SubClass
+ */
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/redefineClass/RedefineBasic.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,105 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import sun.hotspot.WhiteBox;
+
+public class RedefineBasic {
+
+ public static String newB =
+ " class RedefineBasic$B { " +
+ " public static void okToCallBeforeRedefine() { " +
+ " throw new RuntimeException(\"newB: okToCallBeforeRedefine is " +
+ " called after redefinition, test failed\"); }" +
+ " public static void okToCallAfterRedefine() { " +
+ " System.out.println(\"newB: okToCallAfterRedefine\"); } " +
+ " } ";
+
+
+ static class B {
+ public static void okToCallBeforeRedefine() {
+ System.out.println("okToCallBeforeRedefine");
+ }
+ public static void okToCallAfterRedefine() {
+ throw new RuntimeException(
+ "okToCallAfterRedefine is called before redefinition, test failed");
+ }
+ }
+
+ static class SubclassOfB extends B {
+ public static void testAfterRedefine() {
+ B.okToCallAfterRedefine();
+ }
+ }
+
+ class Subclass2OfB extends B {
+ public void testAfterRedefine() {
+ super.okToCallAfterRedefine();
+ }
+ }
+
+ // verify that a given class is shared, report error if necessary
+ public static void
+ verifyClassIsShared(WhiteBox wb, Class c) throws Exception {
+ if (!wb.isSharedClass(c)) {
+ throw new RuntimeException(
+ "This class should be shared but isn't: " + c.getName());
+ } else {
+ System.out.println("The class is shared as expected: " +
+ c.getName());
+ }
+ }
+
+ public static void main(String[] args) throws Exception {
+ WhiteBox wb = WhiteBox.getWhiteBox();
+
+ verifyClassIsShared(wb, RedefineBasic.class);
+ verifyClassIsShared(wb, B.class);
+ verifyClassIsShared(wb, SubclassOfB.class);
+ verifyClassIsShared(wb, Subclass2OfB.class);
+
+ // (1) Test case: verify that original B works as expected
+ // and that redefined B is shared and works as expected,
+ // with new behavior
+ B.okToCallBeforeRedefine();
+ RedefineClassHelper.redefineClass(B.class, newB);
+ verifyClassIsShared(wb, B.class);
+ B.okToCallAfterRedefine();
+
+ // Static subclass of the super:
+ // 1. Make sure it is still shared
+ // 2. and it calls the correct super (the redefined one)
+ verifyClassIsShared(wb, SubclassOfB.class);
+ SubclassOfB.testAfterRedefine();
+
+ // Same as above, but for non-static class
+ verifyClassIsShared(wb, Subclass2OfB.class);
+ RedefineBasic thisTest = new RedefineBasic();
+ thisTest.testSubclass2OfB();
+ }
+
+ public void testSubclass2OfB() {
+ Subclass2OfB sub = new Subclass2OfB();
+ sub.testAfterRedefine();
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/redefineClass/RedefineBasicTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,76 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Run /runtime/RedefineTests/RedefineRunningMethods in AppCDS mode to
+ * make sure class redefinition works with CDS.
+ * (Note: AppCDS does not support uncompressed oops)
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib /test/hotspot/jtreg/runtime/RedefineTests /test/hotspot/jtreg/runtime/appcds
+ * @modules java.compiler
+ * java.instrument
+ * jdk.jartool/sun.tools.jar
+ * java.base/jdk.internal.misc
+ * java.management
+ * @run main RedefineClassHelper
+ * @build sun.hotspot.WhiteBox RedefineBasic
+ * @run main RedefineBasicTest
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class RedefineBasicTest {
+ public static String sharedClasses[] = {
+ "RedefineBasic",
+ "RedefineBasic$B",
+ "RedefineBasic$SubclassOfB",
+ "RedefineBasic$Subclass2OfB",
+ "RedefineClassHelper",
+ "jdk/test/lib/compiler/InMemoryJavaCompiler",
+ "jdk/test/lib/compiler/InMemoryJavaCompiler$FileManagerWrapper",
+ "jdk/test/lib/compiler/InMemoryJavaCompiler$FileManagerWrapper$1",
+ "jdk/test/lib/compiler/InMemoryJavaCompiler$MemoryJavaFileObject"
+ };
+
+ public static void main(String[] args) throws Exception {
+ String wbJar =
+ ClassFileInstaller.writeJar("WhiteBox.jar", "sun.hotspot.WhiteBox");
+ String appJar =
+ ClassFileInstaller.writeJar("RedefineBasic.jar", sharedClasses);
+ String useWb = "-Xbootclasspath/a:" + wbJar;
+
+ OutputAnalyzer output;
+ TestCommon.testDump(appJar, sharedClasses, useWb);
+
+ // redefineagent.jar is created by executing "@run main RedefineClassHelper"
+ // which should be called before executing RedefineBasicTest
+ output = TestCommon.exec(appJar, useWb,
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+WhiteBoxAPI",
+ "-javaagent:redefineagent.jar",
+ "RedefineBasic");
+ TestCommon.checkExec(output);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/redefineClass/RedefineRunningMethods_Shared.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,82 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Run /runtime/RedefineTests/RedefineRunningMethods in AppCDS mode to
+ * make sure class redefinition works with CDS.
+ * (Note: AppCDS does not support uncompressed oops)
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @library /test/lib /test/hotspot/jtreg/runtime/RedefineTests /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * @modules java.compiler
+ * java.instrument
+ * jdk.jartool/sun.tools.jar
+ * @run main RedefineClassHelper
+ * @build sun.hotspot.WhiteBox RedefineRunningMethods_SharedHelper
+ * @run main RedefineRunningMethods_Shared
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class RedefineRunningMethods_Shared {
+ public static String shared_classes[] = {
+ "RedefineRunningMethods_Shared",
+ "RedefineRunningMethods_SharedHelper",
+ "RedefineRunningMethods",
+ "RedefineRunningMethods$1",
+ "RedefineRunningMethods$2",
+ "RedefineRunningMethods$3",
+ "RedefineRunningMethods$B",
+ "RedefineClassHelper",
+ "jdk/test/lib/compiler/InMemoryJavaCompiler",
+ "jdk/test/lib/compiler/InMemoryJavaCompiler$FileManagerWrapper",
+ "jdk/test/lib/compiler/InMemoryJavaCompiler$FileManagerWrapper$1",
+ "jdk/test/lib/compiler/InMemoryJavaCompiler$MemoryJavaFileObject"
+ };
+
+ public static void main(String[] args) throws Exception {
+ String wbJar = ClassFileInstaller.writeJar("WhiteBox.jar", "sun.hotspot.WhiteBox");
+ String appJar = ClassFileInstaller.writeJar("RedefineRunningMethods_Shared.jar", shared_classes);
+ String use_whitebox_jar = "-Xbootclasspath/a:" + wbJar;
+
+ OutputAnalyzer output;
+ TestCommon.testDump(appJar, shared_classes,
+ // command-line arguments ...
+ use_whitebox_jar);
+
+ // RedefineRunningMethods.java contained this:
+ // @run main/othervm -javaagent:redefineagent.jar -Xlog:redefine+class+iklass+add=trace,redefine+class+iklass+purge=trace RedefineRunningMethods
+ output = TestCommon.exec(appJar,
+ // command-line arguments ...
+ use_whitebox_jar,
+ "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:+WhiteBoxAPI",
+ // These arguments are expected by RedefineRunningMethods
+ "-javaagent:redefineagent.jar",
+ "-Xlog:redefine+class+iklass+add=trace,redefine+class+iklass+purge=trace",
+ "RedefineRunningMethods_SharedHelper");
+ TestCommon.checkExec(output);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/redefineClass/RedefineRunningMethods_SharedHelper.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,49 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import sun.hotspot.WhiteBox;
+
+/**
+ * This class is executed by RedefineRunningMethods_Shared.java in
+ * a sub-process.
+ */
+public class RedefineRunningMethods_SharedHelper {
+ public static void main(String[] args) throws Exception {
+ // (1) Validate that all classes used by RedefineRunningMethods are all shared.
+ WhiteBox wb = WhiteBox.getWhiteBox();
+ for (String name : RedefineRunningMethods_Shared.shared_classes) {
+ name = name.replace('/', '.');
+ Class c = Class.forName(name);
+ if (!wb.isSharedClass(c)) {
+ throw new RuntimeException("Test set-up problem. " +
+ "This class should be shared but isn't: " + name);
+ } else {
+ System.out.println("The class is shared as expected: " + name);
+ }
+ }
+
+ // (2) Run the class redefinition test.
+ RedefineRunningMethods.main(args);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/ExerciseGC.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,49 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Exercise GC with shared strings
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires vm.gc.G1
+ * @requires (sun.arch.data.model != "32") & (os.family != "windows")
+ * @library /test/hotspot/jtreg/runtime/appcds /test/lib
+ * @modules java.base/jdk.internal.misc
+ * @modules java.management
+ * jdk.jartool/sun.tools.jar
+ * @build HelloStringGC sun.hotspot.WhiteBox
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @run main ExerciseGC
+ */
+public class ExerciseGC {
+ public static void main(String[] args) throws Exception {
+ SharedStringsUtils.buildJarAndWhiteBox("HelloStringGC");
+
+ SharedStringsUtils.dumpWithWhiteBox(TestCommon.list("HelloStringGC"),
+ "SharedStringsBasic.txt");
+
+ SharedStringsUtils.runWithArchiveAndWhiteBox("HelloStringGC",
+ "-XX:+UnlockDiagnosticVMOptions", "-XX:+VerifyBeforeGC");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/ExtraSharedInput.txt Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,7 @@
+VERSION: 1.0
+@SECTION: Symbol
+0 -1:
+41 -1: (Ljava/util/Set<TE;>;Ljava/lang/Object;)V
+11 -1: linkMethod
+18 -1: type can't be null
+20 -1: isAlphaNumericString
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/FlagCombo.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,58 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Test relevant combinations of command line flags with shared strings
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (sun.arch.data.model != "32") & (os.family != "windows")
+ * @requires (vm.gc=="null")
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * @modules java.management
+ * jdk.jartool/sun.tools.jar
+ * @build HelloString
+ * @run main FlagCombo
+ */
+
+import jdk.test.lib.BuildHelper;
+
+public class FlagCombo {
+ public static void main(String[] args) throws Exception {
+ SharedStringsUtils.buildJar("HelloString");
+
+ SharedStringsUtils.dump(TestCommon.list("HelloString"),
+ "SharedStringsBasic.txt");
+
+ SharedStringsUtils.runWithArchive("HelloString", "-XX:+UseG1GC");
+
+ if (BuildHelper.isCommercialBuild()) {
+ SharedStringsUtils.runWithArchiveAuto("HelloString", "-XX:+UnlockCommercialFeatures",
+ "-XX:StartFlightRecording=dumponexit=true");
+ }
+
+ SharedStringsUtils.runWithArchive("HelloString", "-XX:+UnlockDiagnosticVMOptions",
+ "-XX:NativeMemoryTracking=detail", "-XX:+PrintNMTStatistics");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/HelloString.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,32 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class HelloString {
+ public static void main(String args[]) {
+ // Let's reference the string that is in the archive
+ // Make sure the string below is in the shared string data file (string list)
+ String testString = "shared_test_string_unique_14325";
+ System.out.println("Hello String: " + testString);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/HelloStringGC.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,69 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import sun.hotspot.WhiteBox;
+
+public class HelloStringGC {
+ public static String[] array01 = new String[1000];
+ public static String[] array02 = new String[1000];
+
+ public static void main(String args[]) throws RuntimeException {
+ String testString1 = "shared_test_string_unique_14325";
+ String testString2 = "test123";
+
+ WhiteBox wb = WhiteBox.getWhiteBox();
+ if (!wb.isShared(testString1) && !wb.areSharedStringsIgnored()) {
+ throw new RuntimeException("testString1 is not shared");
+ }
+
+ for (int i=0; i<5; i++) {
+ allocSomeStrings(testString1, testString2);
+ array01 = null;
+ array02 = null;
+ System.gc();
+ sleep(300);
+ array01 = new String[1000];
+ array02 = new String[1000];
+ }
+
+ wb.fullGC();
+
+ System.out.println("HelloStringGC: PASS");
+ }
+
+ private static void allocSomeStrings(String s1, String s2) {
+ for (int i = 0; i < 1000; i ++) {
+ array01[i] = new String(s1);
+ array02[i] = new String(s2);
+ }
+ }
+
+ private static void sleep(int ms) {
+ try {
+ Thread.sleep(ms);
+ } catch (InterruptedException e) {
+ }
+ }
+
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/HelloStringPlus.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,76 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+// A test class to be launched in AppCDS mode, has basic+
+// coverage of string operations
+
+import sun.hotspot.WhiteBox;
+
+public class HelloStringPlus {
+ public static void main(String args[]) {
+ // Let's reference the string that is in archive
+ String testString1 = "shared_test_string_unique_14325";
+ System.out.println("Hello String: " + testString1);
+
+ WhiteBox wb = WhiteBox.getWhiteBox();
+ if (!wb.isShared(testString1) && !wb.areSharedStringsIgnored()) {
+ throw new RuntimeException("testString1 is not shared");
+ }
+
+ // Check other basic string operations
+ // Interning and equality
+ String[] testArray = new String[] {"shared_", "test_", "string_", "intern_", "12345"};
+ String toBeInterned = "";
+
+ StringBuilder sb = new StringBuilder();
+ for (String s : testArray) {
+ sb.append(s);
+ }
+ toBeInterned = sb.toString();
+
+ System.out.println("About to intern a string: " + toBeInterned);
+ toBeInterned.intern();
+
+ // check equality
+ if (testString1.equals(toBeInterned))
+ throw new RuntimeException("Equality test 1 failed");
+
+ if (!testString1.equals("shared_test_string" + '_' + "unique_14325"))
+ throw new RuntimeException("Equality test 2 failed");
+
+ // Chech the hash code functionality; no special assertions, just make sure
+ // no crashe or exception occurs
+ System.out.println("testString1.hashCode() = " + testString1.hashCode());
+
+ // Check intern() method for "" string
+ String empty = "";
+ String empty_interned = empty.intern();
+ if (wb.isShared(empty)) {
+ throw new RuntimeException("Empty string should not be shared");
+ }
+ if (empty_interned != empty) {
+ throw new RuntimeException("Different string is returned from intern() for empty string");
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/IncompatibleOptions.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,145 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Test options that are incompatible with use of shared strings
+ * Also test mismatch in oops encoding between dump time and run time
+ * Feature support: G1GC only, compressed oops/kptrs, 64-bit os, not on windows
+ * @requires (sun.arch.data.model != "32") & (os.family != "windows")
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires (vm.gc=="null")
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * @modules java.management
+ * jdk.jartool/sun.tools.jar
+ * @build HelloString
+ * @run main IncompatibleOptions
+ */
+
+import jdk.test.lib.Asserts;
+import jdk.test.lib.process.OutputAnalyzer;
+
+public class IncompatibleOptions {
+ static final String COOPS_DUMP_WARNING =
+ "Cannot dump shared archive when UseCompressedOops or UseCompressedClassPointers is off";
+ static final String COOPS_EXEC_WARNING =
+ "UseCompressedOops and UseCompressedClassPointers must be on for UseSharedSpaces";
+ static final String GC_WARNING =
+ "Archived java heap is not supported";
+ static final String OBJ_ALIGNMENT_MISMATCH =
+ "The shared archive file's ObjectAlignmentInBytes of .* does not equal the current ObjectAlignmentInBytes of";
+ static final String COMPACT_STRING_MISMATCH =
+ "The shared archive file's CompactStrings setting .* does not equal the current CompactStrings setting";
+
+ static String appJar;
+
+ public static void main(String[] args) throws Exception {
+ appJar = JarBuilder.build("IncompatibleOptions", "HelloString");
+
+ // Uncompressed OOPs
+ testDump(1, "-XX:+UseG1GC", "-XX:-UseCompressedOops", COOPS_DUMP_WARNING, true);
+
+ // incompatible GCs
+ testDump(2, "-XX:+UseParallelGC", "", GC_WARNING, false);
+ testDump(3, "-XX:+UseSerialGC", "", GC_WARNING, false);
+ testDump(4, "-XX:+UseConcMarkSweepGC", "", GC_WARNING, false);
+
+ // ======= archive with compressed oops, run w/o
+ testDump(5, "-XX:+UseG1GC", "-XX:+UseCompressedOops", null, false);
+ testExec(5, "-XX:+UseG1GC", "-XX:-UseCompressedOops",
+ COOPS_EXEC_WARNING, true);
+
+ // NOTE: No warning is displayed, by design
+ // Still run, to ensure no crash or exception
+ testExec(6, "-XX:+UseParallelGC", "", "", false);
+ testExec(7, "-XX:+UseSerialGC", "", "", false);
+ testExec(8, "-XX:+UseConcMarkSweepGC", "", "", false);
+
+ // Test various oops encodings, by varying ObjectAlignmentInBytes and heap sizes
+ testDump(9, "-XX:+UseG1GC", "-XX:ObjectAlignmentInBytes=8", null, false);
+ testExec(9, "-XX:+UseG1GC", "-XX:ObjectAlignmentInBytes=16",
+ OBJ_ALIGNMENT_MISMATCH, true);
+
+ // See JDK-8081416 - Oops encoding mismatch with shared strings
+ // produces unclear or incorrect warning
+ // Correct the test case once the above is fixed
+ // @ignore JDK-8081416 - for tracking purposes
+ // for now, run test as is until the proper behavior is determined
+ testDump(10, "-XX:+UseG1GC", "-Xmx1g", null, false);
+ testExec(10, "-XX:+UseG1GC", "-Xmx32g", null, true);
+
+ // CompactStrings must match between dump time and run time
+ testDump(11, "-XX:+UseG1GC", "-XX:-CompactStrings", null, false);
+ testExec(11, "-XX:+UseG1GC", "-XX:+CompactStrings",
+ COMPACT_STRING_MISMATCH, true);
+ testDump(12, "-XX:+UseG1GC", "-XX:+CompactStrings", null, false);
+ testExec(12, "-XX:+UseG1GC", "-XX:-CompactStrings",
+ COMPACT_STRING_MISMATCH, true);
+ }
+
+ static void testDump(int testCaseNr, String collectorOption, String extraOption,
+ String expectedWarning, boolean expectedToFail) throws Exception {
+
+ System.out.println("Testcase: " + testCaseNr);
+ OutputAnalyzer output = TestCommon.dump(appJar, TestCommon.list("Hello"),
+ "-XX:+UseCompressedOops",
+ collectorOption,
+ "-XX:SharedArchiveConfigFile=" + TestCommon.getSourceFile("SharedStringsBasic.txt"),
+ extraOption);
+
+ if (expectedWarning != null)
+ output.shouldContain(expectedWarning);
+
+ if (expectedToFail) {
+ Asserts.assertNE(output.getExitValue(), 0,
+ "JVM is expected to fail, but did not");
+ }
+ }
+
+ static void testExec(int testCaseNr, String collectorOption, String extraOption,
+ String expectedWarning, boolean expectedToFail) throws Exception {
+
+ OutputAnalyzer output;
+ System.out.println("Testcase: " + testCaseNr);
+
+ // needed, otherwise system considers empty extra option as a
+ // main class param, and fails with "Could not find or load main class"
+ if (!extraOption.isEmpty()) {
+ output = TestCommon.exec(appJar, "-XX:+UseCompressedOops",
+ collectorOption, extraOption, "HelloString");
+ } else {
+ output = TestCommon.exec(appJar, "-XX:+UseCompressedOops",
+ collectorOption, "HelloString");
+ }
+
+ if (expectedWarning != null)
+ output.shouldMatch(expectedWarning);
+
+ if (expectedToFail)
+ Asserts.assertNE(output.getExitValue(), 0);
+ else
+ SharedStringsUtils.checkExec(output);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/InternSharedString.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,56 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Test shared strings together with string intern operation
+ * Feature support: G1GC only, compressed oops/kptrs, 64-bit os, not on windows
+ * @requires (sun.arch.data.model != "32") & (os.family != "windows")
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires vm.gc.G1
+ * @library /test/hotspot/jtreg/runtime/appcds /test/lib
+ * @modules java.base/jdk.internal.misc
+ * @modules java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile InternStringTest.java
+ * @build sun.hotspot.WhiteBox
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @run main InternSharedString
+ */
+
+public class InternSharedString {
+ public static void main(String[] args) throws Exception {
+ SharedStringsUtils.buildJarAndWhiteBox("InternStringTest");
+
+ SharedStringsUtils.dumpWithWhiteBox(TestCommon.list("InternStringTest"),
+ "ExtraSharedInput.txt");
+
+ String[] extraMatches = new String[] {
+ InternStringTest.passed_output1,
+ InternStringTest.passed_output2,
+ InternStringTest.passed_output3 };
+
+ SharedStringsUtils.runWithArchiveAndWhiteBox(extraMatches, "InternStringTest");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/InternStringTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,79 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import sun.hotspot.WhiteBox;
+
+public class InternStringTest {
+ public static String passed_output1 = "Found shared string.";
+ public static String passed_output2 = "Shared strings are equal.";
+ public static String passed_output3 = "Found shared string containing latin1 supplement chars.";
+ public static String passed_output4 = "Found shared string containing non-western chars.";
+ public static final String latin1Sup = "XXXX \u00a3 YYYY"; // \u00a3 = The pound sign
+ public static final String nonWestern = "XXXX \u5678 YYYY"; // \u5678 = Unicode Han Character 'ton (metric or English)'
+
+ public static void main(String[] args) throws Exception {
+ WhiteBox wb = WhiteBox.getWhiteBox();
+
+ // All string literals are shared.
+ String shared1 = "LiveOak";
+ String interned1 = shared1.intern();
+ if (wb.areSharedStringsIgnored() || wb.isShared(interned1)) {
+ System.out.println(passed_output1);
+ } else {
+ throw new RuntimeException("Failed: String is not shared.");
+ }
+
+ // Test 2: shared_string1.intern() == shared_string2.intern()
+ String shared2 = "LiveOak";
+ String interned2 = shared2.intern();
+ if (interned1 == interned2) {
+ System.out.println(passed_output2);
+ } else {
+ throw new RuntimeException("Not equal!");
+ }
+
+ // Test 3: interned strings with a char in latin1 supplement block [\u0080-\u00ff]
+ {
+ String a = "X" + latin1Sup.substring(1);
+ String b = a.intern();
+
+ if (wb.areSharedStringsIgnored() || wb.isShared(b)) {
+ System.out.println(passed_output3);
+ } else {
+ throw new RuntimeException("Failed: expected shared string with latin1-supplement chars.");
+ }
+ }
+
+ // Test 5: interned strings with non-western characters
+ {
+ String a = "X" + nonWestern.substring(1);
+ String b = a.intern();
+ if (wb.areSharedStringsIgnored() || wb.isShared(b)) {
+ System.out.println(passed_output4);
+ } else {
+ throw new RuntimeException("Failed: expected shared string with non-western chars.");
+ }
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/InvalidFileFormat.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,73 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Check most common errors in file format
+ * Feature support: G1GC only, compressed oops/kptrs, 64-bit os, not on windows
+ * @requires (sun.arch.data.model != "32") & (os.family != "windows")
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires vm.gc.G1
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * @modules java.management
+ * jdk.jartool/sun.tools.jar
+ * @build HelloString
+ * @run main InvalidFileFormat
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+import java.io.File;
+
+// Checking most common error use cases
+// This file is not an exhastive test of various shared data file corruption
+// Note on usability intent: the shared data file is created and handled by
+// the previledge person in the server environment.
+public class InvalidFileFormat {
+ public static void main(String[] args) throws Exception {
+ SharedStringsUtils.buildJar("HelloString");
+
+ test("NonExistentFile.txt", "Unable to get hashtable dump file size");
+ test("InvalidHeader.txt", "wrong version of hashtable dump file");
+ test("InvalidVersion.txt", "wrong version of hashtable dump file");
+ test("CorruptDataLine.txt", "Unknown data type. Corrupted at line 2");
+ test("InvalidSymbol.txt", "Unexpected character. Corrupted at line 2");
+ test("InvalidSymbolFormat.txt", "Unrecognized format. Corrupted at line 9");
+ test("OverflowPrefix.txt", "Num overflow. Corrupted at line 4");
+ test("UnrecognizedPrefix.txt", "Unrecognized format. Corrupted at line 5");
+ test("TruncatedString.txt", "Truncated. Corrupted at line 3");
+ }
+
+ private static void
+ test(String dataFileName, String expectedWarning) throws Exception {
+ System.out.println("Filename for testcase: " + dataFileName);
+
+ OutputAnalyzer out = SharedStringsUtils.dumpWithoutChecks(TestCommon.list("HelloString"),
+ "invalidFormat" + File.separator + dataFileName);
+
+ if (!TestCommon.isUnableToMap(out))
+ out.shouldContain(expectedWarning).shouldHaveExitValue(1);
+ }
+
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/LargePages.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,53 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Basic shared string test with large pages
+ * Feature support: G1GC only, compressed oops/kptrs, 64-bit os, not on windows
+ * @requires (sun.arch.data.model != "32") & (os.family != "windows")
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires vm.gc.G1
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * @modules java.management
+ * jdk.jartool/sun.tools.jar
+ * @build HelloString
+ * @run main LargePages
+ */
+public class LargePages {
+ public static void main(String[] args) throws Exception {
+ SharedStringsUtils.buildJar("HelloString");
+
+ SharedStringsUtils.dump(TestCommon.list("HelloString"),
+ "SharedStringsBasic.txt", "-XX:+UseLargePages");
+ SharedStringsUtils.runWithArchive("HelloString", "-XX:+UseLargePages");
+
+ SharedStringsUtils.dump(TestCommon.list("HelloString"),
+ "SharedStringsBasic.txt",
+ "-XX:+UseLargePages", "-XX:+UseLargePagesInMetaspace");
+ SharedStringsUtils.runWithArchive("HelloString",
+ "-XX:+UseLargePages", "-XX:+UseLargePagesInMetaspace");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/LockSharedStrings.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,57 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Test locking on shared strings
+ * Feature support: G1GC only, compressed oops/kptrs, 64-bit os, not on windows
+ * @requires (sun.arch.data.model != "32") & (os.family != "windows")
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires vm.gc.G1
+ * @library /test/hotspot/jtreg/runtime/appcds /test/lib
+ * @modules java.base/jdk.internal.misc
+ * @modules java.management
+ * jdk.jartool/sun.tools.jar
+ * @compile LockStringTest.java LockStringValueTest.java
+ * @build sun.hotspot.WhiteBox
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @run main LockSharedStrings
+ */
+
+public class LockSharedStrings {
+ public static void main(String[] args) throws Exception {
+ SharedStringsUtils.buildJarAndWhiteBox("LockStringTest", "LockStringValueTest");
+
+ SharedStringsUtils.dumpWithWhiteBox(
+ TestCommon.list("LockStringTest", "LockStringValueTest"),
+ "ExtraSharedInput.txt");
+
+ String[] extraMatch = new String[] {"LockStringTest: PASS"};
+ SharedStringsUtils.runWithArchiveAndWhiteBox(extraMatch, "LockStringTest");
+
+ extraMatch = new String[] {"LockStringValueTest: PASS"};
+ SharedStringsUtils.runWithArchiveAndWhiteBox(extraMatch, "LockStringValueTest",
+ "--add-opens=java.base/java.lang=ALL-UNNAMED");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/LockStringTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,68 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import sun.hotspot.WhiteBox;
+
+public class LockStringTest extends Thread {
+ static String lock = "StringLock";
+ static boolean done = false;
+
+ public static void main(String[] args) throws Exception {
+ WhiteBox wb = WhiteBox.getWhiteBox();
+ if (wb.areSharedStringsIgnored()) {
+ System.out.println("The shared strings are ignored");
+ System.out.println("LockStringTest: PASS");
+ return;
+ }
+
+ if (!wb.isShared(lock)) {
+ throw new RuntimeException("Failed: String is not shared.");
+ }
+
+ new LockStringTest().start();
+
+ synchronized(lock) {
+ while (!done) {
+ lock.wait();
+ }
+ }
+ System.gc();
+ System.out.println("LockStringTest: PASS");
+ }
+
+ public void run() {
+ String shared = "LiveOak";
+ synchronized (lock) {
+ for (int i = 0; i < 100; i++) {
+ new String(shared);
+ System.gc();
+ try {
+ sleep(5);
+ } catch (InterruptedException e) {}
+ }
+ done = true;
+ lock.notify();
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/LockStringValueTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,61 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.lang.reflect.*;
+import sun.hotspot.WhiteBox;
+
+/*
+ * Lock the 'value' field of a known shared string, java.lang.Object
+ */
+public class LockStringValueTest {
+ public static void main(String args[]) {
+ String s = "LiveOak";
+ WhiteBox wb = WhiteBox.getWhiteBox();
+
+ if (wb.areSharedStringsIgnored()) {
+ System.out.println("The shared strings are ignored");
+ System.out.println("LockStringValueTest: PASS");
+ return;
+ }
+
+ if (!wb.isShared(s)) {
+ throw new RuntimeException("LockStringValueTest Failed: String is not shared.");
+ }
+
+ Class c = s.getClass();
+ try {
+ Field f = c.getDeclaredField("value");
+ f.setAccessible(true);
+ Object v = f.get(s);
+ lock(v);
+ } catch (NoSuchFieldException nfe) {
+ } catch (IllegalAccessException iae) {}
+ }
+
+ public static void lock(Object o) {
+ synchronized (o) {
+ System.out.println("LockStringValueTest: PASS");
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsBasic.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,78 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Basic test for shared strings
+ * Feature support: G1GC only, compressed oops/kptrs, 64-bit os, not on windows
+ * @requires (sun.arch.data.model != "32") & (os.family != "windows")
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires vm.gc.G1
+ * @library /test/hotspot/jtreg/runtime/appcds /test/lib
+ * @modules java.base/jdk.internal.misc
+ * @modules java.management
+ * jdk.jartool/sun.tools.jar
+ * @build HelloString
+ * @run main SharedStringsBasic
+ */
+import jdk.test.lib.process.OutputAnalyzer;
+import jdk.test.lib.process.ProcessTools;
+
+// This test does not use SharedStringsUtils intentionally:
+// - in order to demonstrate the basic use of the functionality
+// - to provide sanity check and catch potential problems in the utils
+public class SharedStringsBasic {
+ public static void main(String[] args) throws Exception {
+ String appJar = JarBuilder.build("SharedStringsBasic", "HelloString");
+
+ String sharedArchiveConfigFile =
+ TestCommon.getSourceFile("SharedStringsBasic.txt").toString();
+
+ ProcessBuilder dumpPb = ProcessTools.createJavaProcessBuilder(true,
+ "-XX:+UseAppCDS",
+ "-XX:+UseCompressedOops",
+ "-XX:+UseG1GC",
+ "-cp", appJar,
+ "-XX:SharedArchiveConfigFile=" + sharedArchiveConfigFile,
+ "-XX:SharedArchiveFile=./SharedStringsBasic.jsa",
+ "-Xshare:dump",
+ "-Xlog:cds,cds+hashtables");
+
+ TestCommon.executeAndLog(dumpPb, "dump")
+ .shouldContain("Shared string table stats")
+ .shouldHaveExitValue(0);
+
+ ProcessBuilder runPb = ProcessTools.createJavaProcessBuilder(true,
+ "-XX:+UseAppCDS",
+ "-XX:+UseCompressedOops",
+ "-XX:+UseG1GC",
+ "-cp", appJar,
+ "-XX:SharedArchiveFile=./SharedStringsBasic.jsa",
+ "-Xshare:auto",
+ "-showversion",
+ "HelloString");
+
+ TestCommon.executeAndLog(runPb, "run").shouldHaveExitValue(0);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsBasic.txt Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,60 @@
+VERSION: 1.0
+@SECTION: String
+0:
+5: cp819
+31: shared_test_string_unique_14325
+31: shared_test_string_intern_12345
+7: test123
+1: *
+1: -
+1: .
+1: /
+1: :
+1: C
+1: I
+1: J
+1: U
+1: Z
+1: _
+8: segments
+1: |
+5: cp850
+5: cp852
+5: cp855
+5: cp857
+5: cp858
+5: cp862
+5: cp866
+11: ISO_8859_13
+11: ISO_8859_15
+5: cp874
+47: java.lang.invoke.MethodHandle.TRACE_INTERPRETER
+7: CHECKED
+3: zip
+10: waitStatus
+33: java.lang.invoke.MethodHandleImpl
+7: .jimage
+5: cp912
+5: cp914
+5: cp915
+5: cp920
+5: cp923
+5: cp936
+5: euccn
+5: eucjp
+11: permissions
+5: euckr
+6: SIGNAL
+5: cp737
+17: java.library.path
+5: cp775
+13: classValueMap
+4: utf8
+9: PROPAGATE
+9: baseCount
+7: cskoi8r
+8: cyrillic
+@SECTION: Symbol
+41 -1: (Ljava/util/Set<TE;>;Ljava/lang/Object;)V
+10 -1: linkMethod
+20 -1: isAlphaNumericString
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsBasicPlus.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,50 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Basic plus test for shared strings
+ * Feature support: G1GC only, compressed oops/kptrs, 64-bit os, not on windows
+ * @requires (sun.arch.data.model != "32") & (os.family != "windows")
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires vm.gc.G1
+ * @library /test/hotspot/jtreg/runtime/appcds /test/lib
+ * @modules java.base/jdk.internal.misc
+ * @modules java.management
+ * jdk.jartool/sun.tools.jar
+ * @build HelloStringPlus sun.hotspot.WhiteBox
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @run main SharedStringsBasicPlus
+ */
+
+public class SharedStringsBasicPlus {
+ public static void main(String[] args) throws Exception {
+ SharedStringsUtils.buildJarAndWhiteBox("HelloStringPlus");
+
+ SharedStringsUtils.dumpWithWhiteBox( TestCommon.list("HelloStringPlus"),
+ "SharedStringsBasic.txt");
+
+ SharedStringsUtils.runWithArchiveAndWhiteBox("HelloStringPlus");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsStress.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,71 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Write a lots of shared strings.
+ * Feature support: G1GC only, compressed oops/kptrs, 64-bit os, not on windows
+ * @requires (sun.arch.data.model != "32") & (os.family != "windows")
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires vm.gc.G1
+ * @library /test/hotspot/jtreg/runtime/appcds /test/lib
+ * @modules jdk.jartool/sun.tools.jar
+ * @build HelloString
+ * @run main SharedStringsStress
+ */
+import java.io.File;
+import java.io.FileOutputStream;
+import java.io.OutputStreamWriter;
+import java.io.PrintWriter;
+import jdk.test.lib.process.OutputAnalyzer;
+import jdk.test.lib.process.ProcessTools;
+
+public class SharedStringsStress {
+ public static void main(String[] args) throws Exception {
+ String appJar = JarBuilder.build("SharedStringsStress", "HelloString");
+
+ String sharedArchiveConfigFile = System.getProperty("user.dir") + File.separator + "SharedStringsStress_gen.txt";
+ try (FileOutputStream fos = new FileOutputStream(sharedArchiveConfigFile)) {
+ PrintWriter out = new PrintWriter(new OutputStreamWriter(fos));
+ out.println("VERSION: 1.0");
+ out.println("@SECTION: String");
+ out.println("31: shared_test_string_unique_14325");
+ for (int i=0; i<100000; i++) {
+ String s = "generated_string " + i;
+ out.println(s.length() + ": " + s);
+ }
+ out.close();
+ }
+
+ // Set NewSize to 8m due to dumping could fail in hs-tier6 testing with
+ // the vm options: -XX:+UnlockCommercialFeatures -XX:+UseDeterministicG1GC
+ // resulting in vm initialization error:
+ // "GC triggered before VM initialization completed. Try increasing NewSize, current value 1331K."
+ OutputAnalyzer dumpOutput = TestCommon.dump(appJar, TestCommon.list("HelloString"), "-XX:NewSize=8m",
+ "-XX:SharedArchiveConfigFile=" + sharedArchiveConfigFile);
+ TestCommon.checkDump(dumpOutput);
+ OutputAnalyzer execOutput = TestCommon.exec(appJar, "HelloString");
+ TestCommon.checkExec(execOutput);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsUtils.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,143 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import jdk.test.lib.cds.CDSOptions;
+import jdk.test.lib.process.OutputAnalyzer;
+
+// A helper/utility class for testing shared strings
+public class SharedStringsUtils {
+ public static final String TEST_JAR_NAME = "test";
+ public static final String TEST_JAR_NAME_FULL = "test.jar";
+ public static final String WHITEBOX_JAR_NAME = "whitebox";
+
+ public static String getWbParam() {
+ return "-Xbootclasspath/a:" + TestCommon.getTestJar(WHITEBOX_JAR_NAME + ".jar");
+ }
+
+ // build the test jar
+ public static void buildJar(String... classes) throws Exception {
+ JarBuilder.build(TEST_JAR_NAME, classes);
+ }
+
+ // build the test jar and a whitebox jar
+ public static void buildJarAndWhiteBox(String... classes) throws Exception {
+ JarBuilder.build(true, WHITEBOX_JAR_NAME, "sun/hotspot/WhiteBox");
+ buildJar(classes);
+ }
+
+ // execute the "dump" operation, but do not check the output
+ public static OutputAnalyzer dumpWithoutChecks(String appClasses[],
+ String sharedDataFile, String... extraOptions) throws Exception {
+
+ String appJar = TestCommon.getTestJar(TEST_JAR_NAME_FULL);
+ String[] args =
+ TestCommon.concat(extraOptions, "-XX:+UseCompressedOops", "-XX:+UseG1GC",
+ "-XX:SharedArchiveConfigFile=" +
+ TestCommon.getSourceFile(sharedDataFile));
+
+ return TestCommon.dump(appJar, appClasses, args);
+ }
+
+ // execute the dump operation and check the output
+ public static OutputAnalyzer dump(String appClasses[],
+ String sharedDataFile, String... extraOptions) throws Exception {
+ OutputAnalyzer output = dumpWithoutChecks(appClasses, sharedDataFile, extraOptions);
+ checkDump(output);
+ return output;
+ }
+
+ public static OutputAnalyzer dumpWithWhiteBox(String appClasses[],
+ String sharedDataFile, String... extraOptions) throws Exception {
+ return dump(appClasses, sharedDataFile,
+ TestCommon.concat(extraOptions, getWbParam()) );
+ }
+
+ // execute/run test with shared archive
+ public static OutputAnalyzer runWithArchiveAuto(String className,
+ String... extraOptions) throws Exception {
+
+ String appJar = TestCommon.getTestJar(TEST_JAR_NAME_FULL);
+ String[] args = TestCommon.concat(extraOptions,
+ "-cp", appJar, "-XX:+UseCompressedOops", "-XX:+UseG1GC", className);
+
+ OutputAnalyzer output = TestCommon.execAuto(args);
+ checkExecAuto(output);
+ return output;
+ }
+
+ public static OutputAnalyzer runWithArchive(String className,
+ String... extraOptions) throws Exception {
+
+ return runWithArchive(new String[0], className, extraOptions);
+ }
+
+ public static OutputAnalyzer runWithArchive(String[] extraMatches,
+ String className, String... extraOptions) throws Exception {
+
+ String appJar = TestCommon.getTestJar(TEST_JAR_NAME_FULL);
+ String[] args = TestCommon.concat(extraOptions,
+ "-XX:+UseCompressedOops", "-XX:+UseG1GC", className);
+
+ OutputAnalyzer output = TestCommon.exec(appJar, args);
+ checkExec(output, extraMatches);
+ return output;
+ }
+
+
+ // execute/run test with shared archive and white box
+ public static OutputAnalyzer runWithArchiveAndWhiteBox(String className,
+ String... extraOptions) throws Exception {
+
+ return runWithArchive(className,
+ TestCommon.concat(extraOptions, getWbParam(),
+ "-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI") );
+ }
+
+ public static OutputAnalyzer runWithArchiveAndWhiteBox(String[] extraMatches,
+ String className, String... extraOptions) throws Exception {
+
+ return runWithArchive(extraMatches, className,
+ TestCommon.concat(extraOptions, getWbParam(),
+ "-XX:+UnlockDiagnosticVMOptions", "-XX:+WhiteBoxAPI") );
+ }
+
+
+ public static void checkDump(OutputAnalyzer output) throws Exception {
+ output.shouldContain("Shared string table stats");
+ TestCommon.checkDump(output);
+ }
+
+ public static void checkExec(OutputAnalyzer output) throws Exception {
+ TestCommon.checkExec(output, new String[0]);
+ }
+
+ public static void checkExecAuto(OutputAnalyzer output) throws Exception {
+ CDSOptions opts = (new CDSOptions()).setXShareMode("auto");
+ TestCommon.checkExec(output, opts);
+ }
+
+ public static void checkExec(OutputAnalyzer output, String[] extraMatches) throws Exception {
+ TestCommon.checkExec(output, extraMatches);
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsWb.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,40 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import sun.hotspot.WhiteBox;
+
+public class SharedStringsWb {
+ public static void main(String[] args) throws Exception {
+ WhiteBox wb = WhiteBox.getWhiteBox();
+ String s = "shared_test_string_unique_14325";
+ s = s.intern();
+ if (wb.areSharedStringsIgnored() || wb.isShared(s)) {
+ System.out.println("Found shared string.");
+ } else {
+ throw new RuntimeException("String is not shared.");
+ }
+ }
+}
+
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SharedStringsWbTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,53 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary White box test for shared strings
+ * Feature support: G1GC only, compressed oops/kptrs, 64-bit os, not on windows
+ * @requires (sun.arch.data.model != "32") & (os.family != "windows")
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires vm.gc.G1
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * @modules java.management
+ * jdk.jartool/sun.tools.jar
+ * @build sun.hotspot.WhiteBox SharedStringsWb
+ * @run main ClassFileInstaller sun.hotspot.WhiteBox
+ * @run main SharedStringsWbTest
+ */
+
+import java.io.*;
+import sun.hotspot.WhiteBox;
+
+public class SharedStringsWbTest {
+ public static void main(String[] args) throws Exception {
+ SharedStringsUtils.buildJarAndWhiteBox("SharedStringsWb");
+
+ SharedStringsUtils.dumpWithWhiteBox(TestCommon.list("SharedStringsWb"),
+ "SharedStringsBasic.txt");
+
+ SharedStringsUtils.runWithArchiveAndWhiteBox("SharedStringsWb");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/SysDictCrash.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,63 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * @test
+ * @summary Regression test for JDK-8098821
+ * @bug 8098821
+ * @requires (vm.opt.UseCompressedOops == null) | (vm.opt.UseCompressedOops == true)
+ * @requires vm.gc.G1
+ * @library /test/lib /test/hotspot/jtreg/runtime/appcds
+ * @modules java.base/jdk.internal.misc
+ * @modules java.management
+ * @run main SysDictCrash
+ */
+
+import jdk.test.lib.process.OutputAnalyzer;
+import jdk.test.lib.process.ProcessTools;
+
+public class SysDictCrash {
+ public static void main(String[] args) throws Exception {
+ // SharedBaseAddress=0 puts the archive at a very high address on solaris,
+ // which provokes the crash.
+ ProcessBuilder dumpPb = ProcessTools.createJavaProcessBuilder(true,
+ "-XX:+UseG1GC", "-XX:MaxRAMPercentage=12.5",
+ "-XX:+UseAppCDS",
+ "-cp", ".",
+ "-XX:SharedBaseAddress=0", "-XX:SharedArchiveFile=./SysDictCrash.jsa",
+ "-Xshare:dump",
+ "-showversion", "-Xlog:cds,cds+hashtables");
+
+ TestCommon.checkDump(TestCommon.executeAndLog(dumpPb, "dump"));
+
+ ProcessBuilder runPb = ProcessTools.createJavaProcessBuilder(true,
+ "-XX:+UseG1GC", "-XX:MaxRAMPercentage=12.5",
+ "-XX:+UseAppCDS",
+ "-XX:SharedArchiveFile=./SysDictCrash.jsa",
+ "-Xshare:on",
+ "-version");
+
+ TestCommon.checkExec(TestCommon.executeAndLog(runPb, "exec"));
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/CorruptDataLine.txt Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,60 @@
+VERSION: 1.0
+SECTION: String
+0:
+5: cp819
+31: shared_test_string_unique_14325
+31: shared_test_string_intern_12345
+7: test123
+1: *
+1: -
+1: .
+1: /
+1: :
+1: C
+1: I
+1: J
+1: U
+1: Z
+1: _
+8: segments
+1: |
+5: cp850
+5: cp852
+5: cp855
+5: cp857
+5: cp858
+5: cp862
+5: cp866
+11: ISO_8859_13
+11: ISO_8859_15
+5: cp874
+47: java.lang.invoke.MethodHandle.TRACE_INTERPRETER
+7: CHECKED
+3: zip
+10: waitStatus
+33: java.lang.invoke.MethodHandleImpl
+7: .jimage
+5: cp912
+5: cp914
+5: cp915
+5: cp920
+5: cp923
+5: cp936
+5: euccn
+5: eucjp
+11: permissions
+5: euckr
+6: SIGNAL
+5: cp737
+17: java.library.path
+5: cp775
+13: classValueMap
+4: utf8
+9: PROPAGATE
+9: baseCount
+7: cskoi8r
+8: cyrillic
+#DATATYPE: Symbol
+41 -1: (Ljava/util/Set<TE;>;Ljava/lang/Object;)V
+10 -1: linkMethod
+20 -1: isAlphaNumericString
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidDataType.txt Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,60 @@
+VERSION: 1.0
+@SECTION: String
+0:
+5: cp819
+31: shared_test_string_unique_14325
+31: shared_test_string_intern_12345
+7: test123
+1: *
+1: -
+1: .
+1: /
+1: :
+1: C
+1: I
+1: J
+1: U
+1: Z
+1: _
+8: segments
+1: |
+5: cp850
+5: cp852
+5: cp855
+5: cp857
+5: cp858
+5: cp862
+5: cp866
+11: ISO_8859_13
+11: ISO_8859_15
+5: cp874
+47: java.lang.invoke.MethodHandle.TRACE_INTERPRETER
+7: CHECKED
+3: zip
+10: waitStatus
+33: java.lang.invoke.MethodHandleImpl
+7: .jimage
+5: cp912
+5: cp914
+5: cp915
+5: cp920
+5: cp923
+5: cp936
+5: euccn
+5: eucjp
+11: permissions
+5: euckr
+6: SIGNAL
+5: cp737
+17: java.library.path
+5: cp775
+13: classValueMap
+4: utf8
+9: PROPAGATE
+9: baseCount
+7: cskoi8r
+8: cyrillic
+#DATATYPE: Symbol
+41 -1: (Ljava/util/Set<TE;>;Ljava/lang/Object;)V
+10 -1: linkMethod
+20 -1: isAlphaNumericString
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidHeader.txt Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,60 @@
+Garbage Header x0935#%0sl
+@SECTION: String
+0:
+5: cp819
+31: shared_test_string_unique_14325
+31: shared_test_string_intern_12345
+7: test123
+1: *
+1: -
+1: .
+1: /
+1: :
+1: C
+1: I
+1: J
+1: U
+1: Z
+1: _
+8: segments
+1: |
+5: cp850
+5: cp852
+5: cp855
+5: cp857
+5: cp858
+5: cp862
+5: cp866
+11: ISO_8859_13
+11: ISO_8859_15
+5: cp874
+47: java.lang.invoke.MethodHandle.TRACE_INTERPRETER
+7: CHECKED
+3: zip
+10: waitStatus
+33: java.lang.invoke.MethodHandleImpl
+7: .jimage
+5: cp912
+5: cp914
+5: cp915
+5: cp920
+5: cp923
+5: cp936
+5: euccn
+5: eucjp
+11: permissions
+5: euckr
+6: SIGNAL
+5: cp737
+17: java.library.path
+5: cp775
+13: classValueMap
+4: utf8
+9: PROPAGATE
+9: baseCount
+7: cskoi8r
+8: cyrillic
+#DATATYPE: Symbol
+41 -1: (Ljava/util/Set<TE;>;Ljava/lang/Object;)V
+10 -1: linkMethod
+20 -1: isAlphaNumericString
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidString.txt Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,6 @@
+VERSION: 1.0
+@SECTION: String
+31: shred_test_string_unique_14325
+31: shared_test_string_intern_12345
+7: test123
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidStringFormat.txt Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,60 @@
+VERSION: 1.0
+@SECTION: String
+0:
+5:: cp819
+31: shared_test_string_unique_14325
+31: shared_test_string_intern_12345
+7: test123
+1: *
+1: -
+1: .
+1: /
+1: :
+1: C
+1: I
+1: J
+1: U
+1: Z
+1: _
+8: segments
+1: |
+5: cp850
+5: cp852
+5: cp855
+5: cp857
+5: cp858
+5: cp862
+5: cp866
+11: ISO_8859_13
+11: ISO_8859_15
+5: cp874
+47: java.lang.invoke.MethodHandle.TRACE_INTERPRETER
+7: CHECKED
+3: zip
+10: waitStatus
+33: java.lang.invoke.MethodHandleImpl
+7: .jimage
+5: cp912
+5: cp914
+5: cp915
+5: cp920
+5: cp923
+5: cp936
+5: euccn
+5: eucjp
+11: permissions
+5: euckr
+6: SIGNAL
+5: cp737
+17: java.library.path
+5: cp775
+13: classValueMap
+4: utf8
+9: PROPAGATE
+9: baseCount
+7: cskoi8r
+8: cyrillic
+#DATATYPE: Symbol
+41 -1: (Ljava/util/Set<TE;>;Ljava/lang/Object;)V
+10 -1: linkMethod
+20 -1: isAlphaNumericString
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidSymbol.txt Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,12 @@
+VERSION: 1.0
+@SECTION: String
+0:
+5: cp819
+31: shared_test_string_unique_14325
+31: shared_test_string_intern_12345
+7: test123
+8: cyrillic
+@SECTION: Symbol
+41 -1: (Ljava/util/Set<TE;>;Ljava/lang/Object;)V
+10 -1: linkMet%%%hod
+20 -1: isAlphaNumericString
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidSymbolFormat.txt Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,11 @@
+VERSION: 1.0
+@SECTION: String
+0:
+5: cp819
+31: shared_test_string_unique_14325
+31: shared_test_string_intern_12345
+7: test123
+@SECTION: Symbol
+41: (Ljava/util/Set<TE;>;Ljava/lang/Object;)V
+10 -1: linkMethod
+20 -1: isAlphaNumericString
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/InvalidVersion.txt Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,60 @@
+VERSION: 0.0
+@SECTION: String
+0:
+5: cp819
+31: shared_test_string_unique_14325
+31: shared_test_string_intern_12345
+7: test123
+1: *
+1: -
+1: .
+1: /
+1: :
+1: C
+1: I
+1: J
+1: U
+1: Z
+1: _
+8: segments
+1: |
+5: cp850
+5: cp852
+5: cp855
+5: cp857
+5: cp858
+5: cp862
+5: cp866
+11: ISO_8859_13
+11: ISO_8859_15
+5: cp874
+47: java.lang.invoke.MethodHandle.TRACE_INTERPRETER
+7: CHECKED
+3: zip
+10: waitStatus
+33: java.lang.invoke.MethodHandleImpl
+7: .jimage
+5: cp912
+5: cp914
+5: cp915
+5: cp920
+5: cp923
+5: cp936
+5: euccn
+5: eucjp
+11: permissions
+5: euckr
+6: SIGNAL
+5: cp737
+17: java.library.path
+5: cp775
+13: classValueMap
+4: utf8
+9: PROPAGATE
+9: baseCount
+7: cskoi8r
+8: cyrillic
+#DATATYPE: Symbol
+41 -1: (Ljava/util/Set<TE;>;Ljava/lang/Object;)V
+10 -1: linkMethod
+20 -1: isAlphaNumericString
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/OverflowPrefix.txt Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,11 @@
+VERSION: 1.0
+@SECTION: String
+0:
+2147483648: cp819
+31: shared_test_string_unique_14325
+31: shared_test_string_intern_12345
+7: test123
+@SECTION: Symbol
+41 -1: (Ljava/util/Set<TE;>;Ljava/lang/Object;)V
+10 -1: linkMethod
+20 -1: isAlphaNumericString
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/TruncatedString.txt Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,10 @@
+VERSION: 1.0
+@SECTION: String
+2147483647: s
+5: cp819
+31: shared_test_string_intern_12345
+7: test123
+@SECTION: Symbol
+41 -1: (Ljava/util/Set<TE;>;Ljava/lang/Object;)V
+10 -1: linkMethod
+20 -1: isAlphaNumericString
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/sharedStrings/invalidFormat/UnrecognizedPrefix.txt Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,11 @@
+VERSION: 1.0
+@SECTION: String
+0:
+5: cp819
+3E: shared_test_string_unique_14325
+31: shared_test_string_intern_12345
+7: test123
+@SECTION: Symbol
+41 -1: (Ljava/util/Set<TE;>;Ljava/lang/Object;)V
+10 -1: linkMethod
+20 -1: isAlphaNumericString
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/ArrayListTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,41 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.util.*;
+
+// This is a test case executed by DumpClassList.java to load classes
+// from various places to ensure that they are not written to the class list.
+public class ArrayListTest {
+ public static void main(String args[]) throws Exception {
+ // The following lambda usage should generate various classes like
+ // java.lang.invoke.LambdaForm$MH/1146743572. All of them should be excluded from
+ // the class list.
+ List<String> a = new ArrayList<>();
+ a.add("hello world.");
+ a.forEach(str -> System.out.println(str));
+
+ System.out.println(Class.forName("java.lang.NewClass")); // should be excluded from the class list.
+ System.out.println(Class.forName("boot.append.Foo")); // should be excluded from the class list.
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/BootClassPathAppendHelper.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,42 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import sun.hotspot.WhiteBox;
+
+public class BootClassPathAppendHelper {
+ public static void main(String[] args) throws ClassNotFoundException {
+ Class cls = Class.forName("Hello");
+
+ if (cls == null) {
+ throw new java.lang.RuntimeException("Cannot find Hello.class");
+ }
+
+ WhiteBox wb = WhiteBox.getWhiteBox();
+ if (!wb.isSharedClass(cls)) {
+ System.out.println("Hello.class is not in shared space as expected.");
+ } else {
+ throw new java.lang.RuntimeException("Hello.class shouldn't be in shared space.");
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/C1.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,28 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+package sealed.pkg;
+
+public class C1 {
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/C2.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,28 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+package pkg;
+
+public class C2 {
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/CheckIfShared.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,40 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import sun.hotspot.WhiteBox;
+
+public class CheckIfShared {
+ public static void main(String args[]) throws Exception {
+ WhiteBox wb = WhiteBox.getWhiteBox();
+ if ("true".equals(args[0])) {
+ if (!wb.isSharedClass(CheckIfShared.class)) {
+ throw new RuntimeException("wb.isSharedClass(CheckIfShared.class) should be true");
+ }
+ } else {
+ if (wb.isSharedClass(CheckIfShared.class)) {
+ throw new RuntimeException("wb.isSharedClass(CheckIfShared.class) should be false");
+ }
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/Child.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,25 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class Child extends Super {}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr1.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,38 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class CpAttr1 {
+ public static void main(String args[]) {
+ System.out.println("2"); CpAttr2.doit(); // Only the version of this class defined in CpAttr2.java will not throw exception.
+ System.out.println("3"); CpAttr3.doit(); // Only the version of this class defined in CpAttr3.java will not throw exception.
+ System.out.println("4"); CpAttr4.doit(); // Only the version of this class defined in CpAttr4.java will not throw exception.
+ System.out.println("5"); CpAttr5.doit(); // Only the version of this class defined in CpAttr5.java will not throw exception.
+ System.out.println("Test passed");
+ }
+}
+
+class CpAttr2 { static void doit() {throw new RuntimeException("");} }
+class CpAttr3 { static void doit() {throw new RuntimeException("");} }
+class CpAttr4 { static void doit() {throw new RuntimeException("");} }
+class CpAttr5 { static void doit() {throw new RuntimeException("");} }
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr2.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,25 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+class CpAttr2 { static void doit() {} }
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr3.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,26 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+class CpAttr2 { static void doit() {throw new RuntimeException("");} }
+class CpAttr3 { static void doit() {} }
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr4.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,28 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+class CpAttr2 { static void doit() {throw new RuntimeException("");} }
+class CpAttr3 { static void doit() {throw new RuntimeException("");} }
+class CpAttr4 { static void doit() {} }
+class CpAttr5 { static void doit() {throw new RuntimeException("");} }
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/CpAttr5.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,25 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+class CpAttr5 { static void doit() {} }
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/DummyClassHelper.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,58 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.lang.*;
+import java.lang.reflect.*;
+import sun.hotspot.WhiteBox;
+
+public class DummyClassHelper {
+ public static void main(String[] args) throws Exception {
+ String[] classNames = {args[0], args[1]};
+ Class cls = null;
+ if (args.length == 2) {
+ for (int i = 0; i < classNames.length; i++) {
+ Method m = null;
+ cls = Class.forName(classNames[i]);
+ try {
+ m = cls.getMethod("thisClassIsDummy");
+ throw new java.lang.RuntimeException(classNames[i] +
+ " should be loaded from the jimage and should not have the thisClassIsDummy() method.");
+ } catch(NoSuchMethodException ex) {
+ System.out.println(ex.toString());
+ }
+ }
+ } else {
+ WhiteBox wb = WhiteBox.getWhiteBox();
+ for (int i = 0; i < classNames.length; i++) {
+ cls = Class.forName(classNames[i]);
+ if (!wb.isSharedClass(cls)) {
+ System.out.println(classNames[i] + ".class" + " is not in shared space as expected.");
+ } else {
+ throw new java.lang.RuntimeException(classNames[i] +
+ ".class shouldn't be in shared space.");
+ }
+ }
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/EmptyClassHelper.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,59 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.lang.*;
+import java.lang.reflect.*;
+import jdk.internal.misc.JavaLangAccess;
+import jdk.internal.misc.SharedSecrets;
+
+class EmptyClassHelper {
+ static final JavaLangAccess jla = SharedSecrets.getJavaLangAccess();
+ static final String USE_APP = "useAppLoader";
+ public static void main(String[] args) throws Exception {
+ Class cls = null;
+ Method m = null;
+ ClassLoader appLoader = ClassLoader.getSystemClassLoader();
+ String className = "com.sun.tools.javac.Main";
+ if (args[0].equals(USE_APP)) {
+ cls = appLoader.loadClass(className);
+ System.out.println("appLoader loaded class");
+ try {
+ m = cls.getMethod("main", String[].class);
+ System.out.println("appLoader found method main");
+ } catch(NoSuchMethodException ex) {
+ System.out.println(ex.toString());
+ }
+ } else {
+ cls = jla.findBootstrapClassOrNull(appLoader, className);
+ System.out.println("bootLoader loaded class");
+ System.out.println("cls = " + cls);
+ try {
+ m = cls.getMethod("main", String[].class);
+ System.out.println("bootLoader found method main");
+ } catch(NoSuchMethodException ex) {
+ System.out.println(ex.toString());
+ }
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/FieldAnnotationsApp.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,58 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.lang.annotation.Annotation;
+import java.lang.reflect.Field;
+
+public class FieldAnnotationsApp {
+ @MyAnnotation(name="myField1", value="myValue1")
+ public String myField1 = null;
+
+ @MyAnnotation(name="myField2", value="myValue2")
+ public String myField2 = null;
+
+ public static void main(String args[]) throws Exception {
+ for (int i=1; i<=2; i++) {
+ Field field = FieldAnnotationsApp.class.getField("myField" + i);
+ Annotation[] annotations = field.getDeclaredAnnotations();
+
+ for (Annotation anno : annotations){
+ if (anno instanceof MyAnnotation){
+ MyAnnotation myAnno = (MyAnnotation) anno;
+ String name = myAnno.name();
+ String value = myAnno.value();
+
+ System.out.println("Field : " + field.getName());
+ System.out.println(" myAnno.name : " + name);
+ System.out.println(" myAnno.value: " + value);
+
+ if (!(name.equals("myField" + i) && value.equals("myValue" + i))) {
+ throw new Exception("Unexpected annotation values: " + i + " = " + value);
+ }
+ }
+ }
+ }
+ System.out.println("Field annotations are OK.");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/ForNameTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,45 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import sun.hotspot.WhiteBox;
+
+public class ForNameTest {
+ public static void main(String[] args) throws Throwable {
+ // Hello is on the bootclasspath. The defining classloader is
+ // the NULL classloader. See AppCDSClassLoaderTest.
+ Class c = Class.forName("Hello");
+ ClassLoader cl = c.getClassLoader();
+ if (cl != null) {
+ throw new RuntimeException(
+ "Test Failed. Wrong classloader is used. Expect the NULL classloader.");
+ }
+
+ WhiteBox wb = WhiteBox.getWhiteBox();
+ if (!wb.isSharedClass(c)) {
+ System.out.println("As expected, Hello.class is not in shared space.");
+ } else {
+ throw new java.lang.RuntimeException("Hello.class shouldn't be in shared space.");
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/Greet.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,30 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class Greet {
+
+ public String Greeting() {
+ return new String(", how are you?");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/Hello.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,29 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class Hello {
+ public static void main(String args[]) {
+ System.out.println("Hello World");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/HelloExt.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,59 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import sun.hotspot.WhiteBox;
+
+public class HelloExt {
+ public static void main(String[] args) throws Throwable {
+
+ String className = "org.omg.CORBA.ORB";
+ Class cls = Class.forName(className);
+
+ ClassLoader loader = cls.getClassLoader();
+ if (loader != ClassLoader.getPlatformClassLoader()) {
+ throw new java.lang.RuntimeException(className + " should be load by PlatformClassLoader but it is loaded by " + loader);
+ }
+
+ WhiteBox wb = WhiteBox.getWhiteBox();
+ if (wb.isSharedClass(cls)) {
+ System.out.println("As expected, " + className + " is in shared space.");
+ } else {
+ throw new java.lang.RuntimeException(className + " is not in shared space.");
+ }
+
+ className = "[Ljava.lang.Comparable;";
+ cls = Class.forName(className);
+ loader = cls.getClassLoader();
+ if (loader != null) {
+ throw new java.lang.RuntimeException(className + " should be load by the NULL class loader but it is loaded by " + loader);
+ }
+
+ if (wb.isSharedClass(cls)) {
+ System.out.println("As expected, " + className + " is in shared space.");
+ } else {
+ throw new java.lang.RuntimeException(className + " is not in shared space.");
+ }
+ }
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/HelloExtApp.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,29 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class HelloExtApp {
+ public static void main(String args[]) {
+ System.out.println("Hello World Ext: " + HelloExtExt.class.getProtectionDomain());
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/HelloExtExt.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,27 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class HelloExtExt {
+
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/HelloMore.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,30 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class HelloMore {
+ public static void main(String args[]) {
+ Hello.main(args);
+ System.out.println("Hello World ... More");
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/HelloWB.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,37 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import sun.hotspot.WhiteBox;
+
+public class HelloWB {
+ public static void main(String[] args) throws Throwable {
+
+ WhiteBox wb = WhiteBox.getWhiteBox();
+ if (wb.isSharedClass(HelloWB.class)) {
+ System.out.println("As expected, HelloWB.class is in shared space.");
+ } else {
+ throw new java.lang.RuntimeException("HelloWB.class should be in shared space.");
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/Hi.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,35 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class Hi extends Greet {
+ public static void main(String args[]) {
+ Greet g = new Greet();
+ MyClass.doit(g.Greeting());
+ }
+ public static class MyClass {
+ public static void doit(String greeting) {
+ System.out.println("Hi" + greeting);
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/Iloadw.jasm Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,37 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class Iloadw
+ version 51: 0
+{
+ public static Method run:"()I"
+ stack 1 locals 400
+ {
+ iconst_0;
+ istore_w 300;
+ iinc_w 300,1;
+ iload_w 300;
+ ireturn;
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/IloadwMain.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,35 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class IloadwMain {
+ public static void main(String args[]) {
+ int result = Iloadw.run();
+ if (result != 1) {
+ throw new RuntimeException(
+ "Failed. Result is " + result + ", expect 1.");
+ } else {
+ System.out.println("Passed.");
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/JimageClassPackage.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,95 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class JimageClassPackage {
+ public static void main(String args[]) throws Throwable {
+ // Test Package for boot/app/ext module classes from the "modules" jimage.
+ // The following classes are archived. See runtime/AppCDS/Package.java.
+ // java.util.Dictionary (testcase 0),
+ // sun.tools.javac.Main (testcase 1),
+ // jdk.nio.zipfs.ZipInfo (testcase 2),
+ // java.net.URL (testcase 3),
+ // sun.rmi.rmic.Main (testcase 4),
+ // com.sun.jndi.dns.DnsName (testcase 5)
+ String testcases[][] =
+ {{"Loading shared boot module class first", "java.util",
+ "java.util.Dictionary", "java.util.ServiceConfigurationError"},
+
+ {"Loading shared app module class first", "sun.tools.javac",
+ "sun.tools.javac.Main", "sun.tools.javac.BatchParser"},
+
+ {"Loading shared ext module class first", "jdk.nio.zipfs",
+ "jdk.nio.zipfs.ZipInfo", "jdk.nio.zipfs.ZipPath"},
+
+ {"Loading non-shared boot module class first", "java.net",
+ "java.net.HttpCookie", "java.net.URL"},
+
+ {"Loading non-shared app module class first", "sun.rmi.rmic",
+ "sun.rmi.rmic.RMIGenerator", "sun.rmi.rmic.Main"},
+
+ {"Loading non-shared ext module class first", "com.sun.jndi.dns",
+ "com.sun.jndi.dns.Resolver", "com.sun.jndi.dns.DnsName"}};
+
+ JimageClassPackage test = new JimageClassPackage();
+ for (int i = 0; i < testcases.length; i++) {
+ System.out.println("Testcase " + i + ": " + testcases[i][0]);
+ test.testPackage(testcases[i][1], testcases[i][2], testcases[i][3]);
+ }
+ }
+
+ private void testPackage (String pkg,
+ String shared,
+ String nonShared) throws Throwable {
+ Class c1 = Class.forName(shared);
+ ClassLoader cl = c1.getClassLoader();
+ Package pkg_from_loader;
+ if (cl != null) {
+ pkg_from_loader = cl.getDefinedPackage(pkg);
+ } else {
+ pkg_from_loader = Package.getPackage(pkg);
+ }
+
+ Package pkg_from_shared_class = c1.getPackage();
+
+ Class c2 = Class.forName(nonShared);
+ Package pkg_from_nonshared_class = c2.getPackage();
+
+ if (pkg_from_loader != null &&
+ pkg_from_shared_class != null &&
+ pkg_from_loader == pkg_from_shared_class &&
+ pkg_from_shared_class == pkg_from_nonshared_class &&
+ pkg_from_shared_class.getName().equals(pkg)) {
+ System.out.println("Expected package: " + pkg_from_shared_class.toString());
+ } else {
+ System.out.println("Unexpected package" + pkg_from_shared_class);
+ System.exit(1);
+ }
+ if (pkg_from_shared_class.isSealed()) {
+ System.out.println("Package is sealed");
+ } else {
+ System.out.println("Package is not sealed");
+ System.exit(1);
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/JimageClassProtDomain.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,74 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class JimageClassProtDomain {
+ public static void main(String args[]) throws Throwable {
+ // Test ProtectionDomain for boot/app/ext module classes from the "modules" jimage.
+ // The following classes are archived. See runtime/AppCDS/ProtectionDomain.java.
+ // java.util.Dictionary (testcase 0),
+ // sun.tools.javac.Main (testcase 1),
+ // jdk.nio.zipfs.ZipInfo (testcase 2),
+ // java.net.URL (testcase 3),
+ // sun.rmi.rmic.Main (testcase 4),
+ // com.sun.jndi.dns.DnsName (testcase 5)
+ String testcases[][] =
+ {{"Loading shared boot module class first",
+ "java.util.Dictionary", "java.util.ServiceConfigurationError"},
+
+ {"Loading shared app module class first",
+ "sun.tools.javac.Main", "sun.tools.javac.BatchParser"},
+
+ {"Loading shared ext module class first",
+ "jdk.nio.zipfs.ZipInfo", "jdk.nio.zipfs.ZipPath"},
+
+ {"Loading non-shared boot module class first",
+ "java.net.HttpCookie", "java.net.URL"},
+
+ {"Loading non-shared app module class first",
+ "sun.rmi.rmic.RMIGenerator", "sun.rmi.rmic.Main"},
+
+ {"Loading non-shared ext module class first",
+ "com.sun.jndi.dns.Resolver", "com.sun.jndi.dns.DnsName"}};
+ for (int i = 0; i < testcases.length; i++) {
+ System.out.println("Testcase " + i + ": " + testcases[i][0]);
+ JimageClassProtDomain.testProtectionDomain(testcases[i][1], testcases[i][2]);
+ }
+ }
+
+ private static void testProtectionDomain(String shared, String nonShared)
+ throws Throwable {
+ Class c1 = Class.forName(shared);
+ Class c2 = Class.forName(nonShared);
+ if (c1.getProtectionDomain() != c2.getProtectionDomain()) {
+ System.out.println("Failed: Protection Domains do not match!");
+ System.out.println(c1.getProtectionDomain());
+ System.out.println(c1.getProtectionDomain().getCodeSource());
+ System.out.println(c2.getProtectionDomain());
+ System.out.println(c2.getProtectionDomain().getCodeSource());
+ System.exit(1);
+ } else {
+ System.out.println("Passed: Protection Domains match.");
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/JvmtiApp.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,105 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import sun.hotspot.WhiteBox;
+
+public class JvmtiApp {
+ static Class forname() {
+ try {
+ return Class.forName("Hello");
+ } catch (Throwable t) {
+ return null;
+ }
+ }
+
+ static void failed(String msg) {
+ System.out.println("TEST FAILED: " + msg);
+ System.exit(1);
+ }
+
+ // See ../JvmtiAddPath.java for how the classpaths are configured.
+ public static void main(String args[]) {
+ if (args[0].equals("noadd")) {
+ if (forname() != null) {
+ failed("Hello class was loaded unexpectedly");
+ }
+ // We use -verbose:class to verify that Extra.class IS loaded by AppCDS if
+ // the boot classpath HAS NOT been appended.
+ ExtraClass.doit();
+ System.exit(0);
+ }
+
+ WhiteBox wb = WhiteBox.getWhiteBox();
+
+ if (args[0].equals("bootonly")) {
+ wb.addToBootstrapClassLoaderSearch(args[1]);
+ Class cls = forname();
+ if (cls == null) {
+ failed("Cannot find Hello class");
+ }
+ if (cls.getClassLoader() != null) {
+ failed("Hello class not loaded by boot classloader");
+ }
+ } else if (args[0].equals("apponly")) {
+ wb.addToSystemClassLoaderSearch(args[1]);
+ Class cls = forname();
+ if (cls == null) {
+ failed("Cannot find Hello class");
+ }
+ if (cls.getClassLoader() != JvmtiApp.class.getClassLoader()) {
+ failed("Hello class not loaded by app classloader");
+ }
+ } else if (args[0].equals("noadd-appcds")) {
+ Class cls = forname();
+ if (cls == null) {
+ failed("Cannot find Hello class");
+ }
+ if (cls.getClassLoader() != JvmtiApp.class.getClassLoader()) {
+ failed("Hello class not loaded by app classloader");
+ }
+ } else if (args[0].equals("appandboot")) {
+ wb.addToBootstrapClassLoaderSearch(args[1]);
+ wb.addToSystemClassLoaderSearch(args[2]);
+ Class cls = forname();
+ if (cls == null) {
+ failed("Cannot find Hello class");
+ }
+ if (cls.getClassLoader() != null) {
+ failed("Hello class not loaded by boot classloader");
+ }
+ } else {
+ failed("unknown option " + args[0]);
+ }
+
+ // We use -verbose:class to verify that Extra.class IS NOT loaded by AppCDS if
+ // the boot classpath HAS been appended.
+ ExtraClass.doit();
+
+ System.out.println("Test passed: " + args[0]);
+ }
+}
+
+class ExtraClass {
+ static void doit() {}
+}
\ No newline at end of file
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/MethodNoReturn.jasm Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,93 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+WAS:
+
+class MethodNoReturn {
+ void badMethod() {}
+}
+*/
+
+super class MethodNoReturn
+ version 52:0
+{
+
+
+Method "<init>":"()V"
+ stack 1 locals 1
+{
+ aload_0;
+ invokespecial Method java/lang/Object."<init>":"()V";
+ return;
+}
+
+Method badMethod:"()V"
+ stack 0 locals 1
+{
+ /*
+ should be:
+ return;
+ */
+
+ iconst_1;
+ pop;
+ iconst_1;
+ pop;
+ iconst_1;
+ pop;
+ iconst_1;
+ pop;
+ iconst_1;
+ pop;
+ iconst_1;
+ pop;
+ iconst_1;
+ pop;
+ iconst_1;
+ pop;
+ iconst_1;
+ pop;
+ iconst_1;
+ pop;
+ iconst_1;
+ iconst_1;
+ iconst_1;
+ iconst_1;
+ iconst_1;
+ iconst_1;
+ iconst_1;
+ iconst_1;
+ pop;
+ pop;
+ pop;
+ pop;
+ pop;
+ pop;
+ pop;
+ pop;
+ // no return here -- so this class will fail verification
+}
+
+} // end Class MethodNoReturn
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/MissingSuper.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,49 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class MissingSuper {
+ public static void main(String args[]) {
+ try {
+ new MissingSuperSub();
+ } catch (NoClassDefFoundError e) {
+ System.out.println("Expected NoClassDefFoundError:");
+ e.printStackTrace(System.out);
+ }
+
+ try {
+ new MissingSuperImpl();
+ } catch (NoClassDefFoundError e) {
+ System.out.println("Expected NoClassDefFoundError:");
+ e.printStackTrace(System.out);
+ }
+ }
+}
+
+class MissingSuperSup {} // This class will be deleted from missing_super.jar before dumping
+
+class MissingSuperSub extends MissingSuperSup {}
+
+interface MissingSuperIntf {} // This interface will be deleted from missing_super.jar before dumping
+
+class MissingSuperImpl implements MissingSuperIntf {}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/MultiProcClass.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,66 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import sun.hotspot.WhiteBox;
+
+// This class should be loaded from a shared archive.
+public class MultiProcClass {
+ private static String instanceLabel;
+
+ public static void main(String args[]) throws Exception {
+ instanceLabel = args[0];
+ String checkPmap = args[1];
+
+ long pid = ProcessHandle.current().pid();
+ System.out.println(inst("========================== Starting MultiProcClass"));
+ System.out.println(inst("My PID: " + pid ));
+ System.out.println(inst("checkPmap = <" + checkPmap + ">" ));
+
+ if ("true".equals(checkPmap)) {
+ if (runPmap(pid, true) != 0)
+ System.out.println("MultiProcClass: Pmap failed");
+ }
+
+ WhiteBox wb = WhiteBox.getWhiteBox();
+ if (!wb.isSharedClass(MultiProcClass.class)) {
+ throw new RuntimeException(inst("MultiProcClass should be shared but is not."));
+ }
+
+ System.out.println(inst("========================== Leaving MultiProcClass"));
+ }
+
+ // A convenience method to append process instance label
+ private static String inst(String msg) {
+ return "process-" + instanceLabel + " : " + msg;
+ }
+
+ // Use on Linux-only; requires jdk-9 for Process.pid()
+ public static int runPmap(long pid, boolean inheritIO) throws Exception {
+ ProcessBuilder pmapPb = new ProcessBuilder("pmap", "" + pid);
+ if (inheritIO)
+ pmapPb.inheritIO();
+
+ return pmapPb.start().waitFor();
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/MyAnnotation.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,36 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.lang.annotation.Target;
+import java.lang.annotation.ElementType;
+import java.lang.annotation.Retention;
+import java.lang.annotation.RetentionPolicy;
+
+@Retention(RetentionPolicy.RUNTIME)
+@Target(ElementType.FIELD)
+
+public @interface MyAnnotation {
+ public String name();
+ public String value();
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/PackageSealingTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,52 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.lang.Package;
+
+public class PackageSealingTest {
+ public static void main(String args[]) {
+ try {
+ Class c1 = PackageSealingTest.class.forName("sealed.pkg.C1");
+ Class c2 = PackageSealingTest.class.forName("pkg.C2");
+ Package p1 = c1.getPackage();
+ System.out.println("Package 1: " + p1.toString());
+ Package p2 = c2.getPackage();
+ System.out.println("Package 2: " + p2.toString());
+
+ if (!p1.isSealed()) {
+ System.out.println("Failed: sealed.pkg is not sealed.");
+ System.exit(0);
+ }
+
+ if (p2.isSealed()) {
+ System.out.println("Failed: pkg is sealed.");
+ System.exit(0);
+ }
+
+ System.out.println("OK");
+ } catch (Exception e) {
+ System.out.println(e.getMessage());
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/PackageTest.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,56 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+package p;
+
+public class PackageTest {
+ public static void main(String args[]) {
+ (new PackageTest()).test();
+ }
+
+ private void test() {
+ ClassLoader cl = PackageTest.class.getClassLoader();
+ Package pkg_from_loader;
+ if (cl != null) {
+ pkg_from_loader = cl.getDefinedPackage("p");
+ } else {
+ pkg_from_loader = Package.getPackage("p");
+ }
+
+ Package pkg = PackageTest.class.getPackage();
+ if (pkg_from_loader != null && pkg == pkg_from_loader &&
+ pkg.getName().equals("p")) {
+ System.out.println("Expected package: " + pkg);
+ } else {
+ System.out.println("Unexpected package: " + pkg);
+ System.exit(1);
+ }
+ if (pkg.isSealed()) {
+ System.out.println("Package is sealed");
+ System.exit(1);
+ } else {
+ System.out.println("Package is not sealed");
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/ParallelClasses.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,64 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+class ParallelClass0 {}
+class ParallelClass1 {}
+class ParallelClass2 {}
+class ParallelClass3 {}
+class ParallelClass4 {}
+class ParallelClass5 {}
+class ParallelClass6 {}
+class ParallelClass7 {}
+class ParallelClass8 {}
+class ParallelClass9 {}
+class ParallelClass10 {}
+class ParallelClass11 {}
+class ParallelClass12 {}
+class ParallelClass13 {}
+class ParallelClass14 {}
+class ParallelClass15 {}
+class ParallelClass16 {}
+class ParallelClass17 {}
+class ParallelClass18 {}
+class ParallelClass19 {}
+class ParallelClass20 {}
+class ParallelClass21 {}
+class ParallelClass22 {}
+class ParallelClass23 {}
+class ParallelClass24 {}
+class ParallelClass25 {}
+class ParallelClass26 {}
+class ParallelClass27 {}
+class ParallelClass28 {}
+class ParallelClass29 {}
+class ParallelClass30 {}
+class ParallelClass31 {}
+class ParallelClass32 {}
+class ParallelClass33 {}
+class ParallelClass34 {}
+class ParallelClass35 {}
+class ParallelClass36 {}
+class ParallelClass37 {}
+class ParallelClass38 {}
+class ParallelClass39 {}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/ParallelLoad.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,220 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.io.*;
+import java.net.*;
+import java.lang.reflect.Field;
+
+
+// This test helper is parameterized by:
+// - class transformation mode: property "appcds.parallel.transform.mode"
+// - class loader test types
+//
+// In the case of transformMode == "cflh", the transformation is performed
+// by AppCDS/jvmti/TransformerAgent.java. The classes to be transformed, such as
+// ParallelClassTr0, are defined in ./jvmti/parallelLoad/ParallelClasses.java
+
+public class ParallelLoad {
+ public static int MAX_CLASSES = 40;
+ public static int NUM_THREADS = 4;
+
+ public final static int SYSTEM_LOADER = 0;
+ public final static int SINGLE_CUSTOM_LOADER = 1;
+ public final static int MULTI_CUSTOM_LOADER = 2;
+
+ public static final int FINGERPRINT_MODE = 1;
+ public static final int API_MODE = 2;
+
+ public static int loaderType = SYSTEM_LOADER;
+ public static ClassLoader classLoaders[];
+ public static int mode = FINGERPRINT_MODE;
+
+ public static float timeoutFactor =
+ Float.parseFloat(System.getProperty("test.timeout.factor", "1.0"));
+
+ public static void main(String args[]) throws Throwable {
+ run(args, null);
+ }
+ public static void run(String args[], ClassLoader loaders[]) throws Throwable {
+ String customJar = null;
+ System.out.println("ParallelLoad: timeoutFactor = " + timeoutFactor);
+
+ if (args.length >= 1) {
+ if ("SINGLE_CUSTOM_LOADER".equals(args[0])) {
+ loaderType = SINGLE_CUSTOM_LOADER;
+ customJar = args[2];
+ } else if ("MULTI_CUSTOM_LOADER".equals(args[0])) {
+ loaderType = MULTI_CUSTOM_LOADER;
+ customJar = args[2];
+ } else if ("SYSTEM_LOADER".equals(args[0])) {
+ loaderType = SYSTEM_LOADER;
+ } else {
+ throw new RuntimeException("Unexpected loaderType" + args[0]);
+ }
+ }
+
+ if (customJar != null) {
+ if ("FINGERPRINT_MODE".equals(args[1])) {
+ mode = FINGERPRINT_MODE;
+ classLoaders = new ClassLoader[NUM_THREADS];
+ for (int i=0; i<NUM_THREADS; i++) {
+ URL url = new File(customJar).toURI().toURL();
+ URL[] urls = new URL[] {url};
+ classLoaders[i] = new URLClassLoader(urls);
+ }
+ } else {
+ // Loaders must be supplied by caller of the run() method
+ mode = API_MODE;
+ classLoaders = loaders;
+ }
+ }
+
+ System.out.println("Start Parallel Load ...");
+
+ Thread thread[] = new Thread[NUM_THREADS];
+ for (int i=0; i<NUM_THREADS; i++) {
+ Thread t = new ParallelLoadThread(i);
+ t.start();
+ thread[i] = t;
+ }
+
+ Thread watchdog = new ParallelLoadWatchdog();
+ watchdog.setDaemon(true);
+ watchdog.start();
+
+ for (int i=0; i<NUM_THREADS; i++) {
+ thread[i].join();
+ }
+ System.out.println("Parallel Load ... done");
+ System.exit(0);
+ }
+}
+
+
+class ParallelLoadWatchdog extends Thread {
+ public void run() {
+ try {
+ long timeout = (long) (20 * 1000 * ParallelLoad.timeoutFactor);
+ Thread.sleep(timeout);
+ System.out.println("ParallelLoadWatchdog: Timeout reached: timeout(ms) = " + timeout);
+ System.exit(1);
+ } catch (Throwable t) {
+ t.printStackTrace();
+ System.exit(1);
+ }
+ }
+};
+
+
+class ParallelLoadThread extends Thread {
+ static int num_ready[] = new int[ParallelLoad.MAX_CLASSES];
+ static Object lock = new Object();
+ static String transformMode =
+ System.getProperty("appcds.parallel.transform.mode", "none");
+
+ int thread_id;
+ ParallelLoadThread(int thread_id) {
+ this.thread_id = thread_id;
+ }
+
+ public void run() {
+ try {
+ run0();
+ } catch (Throwable t) {
+ t.printStackTrace();
+ System.exit(1);
+ }
+ }
+
+ private static void log(String msg, Object... args) {
+ String msg0 = "ParallelLoadThread: " + String.format(msg, args);
+ System.out.println(msg0);
+ }
+
+ private void run0() throws Throwable {
+ for (int i=0; i<ParallelLoad.MAX_CLASSES; i++) {
+ synchronized(lock) {
+ num_ready[i] ++;
+ while (num_ready[i] < ParallelLoad.NUM_THREADS) {
+ lock.wait();
+ }
+ lock.notifyAll();
+ }
+ log("this = %s %d", this, i);
+ String className = "ParallelClass" + i;
+ if (transformMode.equals("cflh"))
+ className = "ParallelClassTr" + i;
+
+ Class clazz = null;
+
+ switch (ParallelLoad.loaderType) {
+ case ParallelLoad.SYSTEM_LOADER:
+ clazz = Class.forName(className);
+ break;
+ case ParallelLoad.SINGLE_CUSTOM_LOADER:
+ clazz = ParallelLoad.classLoaders[0].loadClass(className);
+ break;
+ case ParallelLoad.MULTI_CUSTOM_LOADER:
+ clazz = ParallelLoad.classLoaders[thread_id].loadClass(className);
+ break;
+ }
+
+ log("clazz = %s", clazz);
+ testTransformation(clazz);
+ }
+ }
+
+ private void testTransformation(Class c) throws Exception {
+ if (transformMode.equals("none"))
+ return;
+
+ // currently only cflh transform mode is supported
+ if (!transformMode.equals("cflh")) {
+ String msg = "wrong transform mode: " + transformMode;
+ throw new IllegalArgumentException(msg);
+ }
+
+ Field[] fields = c.getFields();
+ boolean fieldFound = false;
+ for (Field f : fields) {
+ if (f.getName().equals("testString")) {
+ checkTransformationString(c, (String) f.get(null));
+ fieldFound = true;
+ }
+ }
+
+ if (!fieldFound)
+ throw new RuntimeException ("Expected field 'testString' not found");
+ }
+
+ private void checkTransformationString(Class c, String actual) throws Exception {
+ String expected = "class-transform-check: this-has-been--transformed";
+ if (!actual.equals(expected)) {
+ String msg1 = "Transformation failed for class" + c.getName();
+ String msg2 = String.format("Expected: %s, actual: %s", expected, actual);
+ throw new RuntimeException(msg1 + "\n" + msg2);
+ }
+ }
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/Prohibited.jasm Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,30 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+package java/lang;
+
+public class Prohibited
+ version 51:0
+{
+} // end class Prohibited
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/ProhibitedHelper.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,57 @@
+/*
+ * Copyright (c) 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class ProhibitedHelper {
+ public static void main(String[] args) throws Throwable {
+
+ String className = "java.lang.Prohibited";
+ ClassLoader sysLoader = ClassLoader.getSystemClassLoader();
+ try {
+ Module unnamedModule = sysLoader.getUnnamedModule();
+ Class cls = Class.forName(unnamedModule, className);
+ System.out.println("cls " + cls);
+ throw new java.lang.RuntimeException(className +
+ "in a prohibited package shouldn't be loaded");
+ } catch (Exception e) {
+ e.printStackTrace();
+ if (!(e instanceof java.lang.SecurityException)) {
+ throw new java.lang.RuntimeException(
+ "SecurityException is expected to be thrown while loading " + className);
+ }
+ }
+
+ try {
+ Class cls = Class.forName(className, false, sysLoader);
+ System.out.println("cls " + cls);
+ throw new java.lang.RuntimeException(className +
+ "in a prohibited package shouldn't be loaded");
+ } catch (Exception e) {
+ e.printStackTrace();
+ if (!(e instanceof java.lang.ClassNotFoundException)) {
+ throw new java.lang.RuntimeException(
+ "ClassNotFoundException is expected to be thrown while loading " + className);
+ }
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/ProtDomain.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,53 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.security.ProtectionDomain;
+
+// See ../AppCDSProtectionDomain.java
+//
+// ProtDomain is stored in CDS archive.
+// ProtDomainOther is NOT stored in CDS archive.
+//
+// However, they should have the same ProtectionDomain instance.
+public class ProtDomain {
+ public static void main(String args[]) {
+ System.out.println("Testing ProtDomain");
+ ProtectionDomain mine = ProtDomain.class.getProtectionDomain();
+ ProtectionDomain his = ProtDomainOther.class.getProtectionDomain();
+
+ System.out.println("mine = " + mine);
+ System.out.println("his = " + his);
+
+ if (mine == his) {
+ System.out.println("Protection Domains match");
+ } else {
+ System.out.println("Protection Domains do not match!");
+ System.exit(1);
+ }
+ }
+}
+
+class ProtDomainOther {
+
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/ProtDomainB.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,53 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.security.ProtectionDomain;
+
+// See ../AppCDSProtectionDomain.java
+//
+// ProtDomainB is NOT stored in CDS archive.
+// ProtDomainBOther is stored in CDS archive.
+//
+// However, they should have the same ProtectionDomain instance.
+public class ProtDomainB {
+ public static void main(String args[]) {
+ System.out.println("Testing ProtDomainB");
+ ProtectionDomain mine = ProtDomainB.class.getProtectionDomain();
+ ProtectionDomain his = ProtDomainBOther.class.getProtectionDomain();
+
+ System.out.println("mine = " + mine);
+ System.out.println("his = " + his);
+
+ if (mine == his) {
+ System.out.println("Protection Domains match");
+ } else {
+ System.out.println("Protection Domains do not match!");
+ System.exit(1);
+ }
+ }
+}
+
+class ProtDomainBOther {
+
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/ReportMyLoader.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,31 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class ReportMyLoader {
+ public static void main(String args[]) {
+ System.out.println("ReportMyLoader's loader = " + ReportMyLoader.class.getClassLoader());
+ System.out.println("TestClassLoader.called = " + TestClassLoader.called);
+ }
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/RewriteBytecodes.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,55 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.io.File;
+import sun.hotspot.WhiteBox;
+
+public class RewriteBytecodes {
+ public static void main(String args[]) throws Throwable {
+ String from = "___xxx___";
+ String to = "___yyy___";
+ File clsFile = new File(args[0]);
+ Class superClass = Util.defineModifiedClass(RewriteBytecodes.class.getClassLoader(), clsFile, from, to);
+
+ Child child = new Child();
+
+ if (child.getClass().getSuperclass() != superClass) {
+ throw new RuntimeException("Mismatched super class");
+ }
+ // Even if the Super class is not loaded from the CDS archive, make sure the Child class
+ // can still be loaded successfully, and properly inherits from the rewritten version
+ // of Super.
+ if (!child.toString().equals(to)) {
+ throw new RuntimeException("Wrong output, expected: " + to + ", but got: " + child.toString());
+ }
+
+ WhiteBox wb = WhiteBox.getWhiteBox();
+ if (wb.isSharedClass(superClass)) {
+ throw new RuntimeException("wb.isSharedClass(superClass) should be false");
+ }
+ if (wb.isSharedClass(child.getClass())) {
+ throw new RuntimeException("wb.isSharedClass(child.getClass()) should be false");
+ }
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/Super.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,29 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class Super {
+ public String toString() {
+ return "___xxx___";
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/TestClassLoader.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,42 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+// This is a class loader that simply delegates all calls to its parent loader.
+
+public class TestClassLoader extends ClassLoader {
+ static boolean called = false;
+ ClassLoader parent;
+ public TestClassLoader(ClassLoader parent) {
+ super(parent);
+ this.parent = parent;
+ }
+
+ public Class<?> loadClass(String name, boolean resolve)
+ throws ClassNotFoundException
+ {
+ called = true;
+ System.out.println("TestClassLoader: loadClass(\"" + name + "\", " + resolve + ")");
+ return (super.loadClass(name, resolve));
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/TrySwitchMyLoader.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,36 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+public class TrySwitchMyLoader {
+ public static void main(String args[]) {
+ System.out.println("TrySwitchMyLoader's loader = " + ReportMyLoader.class.getClassLoader());
+ System.setProperty("java.system.class.loader", "TestClassLoader");
+
+ // This should still report the same loader as TrySwitchMyLoader.class.getClassLoader(),
+ // as setting the java.system.class.loader after main method has been executed
+ // has no effect.
+ ReportMyLoader.main(args);
+ }
+}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/Util.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,156 @@
+/*
+ * Copyright (c) 2015, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+import java.io.*;
+import java.lang.reflect.*;
+import java.util.jar.*;
+
+public class Util {
+ /**
+ * Invoke the loader.defineClass() class method to define the class stored in clsFile,
+ * with the following modification:
+ * <ul>
+ * <li> All ASCII strings in the class file bytes that matches fromString will be replaced with toString.
+ * NOTE: the two strings must be the exact same length.
+ * </ul>
+ */
+ public static Class defineModifiedClass(ClassLoader loader, File clsFile, String fromString, String toString)
+ throws FileNotFoundException, IOException, NoSuchMethodException, IllegalAccessException,
+ InvocationTargetException
+ {
+ DataInputStream dis = new DataInputStream(new FileInputStream(clsFile));
+ byte[] buff = new byte[(int)clsFile.length()];
+ dis.readFully(buff);
+ replace(buff, fromString, toString);
+
+ System.out.println("Loading from: " + clsFile + " (" + buff.length + " bytes)");
+
+ Method defineClass = ClassLoader.class.getDeclaredMethod("defineClass",
+ buff.getClass(), int.class, int.class);
+ defineClass.setAccessible(true);
+
+ // We directly call into ClassLoader.defineClass() to define the "Super" class. Also,
+ // rewrite its classfile so that it returns ___yyy___ instead of ___xxx___. Changing the
+ // classfile will guarantee that this class will NOT be loaded from the CDS archive.
+ Class cls = (Class)defineClass.invoke(loader, buff, new Integer(0), new Integer(buff.length));
+ System.out.println("Loaded : " + cls);
+
+ return cls;
+ }
+
+ /**
+ * @return the number of occurrences of the <code>from</code> string that
+ * have been replaced.
+ */
+ public static int replace(byte buff[], String from, String to) {
+ if (to.length() != from.length()) {
+ throw new RuntimeException("bad strings");
+ }
+ byte f[] = asciibytes(from);
+ byte t[] = asciibytes(to);
+ byte f0 = f[0];
+
+ int numReplaced = 0;
+ int max = buff.length - f.length;
+ for (int i=0; i<max; ) {
+ if (buff[i] == f0 && replace(buff, f, t, i)) {
+ i += f.length;
+ numReplaced ++;
+ } else {
+ i++;
+ }
+ }
+ return numReplaced;
+ }
+
+ public static boolean replace(byte buff[], byte f[], byte t[], int i) {
+ for (int x=0; x<f.length; x++) {
+ if (buff[x+i] != f[x]) {
+ return false;
+ }
+ }
+ for (int x=0; x<f.length; x++) {
+ buff[x+i] = t[x];
+ }
+ return true;
+ }
+
+ static byte[] asciibytes(String s) {
+ byte b[] = new byte[s.length()];
+ for (int i=0; i<b.length; i++) {
+ b[i] = (byte)s.charAt(i);
+ }
+ return b;
+ }
+
+ public static Class defineClassFromJAR(ClassLoader loader, File jarFile, String className)
+ throws FileNotFoundException, IOException, NoSuchMethodException, IllegalAccessException,
+ InvocationTargetException {
+ return defineClassFromJAR(loader, jarFile, className, null, null);
+ }
+
+ /**
+ * Invoke the loader.defineClass() class method to define the named class stored in a JAR file.
+ *
+ * If a class exists both in the classpath, as well as in the list of URLs of a URLClassLoader,
+ * by default, the URLClassLoader will not define the class, and instead will delegate to the
+ * app loader. This method is an easy way to force the class to be defined by the URLClassLoader.
+ *
+ * Optionally, you can modify the contents of the classfile buffer. See comments in
+ * defineModifiedClass.
+ */
+ public static Class defineClassFromJAR(ClassLoader loader, File jarFile, String className,
+ String fromString, String toString)
+ throws FileNotFoundException, IOException, NoSuchMethodException, IllegalAccessException,
+ InvocationTargetException
+ {
+ byte[] buff = getClassFileFromJar(jarFile, className);
+
+ if (fromString != null) {
+ replace(buff, fromString, toString);
+ }
+
+ //System.out.println("Loading from: " + ent + " (" + buff.length + " bytes)");
+
+ Method defineClass = ClassLoader.class.getDeclaredMethod("defineClass",
+ buff.getClass(), int.class, int.class);
+ defineClass.setAccessible(true);
+ Class cls = (Class)defineClass.invoke(loader, buff, new Integer(0), new Integer(buff.length));
+
+ //System.out.println("Loaded : " + cls);
+ return cls;
+ }
+
+ public static byte[] getClassFileFromJar(File jarFile, String className) throws FileNotFoundException, IOException {
+ JarFile jf = new JarFile(jarFile);
+ JarEntry ent = jf.getJarEntry(className.replace('.', '/') + ".class");
+
+ DataInputStream dis = new DataInputStream(jf.getInputStream(ent));
+ byte[] buff = new byte[(int)ent.getSize()];
+ dis.readFully(buff);
+ dis.close();
+
+ return buff;
+ }
+}
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/VerifierTest0.java Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,75 @@
+/*
+ * Copyright (c) 2014, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+/*
+ * Note: verifier_test_tmp.jar will be processed by ../AppCDSVerifierTest.java to
+ * create verifier_test.jar, which contains invalid versions of UnverifiableBase
+ * and UnverifiableIntf.
+ */
+
+public class VerifierTest0 {
+ public static void main(String args[]) {
+ boolean good = true;
+ good &= mustBeInvalid("VerifierTestA");
+ good &= mustBeInvalid("VerifierTestB");
+ good &= mustBeInvalid("VerifierTestC");
+ good &= mustBeInvalid("VerifierTestD");
+ good &= mustBeInvalid("VerifierTestE");
+ if (!good) {
+ System.out.println("VerifierTest0 failed");
+ System.exit(1);
+ }
+ }
+
+ /** @return false means error */
+ static boolean mustBeInvalid(String className) {
+ System.out.println("Testing: " + className);
+ try {
+ Class.forName(className);
+ System.out.println("ERROR: class " + className + " was loaded unexpectedly.");
+ return false;
+ } catch (Throwable t) {
+ System.out.println("Expected exception:");
+ t.printStackTrace();
+ return true;
+ }
+ }
+}
+
+class UnverifiableBase {
+ static final VerifierTest0 x = new VerifierTest0(); // <- this static initializer will be made unverifiable by type mismatch
+}
+
+interface UnverifiableIntf {
+ static final VerifierTest0 x = new VerifierTest0(); // <- this static initializer will be made unverifiable by type mismatch
+}
+
+interface UnverifiableIntfSub extends UnverifiableIntf {}
+
+class VerifierTestA extends UnverifiableBase {}
+class VerifierTestB extends VerifierTestA {}
+class VerifierTestC implements UnverifiableIntf {}
+class VerifierTestD extends VerifierTestC {}
+class VerifierTestE implements UnverifiableIntfSub {}
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/com/sun/tools/javac/Main.jasm Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,30 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+package com/sun/tools/javac;
+
+public class Main
+ version 51:0
+{
+} // end class Main
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/cpattr1.mf Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,3 @@
+Manifest-Version: 1.0
+Class-Path: cpattr2.jar
+Created-By: 1.9.0-internal (Oracle Corporation)
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/cpattr1_long.mf Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,18 @@
+Manifest-Version: 1.0
+Class-Path: zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.ja
+ r zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz
+ .jar xx.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.j
+ ar zzzzzzz.jar xx.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar
+ zzzzzzz.jar zzzzzzz.jar xx.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar z
+ zzzzzz.jar zzzzzzz.jar zzzzzzz.jar xx.jar zzzzzzz.jar zzzzzzz.jar zzz
+ zzzz.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar xx.jar zzzzzzz.jar zzzzz
+ zz.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar xx.jar zzzzzzz
+ .jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar xx.j
+ ar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar zzzzzz
+ z.jar xx.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.
+ jar zzzzzzz.jar xx.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.ja
+ r zzzzzzz.jar zzzzzzz.jar xx.jar zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar
+ zzzzzzz.jar zzzzzzz.jar zzzzzzz.jar xx.jar cpattr2.jar cpattr1_long.j
+ ar
+Created-By: 1.9.0-internal (Oracle Corporation)
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/cpattr2.mf Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,4 @@
+Manifest-Version: 1.0
+Class-Path: cpattr3.jar cpattr5_123456789_223456789_323456789_42345678
+ 9_523456789_623456789.jar
+Created-By: 1.9.0-internal (Oracle Corporation)
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/cpattr3.mf Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,2 @@
+Manifest-Version: 1.0
+Created-By: 1.9.0-internal (Oracle Corporation)
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/cpattr4.mf Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,2 @@
+Manifest-Version: 1.0
+Created-By: 1.9.0-internal (Oracle Corporation)
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/cpattr5_extra_long.mf Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,3 @@
+Manifest-Version: 1.0
+Created-By: 1.9.0-internal (Oracle Corporation)
+
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/java/net/HttpCookie.jasm Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,37 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+package java/net;
+
+public class HttpCookie
+ version 51:0
+{
+
+public Method thisClassIsDummy:"()V"
+ stack 0 locals 0
+{
+ return;
+}
+
+} // end class HttpCookie
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/javax/activation/MimeType.jasm Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,37 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+package javax/activation;
+
+public class MimeType
+ version 51:0
+{
+
+public Method thisClassIsDummy:"()V"
+ stack 0 locals 0
+{
+ return;
+}
+
+} // end class MimeType
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/javax/transaction/InvalidTransactionException.jasm Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,37 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+package javax/transaction;
+
+public class InvalidTransactionException
+ version 51:0
+{
+
+public Method thisClassIsDummy:"()V"
+ stack 0 locals 0
+{
+ return;
+}
+
+} // end class InvalidTransactionException
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/jdk/dynalink/DynamicLinker.jasm Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,37 @@
+/*
+ * Copyright (c) 2016, 2017, Oracle and/or its affiliates. All rights reserved.
+ * DO NOT ALTER OR REMOVE COPYRIGHT NOTICES OR THIS FILE HEADER.
+ *
+ * This code is free software; you can redistribute it and/or modify it
+ * under the terms of the GNU General Public License version 2 only, as
+ * published by the Free Software Foundation.
+ *
+ * This code is distributed in the hope that it will be useful, but WITHOUT
+ * ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or
+ * FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License
+ * version 2 for more details (a copy is included in the LICENSE file that
+ * accompanied this code).
+ *
+ * You should have received a copy of the GNU General Public License version
+ * 2 along with this work; if not, write to the Free Software Foundation,
+ * Inc., 51 Franklin St, Fifth Floor, Boston, MA 02110-1301 USA.
+ *
+ * Please contact Oracle, 500 Oracle Parkway, Redwood Shores, CA 94065 USA
+ * or visit www.oracle.com if you need additional information or have any
+ * questions.
+ *
+ */
+
+package jdk/dynalink;
+
+public class DynamicLinker
+ version 51:0
+{
+
+public Method thisClassIsDummy:"()V"
+ stack 0 locals 2
+{
+ return;
+}
+
+} // end class DynamicLinker
--- /dev/null Thu Jan 01 00:00:00 1970 +0000
+++ b/test/hotspot/jtreg/runtime/appcds/test-classes/package_seal.mf Mon Nov 27 20:21:34 2017 -0800
@@ -0,0 +1,6 @@
+Manifest-Version: 1.0
+Created-By: 1.9.0-internal (Oracle Corporation)
+
+Name: sealed/pkg/
+Sealed: true
+